Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C37H5_12
(1068 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25146278|ref|NP_504299.2| alpha/beta hydrolase fold family me... 682 0.0
gi|7497169|pir||T25621 hypothetical protein C37H5.2 - Caenorhabd... 672 0.0
gi|17558492|ref|NP_504297.1| alpha/beta hydrolase fold family me... 556 e-157
gi|32566936|ref|NP_872178.1| alpha/beta hydrolase fold (5F325) [... 553 e-156
gi|39582243|emb|CAE64194.1| Hypothetical protein CBG08821 [Caeno... 525 e-148
gi|31204749|ref|XP_311323.1| ENSANGP00000017492 [Anopheles gambi... 248 2e-64
gi|19527302|ref|NP_598837.1| abhydrolase domain containing 4 [Mu... 243 5e-63
gi|26326239|dbj|BAC26863.1| unnamed protein product [Mus musculus] 243 5e-63
gi|34875013|ref|XP_344404.1| similar to RIKEN cDNA 1110035H23 [R... 242 1e-62
gi|50658087|ref|NP_071343.2| abhydrolase domain containing 4 [Ho... 237 4e-61
gi|10434528|dbj|BAB14289.1| unnamed protein product [Homo sapiens] 235 1e-60
gi|50732804|ref|XP_418772.1| PREDICTED: similar to CGI58 protein... 227 4e-58
gi|47228100|emb|CAF97729.1| unnamed protein product [Tetraodon n... 226 7e-58
gi|47058978|ref|NP_997689.1| CGI-58-like protein [Rattus norvegi... 220 5e-56
gi|13385690|ref|NP_080455.1| CGI58 homolog [Mus musculus] >gnl|B... 219 6e-56
gi|31223313|ref|XP_317294.1| ENSANGP00000010452 [Anopheles gambi... 218 2e-55
gi|31542303|ref|NP_057090.2| CGI58 protein; comparative gene ide... 217 3e-55
gi|39589614|emb|CAE66849.1| Hypothetical protein CBG12221 [Caeno... 216 7e-55
gi|49904089|gb|AAH76814.1| Unknown (protein for MGC:83784) [Xeno... 215 1e-54
gi|24586387|ref|NP_724609.1| CG1882-PB [Drosophila melanogaster]... 214 3e-54
gi|24586385|ref|NP_610326.1| CG1882-PA [Drosophila melanogaster]... 214 3e-54
gi|4929585|gb|AAD34053.1| CGI-58 protein [Homo sapiens] 214 3e-54
gi|34866618|ref|XP_236775.2| similar to CGI58 homolog [Rattus no... 203 5e-51
gi|47213761|emb|CAF95590.1| unnamed protein product [Tetraodon n... 202 1e-50
gi|13278319|gb|AAH03982.1| Abhd4 protein [Mus musculus] 200 5e-50
gi|17505715|ref|NP_492685.1| abhydrolase domain containing 4 lik... 190 5e-47
gi|46436828|gb|EAK96184.1| hypothetical protein CaO19.7166 [Cand... 120 7e-26
gi|7446839|pir||T13464 hypothetical protein T19F6.150 - Arabidop... 116 8e-25
gi|30686425|ref|NP_194147.2| hydrolase, alpha/beta fold family p... 116 8e-25
gi|50550969|ref|XP_502958.1| hypothetical protein [Yarrowia lipo... 115 1e-24
gi|49093444|ref|XP_408183.1| hypothetical protein AN4046.2 [Aspe... 110 4e-23
gi|26386509|dbj|BAB31755.2| unnamed protein product [Mus musculus] 108 2e-22
gi|38106762|gb|EAA53029.1| hypothetical protein MG06157.4 [Magna... 107 5e-22
gi|49080794|ref|XP_403876.1| hypothetical protein UM06261.1 [Ust... 105 1e-21
gi|42573017|ref|NP_974605.1| hydrolase, alpha/beta fold family p... 105 2e-21
gi|46121259|ref|XP_385184.1| hypothetical protein FG05008.1 [Gib... 105 2e-21
gi|19115012|ref|NP_594100.1| hypothetical protein [Schizosacchar... 102 2e-20
gi|50554765|ref|XP_504791.1| hypothetical protein [Yarrowia lipo... 99 2e-19
gi|13879404|gb|AAH06683.1| Abhd5 protein [Mus musculus] 99 2e-19
gi|6323128|ref|NP_013200.1| Protein of unknown function, null mu... 97 5e-19
gi|50548165|ref|XP_501552.1| hypothetical protein [Yarrowia lipo... 97 8e-19
gi|50426343|ref|XP_461768.1| unnamed protein product [Debaryomyc... 93 9e-18
gi|6320330|ref|NP_010410.1| Protein of unknown function, similar... 91 6e-17
gi|50416218|ref|XP_457537.1| unnamed protein product [Debaryomyc... 89 1e-16
gi|50425479|ref|XP_461333.1| unnamed protein product [Debaryomyc... 89 2e-16
gi|45201157|ref|NP_986727.1| AGR062Cp [Eremothecium gossypii] >g... 89 2e-16
gi|6066421|emb|CAB58288.1| possible acetyltransferase [Leishmani... 88 3e-16
gi|32411413|ref|XP_326187.1| hypothetical protein [Neurospora cr... 87 9e-16
gi|47229495|emb|CAF99483.1| unnamed protein product [Tetraodon n... 84 7e-15
gi|50294856|ref|XP_449839.1| unnamed protein product [Candida gl... 84 7e-15
gi|50311859|ref|XP_455961.1| unnamed protein product [Kluyveromy... 81 4e-14
gi|46432550|gb|EAK92027.1| hypothetical protein CaO19.4210 [Cand... 80 6e-14
gi|23125449|ref|ZP_00107382.1| COG0596: Predicted hydrolases or ... 79 2e-13
gi|30315299|gb|AAP30860.1| acetyltranferase [Trypanosoma cruzi] 76 2e-12
gi|50257991|gb|EAL20685.1| hypothetical protein CNBE0500 [Crypto... 76 2e-12
gi|50304313|ref|XP_452106.1| unnamed protein product [Kluyveromy... 75 3e-12
gi|50426633|ref|XP_461914.1| unnamed protein product [Debaryomyc... 74 4e-12
gi|50285253|ref|XP_445055.1| unnamed protein product [Candida gl... 74 7e-12
gi|45185211|ref|NP_982928.1| ABL019Wp [Eremothecium gossypii] >g... 73 1e-11
gi|1871461|dbj|BAA12150.1| 2-hydroxy-6-oxo-7-methylocta-2,4-dien... 72 2e-11
gi|46436017|gb|EAK95387.1| hypothetical protein CaO19.3607 [Cand... 72 2e-11
gi|12746343|gb|AAK07450.1| triacylglycerol acyl hydrolase [Morit... 72 2e-11
gi|46436073|gb|EAK95442.1| hypothetical protein CaO19.11090 [Can... 72 2e-11
gi|48895268|ref|ZP_00328252.1| COG0596: Predicted hydrolases or ... 72 2e-11
gi|24158682|pdb|1IUN|A Chain A, Meta-Cleavage Product Hydrolase ... 71 4e-11
gi|48863920|ref|ZP_00317813.1| COG0596: Predicted hydrolases or ... 70 1e-10
gi|32040840|ref|ZP_00138423.1| COG0596: Predicted hydrolases or ... 69 1e-10
gi|15596026|ref|NP_249520.1| probable hydrolase [Pseudomonas aer... 69 1e-10
gi|46120192|ref|ZP_00179561.2| COG0596: Predicted hydrolases or ... 68 3e-10
gi|21388666|dbj|BAC00790.1| hydrolase [Rhodococcus sp. YK2] 68 4e-10
gi|29826578|ref|NP_821212.1| putative hydrolase [Streptomyces av... 68 4e-10
gi|17231390|ref|NP_487938.1| similar to 2-hydroxy-6-ketonona-2,4... 67 7e-10
gi|48891863|ref|ZP_00325312.1| COG0596: Predicted hydrolases or ... 67 7e-10
gi|29828288|ref|NP_822922.1| putative hydrolase [Streptomyces av... 67 9e-10
gi|6321548|ref|NP_011625.1| Hypothetical ORF; Ygr110wp [Saccharo... 67 9e-10
gi|41408930|ref|NP_961766.1| hypothetical protein MAP2832 [Mycob... 66 1e-09
gi|50293121|ref|XP_448979.1| unnamed protein product [Candida gl... 66 1e-09
gi|15234433|ref|NP_195371.1| hydrolase, alpha/beta fold family p... 66 2e-09
gi|15609852|ref|NP_217231.1| hypothetical protein Rv2715 [Mycoba... 66 2e-09
gi|48789096|ref|ZP_00285075.1| COG0596: Predicted hydrolases or ... 66 2e-09
gi|30690680|ref|NP_849507.1| hydrolase, alpha/beta fold family p... 66 2e-09
gi|47572120|ref|ZP_00242166.1| COG0596: Predicted hydrolases or ... 65 3e-09
gi|49477056|ref|YP_035278.1| lipase, alpha/beta hydrolase fold f... 65 3e-09
gi|48855589|ref|ZP_00309748.1| COG0596: Predicted hydrolases or ... 65 3e-09
gi|4104768|gb|AAD02150.1| hydroxymuconic semialdehyde hydrolase ... 65 3e-09
gi|20808897|ref|NP_624068.1| predicted hydrolases or acyltransfe... 64 5e-09
gi|46312763|ref|ZP_00213357.1| COG0596: Predicted hydrolases or ... 64 6e-09
gi|42780196|ref|NP_977443.1| hydrolase, alpha/beta fold family [... 64 6e-09
gi|47564986|ref|ZP_00236030.1| lipase, putative [Bacillus cereus... 64 6e-09
gi|32038021|ref|ZP_00136293.1| COG0596: Predicted hydrolases or ... 64 6e-09
gi|15598145|ref|NP_251639.1| probable lipase [Pseudomonas aerugi... 64 6e-09
gi|49085442|gb|AAT51278.1| PA2949 [synthetic construct] 64 6e-09
gi|46191740|ref|ZP_00007957.2| COG0596: Predicted hydrolases or ... 64 8e-09
gi|45657654|ref|YP_001740.1| alpha/beta hydrolase [Leptospira in... 64 8e-09
gi|47078061|gb|AAT09778.1| XylF [Pseudomonas sp. ST41] 64 8e-09
gi|19033979|gb|AAL83662.1| 2-hydroxymuconic semialdehyde hydrola... 63 1e-08
gi|3184043|emb|CAA06969.1| 2-hydroxy-6-oxohepta-2,4-dienoate hyd... 63 1e-08
gi|23468546|ref|ZP_00123881.1| COG0596: Predicted hydrolases or ... 63 1e-08
gi|45547260|ref|ZP_00187314.1| COG0596: Predicted hydrolases or ... 63 1e-08
gi|16127955|ref|NP_422519.1| hydrolase, alpha/beta hydrolase fol... 62 2e-08
gi|28869862|ref|NP_792481.1| 3-oxoadipate enol-lactone hydrolase... 62 2e-08
gi|15242419|ref|NP_196505.1| hydrolase, alpha/beta fold family p... 62 2e-08
gi|21398958|ref|NP_654943.1| abhydrolase, alpha/beta hydrolase f... 62 2e-08
gi|15806369|ref|NP_295075.1| dihydrolipoamide acetyltransferase-... 62 2e-08
gi|30261143|ref|NP_843520.1| hydrolase, alpha/beta fold family [... 62 2e-08
gi|42781311|ref|NP_978558.1| hydrolase, alpha/beta fold family [... 62 2e-08
gi|24214832|ref|NP_712313.1| Predicted hydrolases or acyltransfe... 62 2e-08
gi|13357577|ref|NP_077851.1| triacylglycerol lipase [Ureaplasma ... 62 2e-08
gi|14715451|dbj|BAB62053.1| 2-hydroxymuconic semialdehyde hydrol... 62 2e-08
gi|2293076|emb|CAB06612.1| 2-hydroxymuconic semialdehyde hydrola... 62 2e-08
gi|33865215|ref|NP_896774.1| predicted alpha/beta hydrolase supe... 62 2e-08
gi|18976852|ref|NP_578209.1| lysophospholipase [Pyrococcus furio... 62 3e-08
gi|23121697|ref|ZP_00103911.1| COG0596: Predicted hydrolases or ... 62 3e-08
gi|22969948|ref|ZP_00017135.1| hypothetical protein [Chloroflexu... 62 3e-08
gi|32562911|dbj|BAC79225.1| HOPDA hydrolase [Bacillus sp. JF8] 62 3e-08
gi|46441993|gb|EAL01286.1| hypothetical protein CaO19.7943 [Cand... 62 3e-08
gi|13472482|ref|NP_104049.1| dihydrolipoamide S-acetyltransferas... 62 3e-08
gi|135976|sp|P23133|TODF_PSEPU 2-hydroxy-6-oxo-2,4-heptadienoate... 62 3e-08
gi|30019182|ref|NP_830813.1| Lipase [Bacillus cereus ATCC 14579]... 61 4e-08
gi|48733453|ref|ZP_00267196.1| COG0596: Predicted hydrolases or ... 61 4e-08
gi|46441857|gb|EAL01151.1| hypothetical protein CaO19.312 [Candi... 61 4e-08
gi|13374854|emb|CAC34488.1| putative protein [Arabidopsis thaliana] 61 4e-08
gi|46434132|gb|EAK93551.1| hypothetical protein CaO19.14220 [Can... 61 4e-08
gi|22326938|ref|NP_680183.1| hydrolase, alpha/beta fold family p... 61 4e-08
gi|48731582|ref|ZP_00265327.1| COG0596: Predicted hydrolases or ... 61 5e-08
gi|7428100|pir||JC5419 2-hydroxymuconate-semialdehyde hydrolase ... 61 5e-08
gi|32469927|ref|NP_863101.1| 2-hydroxymuconic semialdehyde hydro... 61 5e-08
gi|44238928|gb|AAS46919.1| 2-hydroxymuconic semiadehyde hydrolas... 61 5e-08
gi|45548093|ref|ZP_00188129.1| COG0596: Predicted hydrolases or ... 60 7e-08
gi|48854159|ref|ZP_00308323.1| COG0596: Predicted hydrolases or ... 60 9e-08
gi|46312689|ref|ZP_00213283.1| COG0596: Predicted hydrolases or ... 60 9e-08
gi|17425268|dbj|BAB78766.1| 2-hydroxy-6-(2'-hydroxyphenyl)-6-oxo... 60 9e-08
gi|28971833|dbj|BAC65436.1| putative 2-hydroxymuconic semialdehy... 60 9e-08
gi|50120273|ref|YP_049440.1| putative hydrolase [Erwinia carotov... 60 1e-07
gi|23102382|ref|ZP_00088893.1| COG0596: Predicted hydrolases or ... 60 1e-07
gi|3176649|gb|AAC46394.1| 2-hydroxy-6-oxo-2,4-heptadienoate hydr... 60 1e-07
gi|23102229|ref|ZP_00088749.1| COG0596: Predicted hydrolases or ... 60 1e-07
gi|33862155|ref|NP_893716.1| conserved hypothetical protein [Pro... 60 1e-07
gi|1177721|gb|AAB17100.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dieno... 60 1e-07
gi|95475|pir||D42462 dihydrolipoamide S-acetyltransferase (EC 2.... 60 1e-07
gi|113138|sp|P27747|ACOC_ALCEU Dihydrolipoyllysine-residue acety... 60 1e-07
gi|22975019|ref|ZP_00021096.1| hypothetical protein [Chloroflexu... 59 1e-07
gi|3059193|dbj|BAA25612.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dien... 59 1e-07
gi|45513842|ref|ZP_00165408.1| COG0596: Predicted hydrolases or ... 59 1e-07
gi|46188847|ref|ZP_00123770.2| COG0596: Predicted hydrolases or ... 59 1e-07
gi|46132132|ref|ZP_00170511.2| COG0596: Predicted hydrolases or ... 59 1e-07
gi|23126297|ref|ZP_00108198.1| COG0596: Predicted hydrolases or ... 59 1e-07
gi|3077808|dbj|BAA25795.1| esterase2 [Acetobacter pasteurianus] 59 2e-07
gi|2822275|gb|AAC03446.1| 2-hydroxy-6-oxo-7-methylocta-2,4-dieno... 59 2e-07
gi|30020469|ref|NP_832100.1| Proline iminopeptidase [Bacillus ce... 59 2e-07
gi|118690|sp|P19076|DMPD_PSEUF 2-hydroxymuconic semialdehyde hyd... 59 2e-07
gi|2627154|dbj|BAA23557.1| 2-hydroxymuconic semialdehyde hydrola... 59 2e-07
gi|47573717|ref|ZP_00243755.1| COG0596: Predicted hydrolases or ... 59 2e-07
gi|21673359|ref|NP_661424.1| dihydrolipoamide acetyltransferase,... 59 2e-07
gi|31239345|ref|XP_320086.1| ENSANGP00000018355 [Anopheles gambi... 59 2e-07
gi|7521901|pir||T30900 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate... 59 2e-07
gi|31194811|ref|XP_306353.1| ENSANGP00000002016 [Anopheles gambi... 59 2e-07
gi|48732965|ref|ZP_00266708.1| COG0596: Predicted hydrolases or ... 59 2e-07
gi|10956983|ref|NP_049203.1| 2-hydroxymuconic semialdehyde hydro... 59 2e-07
gi|6625512|emb|CAB63926.1| esterase [Ralstonia metallidurans] 59 2e-07
gi|10441628|gb|AAG17130.1| hypothetical CdoFa [Comamonas sp. JS765] 58 3e-07
gi|48772555|ref|ZP_00276897.1| COG0596: Predicted hydrolases or ... 58 3e-07
gi|23013999|ref|ZP_00053841.1| COG0596: Predicted hydrolases or ... 58 3e-07
gi|12804563|gb|AAH01698.1| Abhydrolase domain containing 6 [Homo... 58 3e-07
gi|26987291|ref|NP_742716.1| acetoin dehydrogenase, dihydrolipoa... 58 4e-07
gi|9963839|gb|AAG09720.1| lipase [Homo sapiens] 58 4e-07
gi|15614842|ref|NP_243145.1| BH2279~unknown conserved protein [B... 58 4e-07
gi|49477545|ref|YP_036330.1| proline iminopeptidase [Bacillus th... 58 4e-07
gi|46323559|ref|ZP_00223923.1| COG0596: Predicted hydrolases or ... 58 4e-07
gi|46315484|ref|ZP_00216066.1| COG0596: Predicted hydrolases or ... 58 4e-07
gi|21221335|ref|NP_627114.1| putative hydrolase [Streptomyces co... 58 4e-07
gi|47570092|ref|ZP_00240751.1| proline iminopeptidase-related pr... 58 4e-07
gi|30262232|ref|NP_844609.1| hydrolase, alpha/beta fold family [... 57 6e-07
gi|26990356|ref|NP_745781.1| hydrolase, alpha/beta fold family [... 57 6e-07
gi|48788458|ref|ZP_00284437.1| COG0596: Predicted hydrolases or ... 57 6e-07
gi|2098617|gb|AAB57641.1| 2-hydroxy-6-phenyl-6-oxo-2,4-dienoic a... 57 6e-07
gi|21400094|ref|NP_656079.1| abhydrolase, alpha/beta hydrolase f... 57 6e-07
gi|45523495|ref|ZP_00174851.1| COG0596: Predicted hydrolases or ... 57 6e-07
gi|41406596|ref|NP_959432.1| hypothetical protein MAP0498 [Mycob... 57 6e-07
gi|37523246|ref|NP_926623.1| hypothetical protein gll3677 [Gloeo... 57 6e-07
gi|49070714|ref|XP_399646.1| hypothetical protein UM02031.1 [Ust... 57 6e-07
gi|42784060|ref|NP_981307.1| hydrolase, alpha/beta fold family [... 57 6e-07
gi|7531037|sp|Q59695|ACOC_PSEPU Dihydrolipoyllysine-residue acet... 57 7e-07
gi|39582925|emb|CAE72990.1| Hypothetical protein CBG20335 [Caeno... 57 7e-07
gi|28870428|ref|NP_793047.1| hydrolase, alpha/beta fold family [... 57 7e-07
gi|16330114|ref|NP_440842.1| unknown protein [Synechocystis sp. ... 57 7e-07
gi|17232117|ref|NP_488665.1| hypothetical protein [Nostoc sp. PC... 57 7e-07
gi|48786874|ref|ZP_00282956.1| COG0596: Predicted hydrolases or ... 57 7e-07
gi|46314783|ref|ZP_00215368.1| COG0596: Predicted hydrolases or ... 57 7e-07
gi|47271495|ref|NP_065727.3| abhydrolase domain containing 6; li... 57 7e-07
gi|45683517|ref|ZP_00194950.1| COG0596: Predicted hydrolases or ... 57 7e-07
gi|41053091|dbj|BAD08034.1| hydrolase, alpha/beta fold family-li... 57 9e-07
gi|21219010|ref|NP_624789.1| putative hydrolase [Streptomyces co... 57 9e-07
gi|17229548|ref|NP_486096.1| hypothetical protein [Nostoc sp. PC... 57 9e-07
gi|42782360|ref|NP_979607.1| hydrolase, alpha/beta fold family [... 57 9e-07
gi|32038137|ref|ZP_00136409.1| COG0596: Predicted hydrolases or ... 56 1e-06
gi|48771539|ref|ZP_00275881.1| COG0596: Predicted hydrolases or ... 56 1e-06
gi|46135268|ref|ZP_00162633.2| COG0596: Predicted hydrolases or ... 56 1e-06
gi|31560264|ref|NP_079617.2| abhydrolase domain containing 6 [Mu... 56 1e-06
gi|49087432|gb|AAT51458.1| PA3053 [synthetic construct] 56 1e-06
gi|12857885|dbj|BAB31136.1| unnamed protein product [Mus musculus] 56 1e-06
gi|15598249|ref|NP_251743.1| probable hydrolytic enzyme [Pseudom... 56 1e-06
gi|22971843|ref|ZP_00018763.1| hypothetical protein [Chloroflexu... 56 1e-06
gi|30021420|ref|NP_833051.1| 3-Oxoadipate enol-lactonase [Bacill... 56 1e-06
gi|25406548|pir||E96811 hypothetical protein T11I11.15 [imported... 56 1e-06
gi|29654528|ref|NP_820220.1| hydrolase, alpha/beta hydrolase fol... 56 1e-06
gi|18411865|ref|NP_565173.1| hydrolase, alpha/beta fold family p... 56 1e-06
gi|3273241|dbj|BAA31164.1| EtbD2 [Rhodococcus sp.] >gnl|BL_ORD_I... 56 2e-06
gi|1346454|sp|Q02104|LIP1_PSYIM LIPASE 1 PRECURSOR (TRIACYLGLYCE... 56 2e-06
gi|15610705|ref|NP_218086.1| hypothetical protein Rv3569c [Mycob... 56 2e-06
gi|41407808|ref|NP_960644.1| hypothetical protein MAP1710 [Mycob... 56 2e-06
gi|17227812|ref|NP_484360.1| 2-hydroxy-6-oxohepta-2,4-dienoate h... 55 2e-06
gi|6630546|gb|AAF19565.1| putative alpha/beta hydrolase [Arabido... 55 2e-06
gi|27380457|ref|NP_771986.1| blr5346 [Bradyrhizobium japonicum U... 55 2e-06
gi|23123813|ref|ZP_00105853.1| COG0596: Predicted hydrolases or ... 55 2e-06
gi|17227689|ref|NP_484237.1| haloalkane dehalogenase [Nostoc sp.... 55 2e-06
gi|26450364|dbj|BAC42298.1| putative alpha/beta hydrolase [Arabi... 55 2e-06
gi|46130421|ref|ZP_00202321.1| COG0596: Predicted hydrolases or ... 55 2e-06
gi|47564952|ref|ZP_00235996.1| carboxylesterase NP [Bacillus cer... 55 2e-06
gi|3641341|gb|AAC36352.1| lactone-specific esterase [Pseudomonas... 55 2e-06
gi|23121275|ref|ZP_00103625.1| COG0596: Predicted hydrolases or ... 55 2e-06
gi|126303|sp|P24640|LIP3_MORS1 Lipase 3 precursor (Triacylglycer... 55 2e-06
gi|26553998|ref|NP_757932.1| lipase-esterase related protein [My... 55 2e-06
gi|49481645|ref|YP_038899.1| hydrolase; menaquinone biosynthesis... 55 2e-06
gi|30022922|ref|NP_834553.1| Menaquinone biosynthesis related pr... 55 2e-06
gi|42563999|ref|NP_187695.3| hydrolase, alpha/beta fold family p... 55 2e-06
gi|18413878|ref|NP_567394.1| hydrolase, alpha/beta fold family p... 55 3e-06
gi|24215557|ref|NP_713038.1| Predicted hydrolases or acyltransfe... 55 3e-06
gi|37523402|ref|NP_926779.1| probable 2-hydroxy-6-oxohepta-2,4-d... 55 3e-06
gi|46119580|ref|ZP_00176859.2| COG0596: Predicted hydrolases or ... 55 3e-06
gi|48783291|ref|ZP_00279753.1| COG0596: Predicted hydrolases or ... 55 3e-06
gi|48836090|ref|ZP_00293087.1| COG0596: Predicted hydrolases or ... 55 3e-06
gi|21232285|ref|NP_638202.1| hydrolase [Xanthomonas campestris p... 55 3e-06
gi|21537159|gb|AAM61500.1| hydrolase-like protein [Arabidopsis t... 55 4e-06
gi|46321692|ref|ZP_00222067.1| COG0596: Predicted hydrolases or ... 55 4e-06
gi|48788978|ref|ZP_00284957.1| COG0596: Predicted hydrolases or ... 55 4e-06
gi|13473738|ref|NP_105306.1| contains similarity to hydrolase [M... 55 4e-06
gi|32039355|ref|ZP_00137627.1| COG0596: Predicted hydrolases or ... 55 4e-06
gi|15599347|ref|NP_252841.1| probable hydrolase [Pseudomonas aer... 55 4e-06
gi|50084198|ref|YP_045708.1| putative hydrolase [Acinetobacter s... 55 4e-06
gi|48890949|ref|ZP_00324540.1| COG0596: Predicted hydrolases or ... 55 4e-06
gi|50754367|ref|XP_414352.1| PREDICTED: similar to abhydrolase d... 55 4e-06
gi|37522898|ref|NP_926275.1| probable 2-hydroxy-6-oxohepta-2,4-d... 55 4e-06
gi|49480117|ref|YP_037407.1| 3-Oxoadipate enol-lactonase, alpha/... 55 4e-06
gi|47564419|ref|ZP_00235464.1| hydrolase, alpha/beta fold family... 55 4e-06
gi|22971856|ref|ZP_00018775.1| hypothetical protein [Chloroflexu... 55 4e-06
gi|23127327|ref|ZP_00109200.1| COG0596: Predicted hydrolases or ... 54 5e-06
gi|20373111|dbj|BAB91221.1| putative meta cleavage compound hydr... 54 5e-06
gi|47218872|emb|CAG05638.1| unnamed protein product [Tetraodon n... 54 5e-06
gi|8978311|dbj|BAA98136.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dien... 54 5e-06
gi|48782255|ref|ZP_00278807.1| COG0596: Predicted hydrolases or ... 54 5e-06
gi|33240700|ref|NP_875642.1| Alpha/beta superfamily hydrolase [P... 54 5e-06
gi|30020305|ref|NP_831936.1| Proline iminopeptidase [Bacillus ce... 54 5e-06
gi|17508535|ref|NP_493077.1| esterase lipase YbfF (1M774) [Caeno... 54 5e-06
gi|22972873|ref|ZP_00019727.1| hypothetical protein [Chloroflexu... 54 5e-06
gi|34869524|ref|XP_223871.2| similar to RIKEN cDNA 0610041D24 [R... 54 5e-06
gi|45512069|ref|ZP_00163636.1| COG0596: Predicted hydrolases or ... 54 5e-06
gi|32766489|gb|AAH54984.1| Abhd6-prov protein [Xenopus laevis] 54 5e-06
gi|29827797|ref|NP_822431.1| putative hydrolase [Streptomyces av... 54 5e-06
gi|30022426|ref|NP_834057.1| Lipase [Bacillus cereus ATCC 14579]... 54 5e-06
gi|46317460|ref|ZP_00218038.1| COG0596: Predicted hydrolases or ... 54 5e-06
gi|47569345|ref|ZP_00240029.1| hydrolase, alpha/beta hydrolase f... 54 5e-06
gi|15897063|ref|NP_341668.1| Esterase, tropinesterase related pr... 54 6e-06
gi|21673775|ref|NP_661840.1| hydrolase, alpha/beta hydrolase fol... 54 6e-06
gi|37521904|ref|NP_925281.1| hypothetical protein gll2335 [Gloeo... 54 6e-06
gi|33867231|ref|NP_898789.1| HOMODA-hydrolase (IpbD) [Rhodococcu... 54 6e-06
gi|45657067|ref|YP_001153.1| conserved hypothetical protein [Lep... 54 6e-06
gi|29603467|dbj|BAC67693.1| tesD [Comamonas testosteroni] 54 6e-06
gi|12833195|dbj|BAB22430.1| unnamed protein product [Mus musculus] 54 6e-06
gi|28869068|ref|NP_791687.1| hydrolase, alpha/beta fold family [... 54 6e-06
gi|31044156|gb|AAP42868.1| NanE [Streptomyces nanchangensis] 54 6e-06
gi|48891381|ref|ZP_00324905.1| COG0596: Predicted hydrolases or ... 54 6e-06
gi|21225710|ref|NP_631489.1| putative hydrolase [Streptomyces co... 54 6e-06
gi|21402393|ref|NP_658378.1| abhydrolase, alpha/beta hydrolase f... 54 6e-06
gi|23116875|ref|ZP_00101207.1| COG0596: Predicted hydrolases or ... 54 6e-06
gi|30264421|ref|NP_846798.1| hydrolase, alpha/beta fold family [... 54 6e-06
gi|23099779|ref|NP_693245.1| prolyl aminopeptidase [Oceanobacill... 54 6e-06
gi|42783476|ref|NP_980723.1| hydrolase, alpha/beta fold family [... 54 6e-06
gi|50871368|emb|CAE54381.1| carboxylesterase [Oleispira antarcti... 54 8e-06
gi|46134407|ref|ZP_00203304.1| COG0596: Predicted hydrolases or ... 54 8e-06
gi|1702883|emb|CAA70749.1| 2-hydroxy-6-ketonona-2,4-dienedioic a... 54 8e-06
gi|27904961|ref|NP_778087.1| putative biotin biosynthesis protei... 54 8e-06
gi|49176013|ref|NP_414883.3| 2-hydroxy-6-ketonona-2,4-dienedioic... 54 8e-06
gi|23113504|ref|ZP_00098873.1| COG0596: Predicted hydrolases or ... 54 8e-06
gi|20807053|ref|NP_622224.1| predicted hydrolases or acyltransfe... 54 8e-06
gi|45527363|ref|ZP_00178563.1| COG0596: Predicted hydrolases or ... 54 8e-06
gi|46319390|ref|ZP_00219798.1| COG0596: Predicted hydrolases or ... 54 8e-06
gi|37522627|ref|NP_926004.1| probable 2-hydroxy-6-oxohepta-2,4-d... 54 8e-06
gi|12644343|sp|P77044|MHPC_ECOLI 2-hydroxy-6-ketonona-2,4-diened... 54 8e-06
gi|1665748|dbj|BAA13054.1| MhpC [Escherichia coli] 54 8e-06
gi|50084315|ref|YP_045825.1| lipase [Acinetobacter sp. ADP1] >gn... 54 8e-06
gi|28896922|ref|NP_796527.1| BioH protein [Vibrio parahaemolytic... 54 8e-06
gi|48854158|ref|ZP_00308322.1| COG0596: Predicted hydrolases or ... 54 8e-06
gi|36958694|gb|AAQ87162.1| 3-oxoadipate enol-lactonase [Rhizobiu... 54 8e-06
gi|24215244|ref|NP_712725.1| Predicted hydrolases or acyltransfe... 54 8e-06
gi|34979720|gb|AAQ83881.1| esterase [Ralstonia mannitolilytica] 53 1e-05
gi|48894367|ref|ZP_00327476.1| COG0596: Predicted hydrolases or ... 53 1e-05
gi|46131563|ref|ZP_00202627.1| COG0596: Predicted hydrolases or ... 53 1e-05
gi|24373880|ref|NP_717923.1| hydrolase, alpha/beta fold family [... 53 1e-05
gi|46120316|ref|ZP_00179781.2| COG0596: Predicted hydrolases or ... 53 1e-05
gi|11499296|ref|NP_070534.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-di... 53 1e-05
gi|37526116|ref|NP_929460.1| hypothetical protein [Photorhabdus ... 53 1e-05
gi|16080194|ref|NP_391020.1| yugF [Bacillus subtilis subsp. subt... 53 1e-05
gi|18309414|ref|NP_561348.1| putative beta-ketoadipate enol-lact... 53 1e-05
gi|1389642|dbj|BAA12881.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dien... 53 1e-05
gi|20807057|ref|NP_622228.1| predicted hydrolases or acyltransfe... 53 1e-05
gi|49258084|gb|AAH74464.1| Unknown (protein for MGC:84753) [Xeno... 53 1e-05
gi|46435097|gb|EAK94487.1| hypothetical protein CaO19.782 [Candi... 53 1e-05
gi|24640348|ref|NP_572388.1| CG2059-PA [Drosophila melanogaster]... 53 1e-05
gi|115109|sp|P17548|BPHD_PSES1 2-HYDROXY-6-OXO-6-PHENYLHEXA-2,4-... 53 1e-05
gi|37678415|ref|NP_933024.1| biotin biosynthesis protein BioH [V... 53 1e-05
gi|23126248|ref|ZP_00108150.1| COG0596: Predicted hydrolases or ... 53 1e-05
gi|15029380|gb|AAK81864.1| lipase [Streptococcus sp. (N1)] 53 1e-05
gi|17546115|ref|NP_519517.1| PUTATIVE TRANSMEMBRANE PROTEIN [Ral... 53 1e-05
gi|32491334|ref|NP_871588.1| bioH [Wigglesworthia glossinidia en... 53 1e-05
gi|16124478|ref|NP_419042.1| hydrolase, alpha/beta hydrolase fol... 53 1e-05
gi|6118537|gb|AAF04141.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-dieno... 53 1e-05
gi|21624259|dbj|BAC01057.1| 2-hydroxy-6-phenylhexa-2,4-dienoic a... 53 1e-05
gi|28193603|emb|CAD62284.1| 2-hydroxy-6-phenylhexa-2,4-dienoic a... 53 1e-05
gi|34922418|sp|O52866|HYES_CORS2 Soluble epoxide hydrolase (SEH)... 53 1e-05
gi|47194806|emb|CAF93627.1| unnamed protein product [Tetraodon n... 53 1e-05
gi|26988925|ref|NP_744350.1| hydrolase, alpha/beta fold family [... 53 1e-05
gi|37520786|ref|NP_924163.1| hypothetical protein gll1217 [Gloeo... 53 1e-05
gi|25013108|gb|AAN71653.1| SD11339p [Drosophila melanogaster] 53 1e-05
gi|22299609|ref|NP_682856.1| ORF_ID:tlr2066~similar to epoxide h... 53 1e-05
gi|50085219|ref|YP_046729.1| putative hydrolases or acyltransfer... 52 2e-05
gi|48852753|ref|ZP_00306936.1| COG0596: Predicted hydrolases or ... 52 2e-05
gi|46366999|ref|ZP_00229122.1| COG0596: Predicted hydrolases or ... 52 2e-05
gi|11875162|dbj|BAB19375.1| contains EST C19423(E10389)~unknown ... 52 2e-05
gi|15598705|ref|NP_252199.1| probable hydrolase [Pseudomonas aer... 52 2e-05
gi|94869|pir||C35124 2,6-dioxo-6-phenylhexa-3-enoate hydrolase (... 52 2e-05
gi|598361|gb|AAA56853.1| beta-D-galactosidase >gnl|BL_ORD_ID|300... 52 2e-05
gi|21243764|ref|NP_643346.1| hydrolase [Xanthomonas axonopodis p... 52 2e-05
gi|13471725|ref|NP_103292.1| probable epoxide hydrolase [Mesorhi... 52 2e-05
gi|23126850|ref|ZP_00108734.1| COG0596: Predicted hydrolases or ... 52 2e-05
gi|21402903|ref|NP_658888.1| abhydrolase, alpha/beta hydrolase f... 52 2e-05
gi|48853522|ref|ZP_00307691.1| COG0596: Predicted hydrolases or ... 52 2e-05
gi|45512103|ref|ZP_00163670.1| COG0596: Predicted hydrolases or ... 52 2e-05
gi|46446765|ref|YP_008130.1| hypothetical protein pc1131 [Parach... 52 2e-05
gi|16081937|ref|NP_394346.1| triacylglycerol lipase related prot... 52 2e-05
gi|33862184|ref|NP_893745.1| possible alpha/beta hydrolase super... 52 2e-05
gi|23478935|gb|EAA15891.1| putative esterase/lipase hi0193 [Plas... 52 2e-05
gi|16126634|ref|NP_421198.1| acetoin dehydrogenase E2 component,... 52 2e-05
gi|50085622|ref|YP_047132.1| conserved hypothetical protein; put... 52 2e-05
gi|22324419|dbj|BAC10336.1| unknown protein [Oryza sativa (japon... 52 2e-05
gi|46113525|ref|ZP_00200815.1| COG0596: Predicted hydrolases or ... 52 2e-05
gi|27382255|ref|NP_773784.1| oxidoreductase [Bradyrhizobium japo... 52 2e-05
gi|47208280|emb|CAF91066.1| unnamed protein product [Tetraodon n... 52 3e-05
gi|41054539|ref|NP_955909.1| kraken-like; wu:fb69a04 [Danio reri... 52 3e-05
gi|15889763|ref|NP_355444.1| AGR_C_4537p [Agrobacterium tumefaci... 52 3e-05
gi|42744547|gb|AAH66637.1| Zgc:55804 protein [Danio rerio] 52 3e-05
gi|46316595|ref|ZP_00217174.1| COG0596: Predicted hydrolases or ... 52 3e-05
gi|17936378|ref|NP_533168.1| hydrolase [Agrobacterium tumefacien... 52 3e-05
gi|31544537|ref|NP_853115.1| LipA [Mycoplasma gallisepticum R] >... 52 3e-05
gi|8926386|gb|AAF81825.1| 2-hydroxy-6-ketonona-2,4-dienedoic aci... 52 3e-05
gi|46320166|ref|ZP_00220559.1| COG0596: Predicted hydrolases or ... 52 3e-05
gi|46102656|ref|XP_380208.1| hypothetical protein FG00032.1 [Gib... 52 3e-05
gi|48890847|ref|ZP_00324452.1| COG0596: Predicted hydrolases or ... 52 3e-05
gi|47215578|emb|CAG10749.1| unnamed protein product [Tetraodon n... 52 3e-05
gi|27382076|ref|NP_773605.1| blr6965 [Bradyrhizobium japonicum U... 52 3e-05
gi|21401218|ref|NP_657203.1| abhydrolase, alpha/beta hydrolase f... 52 3e-05
gi|48770058|ref|ZP_00274402.1| COG0596: Predicted hydrolases or ... 52 3e-05
gi|34500485|ref|NP_904256.1| haloacetate dehalogenase H-1 [Delft... 52 3e-05
gi|50726075|dbj|BAD33598.1| family protein-like [Oryza sativa (j... 52 3e-05
gi|24655886|ref|NP_647696.1| CG15820-PA [Drosophila melanogaster... 52 3e-05
gi|47568033|ref|ZP_00238739.1| hydrolase, alpha/beta hydrolase f... 52 3e-05
gi|29828090|ref|NP_822724.1| putative carboxylesterase [Streptom... 51 4e-05
gi|23025154|ref|ZP_00064323.1| COG0596: Predicted hydrolases or ... 51 4e-05
gi|46111153|ref|XP_382634.1| hypothetical protein FG02458.1 [Gib... 51 4e-05
gi|48768966|ref|ZP_00273313.1| COG0596: Predicted hydrolases or ... 51 4e-05
gi|50123052|ref|YP_052219.1| putative biotin biosynthesis protei... 51 4e-05
gi|27364310|ref|NP_759838.1| Biotin biosynthesis protein BioH [V... 51 4e-05
gi|16330122|ref|NP_440850.1| 2-hydroxy-6-oxohepta-2,4-dienoate h... 51 4e-05
gi|15806368|ref|NP_295074.1| hydrolase, alpha/beta hydrolase fol... 51 4e-05
gi|15800080|ref|NP_286092.1| 2-hydroxy-6-ketonona-2,4-dienedioic... 51 4e-05
gi|1480641|gb|AAC44742.1| BphD 51 4e-05
gi|38703860|ref|NP_308431.2| 2-hydroxy-6-ketonona-2,4-dienedioic... 51 4e-05
gi|47565478|ref|ZP_00236519.1| protein of unknown function, puta... 51 4e-05
gi|17988234|ref|NP_540868.1| PUTATIVE HYDROLASE [Brucella melite... 51 4e-05
gi|27467307|ref|NP_763944.1| putative esterase/lipase [Staphyloc... 51 4e-05
gi|15896189|ref|NP_349538.1| Alpha/beta superfamily hydrolase [C... 51 4e-05
gi|15238212|ref|NP_199005.1| hydrolase, alpha/beta fold family p... 51 5e-05
gi|46911820|emb|CAG18618.1| putative bioH protein [Photobacteriu... 51 5e-05
gi|46119080|ref|ZP_00201423.1| COG0596: Predicted hydrolases or ... 51 5e-05
gi|23121440|ref|ZP_00103735.1| COG0596: Predicted hydrolases or ... 51 5e-05
gi|13470437|ref|NP_102005.1| lactone-specific esterase [Mesorhiz... 51 5e-05
gi|48428776|gb|AAT42424.1| acyl-CoA synthetase [Collimonas fungi... 51 5e-05
gi|15966569|ref|NP_386922.1| PUTATIVE PROLINE IMINOPEPTIDASE PRO... 51 5e-05
gi|10433066|dbj|BAB13900.1| unnamed protein product [Homo sapiens] 51 5e-05
gi|22547157|ref|NP_078803.2| abhydrolase domain containing 8 [Ho... 51 5e-05
gi|46322294|ref|ZP_00222665.1| COG0596: Predicted hydrolases or ... 51 5e-05
gi|23128677|ref|ZP_00110517.1| COG0596: Predicted hydrolases or ... 51 5e-05
gi|18652351|gb|AAL77079.1| 6-substituted 2-hydroxy-6-oxohexa-2,4... 51 5e-05
gi|42629139|ref|ZP_00154688.1| COG0596: Predicted hydrolases or ... 51 5e-05
gi|37521571|ref|NP_924948.1| probable hydrolase [Gloeobacter vio... 51 5e-05
gi|48729378|ref|ZP_00263129.1| COG0596: Predicted hydrolases or ... 51 5e-05
gi|1945074|dbj|BAA19688.1| prolyl aminopeptidase [Chryseobacteri... 51 5e-05
gi|17137390|ref|NP_477265.1| CG3943-PA [Drosophila melanogaster]... 51 5e-05
gi|22959329|ref|ZP_00006983.1| COG0596: Predicted hydrolases or ... 51 5e-05
gi|22298936|ref|NP_682183.1| ORF_ID:tlr1393~probable hydrolase [... 51 5e-05
gi|46908856|ref|YP_015245.1| hydrolase, alpha/beta fold family [... 51 5e-05
gi|48729681|ref|ZP_00263431.1| COG0596: Predicted hydrolases or ... 51 5e-05
gi|21388677|dbj|BAC00799.1| hydrolase [Rhodococcus sp. YK2] 50 7e-05
gi|30021840|ref|NP_833471.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-di... 50 7e-05
gi|46130566|ref|ZP_00165492.2| COG0596: Predicted hydrolases or ... 50 7e-05
gi|22971068|ref|ZP_00018065.1| hypothetical protein [Chloroflexu... 50 7e-05
gi|15803916|ref|NP_289952.1| biotin biosynthesis; reaction prior... 50 7e-05
gi|46316969|ref|ZP_00217547.1| COG0596: Predicted hydrolases or ... 50 7e-05
gi|22971842|ref|ZP_00018762.1| hypothetical protein [Chloroflexu... 50 7e-05
gi|34762937|ref|ZP_00143917.1| 2-hydroxy-6-oxo-6-phenylhexa-2,4-... 50 7e-05
gi|48095091|ref|XP_394354.1| similar to ENSANGP00000010491 [Apis... 50 9e-05
gi|18150927|ref|NP_542864.1| xylF [Pseudomonas putida] >gnl|BL_O... 50 9e-05
gi|33357095|pdb|1J1I|A Chain A, Crystal Structure Of A His-Tagge... 50 9e-05
gi|13508258|ref|NP_110207.1| triacylglycerol lipase (lip) 3 [Myc... 50 9e-05
gi|37536386|ref|NP_922495.1| hypothetical protein [Oryza sativa ... 50 9e-05
gi|45439992|ref|NP_991531.1| putative biotin biosynthesis protei... 50 9e-05
gi|50421021|ref|XP_459053.1| unnamed protein product [Debaryomyc... 50 9e-05
gi|22970642|ref|ZP_00017693.1| hypothetical protein [Chloroflexu... 50 9e-05
gi|23101896|ref|ZP_00088439.1| COG0596: Predicted hydrolases or ... 50 9e-05
gi|23105988|ref|ZP_00092442.1| COG0596: Predicted hydrolases or ... 50 9e-05
gi|42780895|ref|NP_978142.1| hydrolase, alpha/beta fold family [... 50 9e-05
gi|46366651|ref|ZP_00228881.1| COG0596: Predicted hydrolases or ... 50 9e-05
gi|48866329|ref|ZP_00320185.1| COG0596: Predicted hydrolases or ... 50 9e-05
gi|11262634|pir||T46582 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2... 50 9e-05
gi|28201210|dbj|BAC56745.1| meta cleavage compound hydrolase [Ja... 50 9e-05
gi|27228520|ref|NP_758570.1| meta cleavage compound hydrolase [P... 50 9e-05
gi|48894007|ref|ZP_00327205.1| COG0596: Predicted hydrolases or ... 50 9e-05
gi|16120472|ref|NP_403785.1| putative biotin biosynthesis protei... 50 9e-05
gi|27381194|ref|NP_772723.1| blr6083 [Bradyrhizobium japonicum U... 50 9e-05
gi|16119450|ref|NP_396156.1| AGR_pAT_317p [Agrobacterium tumefac... 50 9e-05
gi|14196240|dbj|BAB55888.1| hydrolase [Terrabacter sp. DBF63] 50 1e-04
gi|1905991|gb|AAB81313.1| 2-hydroxy-6-ketonona-2,4-dienoate hydr... 50 1e-04
gi|1730577|sp|P46541|PIP_BACCO Proline iminopeptidase (PIP) (Pro... 50 1e-04
gi|15642712|ref|NP_232345.1| bioH protein [Vibrio cholerae O1 bi... 50 1e-04
gi|1263187|gb|AAB62292.1| HOMODA hydrolase [Pseudomonas putida] ... 50 1e-04
gi|11499917|ref|NP_071161.1| carboxylesterase (est-3) [Archaeogl... 50 1e-04
gi|11967947|ref|NP_071864.1| hypothetical protein, clone 2-25 [M... 50 1e-04
gi|13541998|ref|NP_111686.1| Predicted hydrolase (alpha/beta sup... 50 1e-04
gi|14325430|dbj|BAB60334.1| non-heme chloroheme peroxidase [Ther... 50 1e-04
gi|30268640|dbj|BAC75995.1| meta cleavage compound hydrolase [Te... 50 1e-04
gi|21356953|ref|NP_652068.1| CG5704-PA [Drosophila melanogaster]... 50 1e-04
gi|33241206|ref|NP_876148.1| Alpha/beta superfamily hydrolase [P... 50 1e-04
gi|8843721|dbj|BAA97254.1| BphD [Burkholderia sp. TSN101] 50 1e-04
gi|48783362|ref|ZP_00279814.1| COG0596: Predicted hydrolases or ... 50 1e-04
gi|21388684|dbj|BAC00805.1| hydrolase [Rhodococcus sp. YK2] 49 2e-04
gi|18398716|ref|NP_565437.1| hydrolase, alpha/beta fold family p... 49 2e-04
gi|34498375|ref|NP_902590.1| probable hydrolase [Chromobacterium... 49 2e-04
gi|46106420|ref|ZP_00187188.2| COG0596: Predicted hydrolases or ... 49 2e-04
gi|30065303|ref|NP_839474.1| putative enzyme in biotin precursor... 49 2e-04
gi|49482845|ref|YP_040069.1| putative esterase [Staphylococcus a... 49 2e-04
gi|15923605|ref|NP_371139.1| hypothetical protein SAV0615 [Staph... 49 2e-04
gi|13488467|ref|NP_109474.1| hydrolase [Mesorhizobium loti MAFF3... 49 2e-04
gi|23130186|ref|ZP_00112005.1| COG0596: Predicted hydrolases or ... 49 2e-04
gi|21225522|ref|NP_631301.1| putative hydrolase. [Streptomyces c... 49 2e-04
gi|29899138|gb|AAP03105.1| possible hydrolase [Streptomyces gris... 49 2e-04
gi|25411863|pir||D84563 hypothetical protein At2g18360 [imported... 49 2e-04
gi|30995358|ref|NP_438361.2| esterase/lipase [Haemophilus influe... 49 2e-04
gi|23126428|ref|ZP_00108324.1| COG0596: Predicted hydrolases or ... 49 2e-04
gi|39996154|ref|NP_952105.1| hydrolase, alpha/beta fold family [... 49 2e-04
gi|16131288|ref|NP_417871.1| biotin biosynthesis; reaction prior... 49 2e-04
gi|47223164|emb|CAG11299.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|17227535|ref|NP_484083.1| putative hydrolase [Nostoc sp. PCC ... 49 2e-04
gi|37524139|ref|NP_927483.1| hypothetical protein [Photorhabdus ... 49 2e-04
gi|47095481|ref|ZP_00233090.1| hydrolase, alpha/beta fold family... 49 2e-04
gi|2833494|sp|Q57427|Y193_HAEIN Putative esterase/lipase HI0193 ... 49 2e-04
gi|16125477|ref|NP_420041.1| proline iminopeptidase [Caulobacter... 49 2e-04
gi|47568239|ref|ZP_00238942.1| acetoin dehydrogenase E2 componen... 49 2e-04
gi|14521792|ref|NP_127268.1| lysophospholipase [Pyrococcus abyss... 49 2e-04
gi|27378870|ref|NP_770399.1| bll3759 [Bradyrhizobium japonicum U... 49 2e-04
gi|46916087|emb|CAG22856.1| hypothetical protein [Photobacterium... 49 2e-04
gi|27804821|gb|AAO22865.1| hypothetical protein [Myxococcus xant... 49 2e-04
gi|46444340|gb|EAL03615.1| hypothetical protein CaO19.9034 [Cand... 49 2e-04
gi|48782800|ref|ZP_00279280.1| COG0596: Predicted hydrolases or ... 49 2e-04
gi|23125606|ref|ZP_00107532.1| COG0596: Predicted hydrolases or ... 49 2e-04
gi|46912695|emb|CAG19485.1| hypothetical hydrolase/acyltransfera... 49 2e-04
gi|22298589|ref|NP_681836.1| ORF_ID:tlr1045~hypothetical protein... 49 2e-04
gi|15965747|ref|NP_386100.1| PUTATIVE OXIDOREDUCTASE PROTEIN [Si... 49 2e-04
gi|28373574|pdb|1M33|A Chain A, Crystal Structure Of Bioh At 1.7 A 49 2e-04
gi|46907905|ref|YP_014294.1| hydrolase, alpha/beta fold family [... 49 2e-04
gi|20336343|gb|AAM18212.1| streptothricin acetyl-transferase [Sh... 49 3e-04
gi|17939197|ref|NP_536182.1| haloalkane dehalogenase [Agrobacter... 49 3e-04
gi|33864208|ref|NP_895768.1| possible alpha/beta hydrolase super... 49 3e-04
gi|16127538|ref|NP_422102.1| hydrolase, putative [Caulobacter cr... 49 3e-04
gi|16801885|ref|NP_472153.1| similar to hydrolase (esterase) (tr... 49 3e-04
gi|48770794|ref|ZP_00275137.1| COG0596: Predicted hydrolases or ... 49 3e-04
gi|27382608|ref|NP_774137.1| bll7497 [Bradyrhizobium japonicum U... 49 3e-04
gi|32414827|ref|XP_327893.1| hypothetical protein [Neurospora cr... 49 3e-04
gi|16766797|ref|NP_462412.1| putative hydrolase [Salmonella typh... 49 3e-04
gi|16762778|ref|NP_458395.1| putative biotin biosynthesis protei... 49 3e-04
gi|16119878|ref|NP_396583.1| haloalkane dehalogenase [Agrobacter... 49 3e-04
gi|13541806|ref|NP_111494.1| Predicted hydrolase (alpha/beta sup... 49 3e-04
gi|50422293|ref|XP_459709.1| unnamed protein product [Debaryomyc... 49 3e-04
gi|42522728|ref|NP_968108.1| putative hydrolase [Bdellovibrio ba... 49 3e-04
gi|16804714|ref|NP_466199.1| similar to hydrolase (esterase) [Li... 49 3e-04
gi|42491264|dbj|BAD10974.1| Streptothricin acetyltransferase [Sa... 48 3e-04
gi|42491272|dbj|BAD10980.1| Streptothricin acetyltransferase [Es... 48 3e-04
gi|42491268|dbj|BAD10977.1| Streptothricin acetyltransferase [Sa... 48 3e-04
gi|45752403|dbj|BAD13383.1| streptothricin acetyl-transferase [E... 48 3e-04
gi|46366433|ref|ZP_00228741.1| COG0596: Predicted hydrolases or ... 48 3e-04
gi|48783148|ref|ZP_00279610.1| COG0596: Predicted hydrolases or ... 48 3e-04
>gi|25146278|ref|NP_504299.2| alpha/beta hydrolase fold family member
(5F327) [Caenorhabditis elegans]
gi|20901930|gb|AAB42366.2| Hypothetical protein C37H5.2
[Caenorhabditis elegans]
Length = 355
Score = 682 bits (1760), Expect = 0.0
Identities = 339/355 (95%), Positives = 339/355 (95%)
Frame = +1
Query: 1 MTETDIATXXXXXXXXXXXXXXXXLAEAENRIFTALGIKFSSELVQIPFKNTEINTITVN 180
MTETDIAT LAEAENRIFTALGIKFSSELVQIPFKNTEINTITVN
Sbjct: 1 MTETDIATSKPWFSTSSCSSKSEKLAEAENRIFTALGIKFSSELVQIPFKNTEINTITVN 60
Query: 181 CENESSELKSKYPIVLIHGFGAGVALWGSAIKRLAQFQNVYAIDLPGFGRSSRTKFSTDP 360
CENESSELKSKYPIVLIHGFGAGVALWGSAIKRLAQFQNVYAIDLPGFGRSSRTKFSTDP
Sbjct: 61 CENESSELKSKYPIVLIHGFGAGVALWGSAIKRLAQFQNVYAIDLPGFGRSSRTKFSTDP 120
Query: 361 ETAEKEMIEAIEQWRVKMNLEKMNLVGHSFGGYLSTSYALKYPKRIENLILADPWGFTDV 540
ETAEKEMIEAIEQWRVKMNLEKMNLVGHSFGGYLSTSYALKYPKRIENLILADPWGFTDV
Sbjct: 121 ETAEKEMIEAIEQWRVKMNLEKMNLVGHSFGGYLSTSYALKYPKRIENLILADPWGFTDV 180
Query: 541 DPSFLEKLTKRQKALFWVILKFNPLAALRLVGGYGPSLMKRLRPDLEQKYSEDVYDYIYL 720
DPSFLEKLTKRQKALFWVILKFNPLAALRLVGGYGPSLMKRLRPDLEQKYSEDVYDYIYL
Sbjct: 181 DPSFLEKLTKRQKALFWVILKFNPLAALRLVGGYGPSLMKRLRPDLEQKYSEDVYDYIYL 240
Query: 721 ANSGNPTGEIIFKSLSENLRWAKNPMSKRFHELDKTVPVKFIHGGMSWVDWKTTREMFGS 900
ANSGNPTGEIIFKSLSENLRWAKNPMSKRFHELDKTVPVKFIHGGMSWVDWKTTREMFGS
Sbjct: 241 ANSGNPTGEIIFKSLSENLRWAKNPMSKRFHELDKTVPVKFIHGGMSWVDWKTTREMFGS 300
Query: 901 MDHVESHIIEGAGHHVYADDTDRFVELVIGSLKDGKTGDLVPEEVNLEEDIVTPL 1065
MDHVESHIIEGAGHHVYADDTDRFVELVIGSLKDGKTGDLVPEEVNLEEDIVTPL
Sbjct: 301 MDHVESHIIEGAGHHVYADDTDRFVELVIGSLKDGKTGDLVPEEVNLEEDIVTPL 355
>gi|7497169|pir||T25621 hypothetical protein C37H5.2 - Caenorhabditis
elegans
Length = 372
Score = 672 bits (1734), Expect = 0.0
Identities = 339/372 (91%), Positives = 339/372 (91%), Gaps = 17/372 (4%)
Frame = +1
Query: 1 MTETDIATXX-----------------XXXXXXXXXXXXXXLAEAENRIFTALGIKFSSE 129
MTETDIAT LAEAENRIFTALGIKFSSE
Sbjct: 1 MTETDIATSKPWYGNYYILFCIAINSFYGFSTSSCSSKSEKLAEAENRIFTALGIKFSSE 60
Query: 130 LVQIPFKNTEINTITVNCENESSELKSKYPIVLIHGFGAGVALWGSAIKRLAQFQNVYAI 309
LVQIPFKNTEINTITVNCENESSELKSKYPIVLIHGFGAGVALWGSAIKRLAQFQNVYAI
Sbjct: 61 LVQIPFKNTEINTITVNCENESSELKSKYPIVLIHGFGAGVALWGSAIKRLAQFQNVYAI 120
Query: 310 DLPGFGRSSRTKFSTDPETAEKEMIEAIEQWRVKMNLEKMNLVGHSFGGYLSTSYALKYP 489
DLPGFGRSSRTKFSTDPETAEKEMIEAIEQWRVKMNLEKMNLVGHSFGGYLSTSYALKYP
Sbjct: 121 DLPGFGRSSRTKFSTDPETAEKEMIEAIEQWRVKMNLEKMNLVGHSFGGYLSTSYALKYP 180
Query: 490 KRIENLILADPWGFTDVDPSFLEKLTKRQKALFWVILKFNPLAALRLVGGYGPSLMKRLR 669
KRIENLILADPWGFTDVDPSFLEKLTKRQKALFWVILKFNPLAALRLVGGYGPSLMKRLR
Sbjct: 181 KRIENLILADPWGFTDVDPSFLEKLTKRQKALFWVILKFNPLAALRLVGGYGPSLMKRLR 240
Query: 670 PDLEQKYSEDVYDYIYLANSGNPTGEIIFKSLSENLRWAKNPMSKRFHELDKTVPVKFIH 849
PDLEQKYSEDVYDYIYLANSGNPTGEIIFKSLSENLRWAKNPMSKRFHELDKTVPVKFIH
Sbjct: 241 PDLEQKYSEDVYDYIYLANSGNPTGEIIFKSLSENLRWAKNPMSKRFHELDKTVPVKFIH 300
Query: 850 GGMSWVDWKTTREMFGSMDHVESHIIEGAGHHVYADDTDRFVELVIGSLKDGKTGDLVPE 1029
GGMSWVDWKTTREMFGSMDHVESHIIEGAGHHVYADDTDRFVELVIGSLKDGKTGDLVPE
Sbjct: 301 GGMSWVDWKTTREMFGSMDHVESHIIEGAGHHVYADDTDRFVELVIGSLKDGKTGDLVPE 360
Query: 1030 EVNLEEDIVTPL 1065
EVNLEEDIVTPL
Sbjct: 361 EVNLEEDIVTPL 372