Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C39E9_10
(1467 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539092|ref|NP_502513.1| spinster-like family member (53.5 k... 942 0.0
gi|39587724|emb|CAE58662.1| Hypothetical protein CBG01831 [Caeno... 893 0.0
gi|39583171|emb|CAE61389.1| Hypothetical protein CBG05238 [Caeno... 474 e-132
gi|31441766|emb|CAA93644.2| Hypothetical protein F09A5.1 [Caenor... 453 e-126
gi|17557872|ref|NP_506041.1| SPINL protein family member (58.1 k... 441 e-122
gi|17551510|ref|NP_510181.1| general substrate transporter famil... 435 e-120
gi|39592176|emb|CAE75396.1| Hypothetical protein CBG23385 [Caeno... 432 e-119
gi|39583260|emb|CAE60052.1| Hypothetical protein CBG03564 [Caeno... 349 8e-95
gi|32698462|emb|CAC35848.2| Hypothetical protein Y111B2A.19 [Cae... 333 6e-90
gi|17556701|ref|NP_499650.1| spinster-like (3N783) [Caenorhabdit... 332 1e-89
gi|24119224|ref|NP_705949.1| spinster-like; etID64740.3 [Danio r... 331 2e-89
gi|28856118|gb|AAH48024.1| Spinster-like [Danio rerio] 330 5e-89
gi|34859183|ref|XP_341928.1| similar to spinster-like protein [R... 323 8e-87
gi|14042968|ref|NP_114427.1| spinster [Homo sapiens] >gnl|BL_ORD... 322 1e-86
gi|13544043|gb|AAH06156.1| SPINL protein [Homo sapiens] 322 1e-86
gi|40807118|gb|AAH65235.1| SPINL protein [Homo sapiens] 322 2e-86
gi|20071304|gb|AAH26854.1| Spinster [Mus musculus] 320 4e-86
gi|12805633|gb|AAH02297.1| 2210013K02Rik protein [Mus musculus] 319 9e-86
gi|12963795|ref|NP_076201.1| spinster [Mus musculus] >gnl|BL_ORD... 318 3e-85
gi|31217117|ref|XP_316365.1| ENSANGP00000013028 [Anopheles gambi... 310 7e-83
gi|47223771|emb|CAF98541.1| unnamed protein product [Tetraodon n... 308 3e-82
gi|15079262|gb|AAH11467.1| BC011467 protein [Mus musculus] 306 1e-81
gi|27469378|gb|AAH41772.1| Similar to spinster-like protein [Hom... 305 2e-81
gi|37543397|ref|XP_058879.6| similar to spinster [Homo sapiens] 302 1e-80
gi|24654039|ref|NP_725531.1| CG8428-PA [Drosophila melanogaster]... 302 1e-80
gi|17864456|ref|NP_524823.1| CG8428-PD [Drosophila melanogaster]... 302 1e-80
gi|47223772|emb|CAF98542.1| unnamed protein product [Tetraodon n... 293 7e-78
gi|15291895|gb|AAK93216.1| LD30873p [Drosophila melanogaster] 286 1e-75
gi|28839526|gb|AAH47741.1| SPINL protein [Homo sapiens] 286 1e-75
gi|20882145|ref|XP_126365.1| RIKEN cDNA 9830002I17 [Mus musculus... 285 1e-75
gi|24654037|ref|NP_725530.1| CG8428-PC [Drosophila melanogaster]... 285 3e-75
gi|24654041|ref|NP_725532.1| CG8428-PB [Drosophila melanogaster]... 285 3e-75
gi|48123641|ref|XP_396540.1| similar to CG8428-PD [Apis mellifera] 276 1e-72
gi|47271489|ref|NP_872344.2| hypothetical protein MGC29671 [Homo... 270 5e-71
gi|33341776|gb|AAQ15259.1| PP2030 [Homo sapiens] 266 7e-70
gi|50758060|ref|XP_415741.1| PREDICTED: similar to spinster [Gal... 260 5e-68
gi|19584295|emb|CAB99229.1| hypothetical protein [Homo sapiens] 248 3e-64
gi|26334443|dbj|BAC30922.1| unnamed protein product [Mus musculus] 247 6e-64
gi|34872719|ref|XP_220714.2| similar to spinster-like protein [R... 241 2e-62
gi|12003978|gb|AAG43829.1| spinster type V [Drosophila melanogas... 226 1e-57
gi|24654044|ref|NP_725533.1| CG8428-PE [Drosophila melanogaster]... 226 1e-57
gi|21754987|dbj|BAC04603.1| unnamed protein product [Homo sapiens] 207 5e-52
gi|23271053|gb|AAH23646.1| MGC29671 protein [Homo sapiens] 192 2e-47
gi|50758058|ref|XP_415740.1| PREDICTED: similar to BC011467 prot... 152 2e-35
gi|48844363|ref|ZP_00298679.1| COG0477: Permeases of the major f... 150 1e-34
gi|22328088|ref|NP_680469.1| transporter-related [Arabidopsis th... 122 3e-26
gi|28871247|ref|NP_793866.1| major facilitator family transporte... 118 4e-25
gi|16124591|ref|NP_419155.1| major facilitator family transporte... 117 9e-25
gi|30681799|ref|NP_179858.2| transporter-related [Arabidopsis th... 115 2e-24
gi|25412133|pir||B84616 hypothetical protein At2g22730 [imported... 113 1e-23
gi|29171555|ref|NP_808601.1| major facilitator family transporte... 113 1e-23
gi|7486520|pir||T05899 hypothetical protein F6H11.180 - Arabidop... 112 2e-23
gi|48847940|ref|ZP_00302188.1| COG0477: Permeases of the major f... 108 2e-22
gi|15237714|ref|NP_201255.1| membrane protein-related [Arabidops... 107 6e-22
gi|48732871|ref|ZP_00266614.1| COG0477: Permeases of the major f... 106 1e-21
gi|48771028|ref|ZP_00275371.1| COG0477: Permeases of the major f... 100 7e-20
gi|15599849|ref|NP_253343.1| probable MFS transporter [Pseudomon... 99 2e-19
gi|15643779|ref|NP_228827.1| permease, putative [Thermotoga mari... 96 2e-18
gi|45516434|ref|ZP_00167986.1| COG0477: Permeases of the major f... 94 1e-17
gi|45518054|ref|ZP_00169605.1| COG0477: Permeases of the major f... 89 3e-16
gi|16126724|ref|NP_421288.1| major facilitator family transporte... 87 1e-15
gi|31217103|ref|XP_316363.1| ENSANGP00000012990 [Anopheles gambi... 86 2e-15
gi|27380034|ref|NP_771563.1| major facilitator superfamily trans... 85 4e-15
gi|47213669|emb|CAF95622.1| unnamed protein product [Tetraodon n... 85 5e-15
gi|46313324|ref|ZP_00213915.1| COG0477: Permeases of the major f... 84 1e-14
gi|48849703|ref|ZP_00303946.1| COG0477: Permeases of the major f... 82 3e-14
gi|46317017|ref|ZP_00217595.1| COG0477: Permeases of the major f... 82 4e-14
gi|16126725|ref|NP_421289.1| major facilitator family transporte... 79 4e-13
gi|46311552|ref|ZP_00212157.1| COG0477: Permeases of the major f... 76 2e-12
gi|48772535|ref|ZP_00276877.1| COG0477: Permeases of the major f... 74 7e-12
gi|38344438|emb|CAE05644.2| OSJNBa0038O10.10 [Oryza sativa (japo... 74 7e-12
gi|48847575|ref|ZP_00301826.1| COG0477: Permeases of the major f... 74 1e-11
gi|18976815|ref|NP_578172.1| putative membrane transport protein... 73 2e-11
gi|3915309|sp|O52733|XYLT_LACBR D-xylose-proton symporter (D-xyl... 72 4e-11
gi|48782186|ref|ZP_00278738.1| COG0477: Permeases of the major f... 72 4e-11
gi|15898838|ref|NP_343443.1| Multidrug resistance protein [Sulfo... 71 6e-11
gi|28377750|ref|NP_784642.1| transport protein [Lactobacillus pl... 71 6e-11
gi|14590275|ref|NP_142341.1| hypothetical protein PH0367 [Pyroco... 71 8e-11
gi|18977198|ref|NP_578555.1| putative transport membrane protein... 71 8e-11
gi|18250632|emb|CAC83623.1| putative permease [Delftia acidovorans] 70 1e-10
gi|46315745|ref|ZP_00216326.1| COG0477: Permeases of the major f... 70 1e-10
gi|23099161|ref|NP_692627.1| multidrug resistance protein [Ocean... 70 2e-10
gi|15898706|ref|NP_343311.1| Multidrug resistance protein [Sulfo... 69 2e-10
gi|46131873|ref|ZP_00170249.2| COG0477: Permeases of the major f... 69 4e-10
gi|46314393|ref|ZP_00214979.1| COG0477: Permeases of the major f... 69 4e-10
gi|46315777|ref|ZP_00216358.1| COG0477: Permeases of the major f... 68 6e-10
gi|16126062|ref|NP_420626.1| major facilitator family transporte... 68 6e-10
gi|29375022|ref|NP_814175.1| major facilitator family transporte... 68 6e-10
gi|46320670|ref|ZP_00221055.1| COG0477: Permeases of the major f... 67 8e-10
gi|23480447|gb|EAA17003.1| major facilitator superfamily protein... 67 8e-10
gi|15807729|ref|NP_285384.1| drug transport protein, putative [D... 67 1e-09
gi|16760325|ref|NP_455942.1| membrane transport protein [Salmone... 66 2e-09
gi|16764888|ref|NP_460503.1| putative transport protein [Salmone... 66 2e-09
gi|31217111|ref|XP_316364.1| ENSANGP00000012982 [Anopheles gambi... 66 2e-09
gi|15899835|ref|NP_344440.1| Transporter [Sulfolobus solfataricu... 66 2e-09
gi|16078301|ref|NP_389118.1| hexuronate transporter [Bacillus su... 65 4e-09
gi|46317168|ref|ZP_00217746.1| COG0477: Permeases of the major f... 65 4e-09
gi|30962589|dbj|BAC56976.2| 5-carboxyvanillic acid transport pro... 65 4e-09
gi|14591078|ref|NP_143153.1| hypothetical protein PH1260 [Pyroco... 65 4e-09
gi|16080574|ref|NP_391401.1| yvkA [Bacillus subtilis subsp. subt... 64 7e-09
gi|42520261|ref|NP_966176.1| bicyclomycin resistance protein [Wo... 64 9e-09
gi|46136585|ref|XP_389984.1| hypothetical protein FG09808.1 [Gib... 64 9e-09
gi|15896611|ref|NP_349960.1| Predicted permease [Clostridium ace... 64 9e-09
gi|45517558|ref|ZP_00169109.1| COG0477: Permeases of the major f... 64 9e-09
gi|24640209|ref|NP_572347.1| CG14439-PA [Drosophila melanogaster... 64 9e-09
gi|26990064|ref|NP_745489.1| major facilitator family transporte... 64 9e-09
gi|46131937|ref|ZP_00170303.2| COG0477: Permeases of the major f... 64 1e-08
gi|16079430|ref|NP_390254.1| yqjV [Bacillus subtilis subsp. subt... 63 2e-08
gi|21218650|ref|NP_624429.1| putative integral membrane transpor... 63 2e-08
gi|29375376|ref|NP_814530.1| drug resistance transporter, EmrB/Q... 63 2e-08
gi|49475727|ref|YP_033768.1| Bicyclomycin resistance protein [Ba... 63 2e-08
gi|48870771|ref|ZP_00323490.1| COG0477: Permeases of the major f... 63 2e-08
gi|48765390|ref|ZP_00269941.1| COG2814: Arabinose efflux permeas... 63 2e-08
gi|48870523|ref|ZP_00323245.1| COG0477: Permeases of the major f... 63 2e-08
gi|27379413|ref|NP_770942.1| bll4302 [Bradyrhizobium japonicum U... 63 2e-08
gi|14521351|ref|NP_126827.1| transport protein, permease [Pyroco... 63 2e-08
gi|1498494|gb|AAC45137.1| ORF2; homolog to sensor protein of a p... 62 3e-08
gi|23024756|ref|ZP_00063953.1| COG0477: Permeases of the major f... 62 3e-08
gi|9507375|ref|NP_040465.1| tet [Plasmid pNS1] >gnl|BL_ORD_ID|13... 62 3e-08
gi|15604540|ref|NP_221058.1| BICYCLOMYCIN RESISTANCE PROTEIN (bc... 62 3e-08
gi|135552|sp|P02983|TCR_STAAU Tetracycline resistance protein 62 3e-08
gi|46319284|ref|ZP_00219696.1| COG0477: Permeases of the major f... 62 3e-08
gi|49474340|ref|YP_032382.1| Bicyclomycin resistance protein [Ba... 62 3e-08
gi|9507382|ref|NP_040470.1| polypeptide B (ttg start codon) [Pla... 62 3e-08
gi|14021010|dbj|BAB47634.1| polypeptide B [Staphylococcus aureus] 62 3e-08
gi|41350139|gb|AAS00401.1| transmembrane permease [Saccharopolys... 62 5e-08
gi|48783056|ref|ZP_00279518.1| COG0477: Permeases of the major f... 62 5e-08
gi|32266608|ref|NP_860640.1| conserved hypothetical protein [Hel... 62 5e-08
gi|42491100|emb|CAE11237.1| ExuT protein [Bacillus amyloliquefac... 62 5e-08
gi|46317006|ref|ZP_00217584.1| COG0477: Permeases of the major f... 61 6e-08
gi|1168483|sp|P45598|ARAE_KLEOX Arabinose-proton symporter (Arab... 61 6e-08
gi|16944692|emb|CAC28808.2| related to tetracycline efflux prote... 61 8e-08
gi|15601035|ref|NP_232665.1| multidrug resistance protein D [Vib... 61 8e-08
gi|33520082|gb|AAQ21339.1| unknown [Amycolatopsis azurea] 61 8e-08
gi|48114720|ref|XP_396376.1| similar to CG14439-PA [Apis mellifera] 61 8e-08
gi|46316527|ref|ZP_00217106.1| COG0477: Permeases of the major f... 61 8e-08
gi|32404954|ref|XP_323090.1| hypothetical protein [Neurospora cr... 61 8e-08
gi|47565730|ref|ZP_00236770.1| drug transporter, putative [Bacil... 61 8e-08
gi|46322147|ref|ZP_00222519.1| COG0477: Permeases of the major f... 60 1e-07
gi|49104473|ref|XP_411249.1| hypothetical protein AN7112.2 [Aspe... 60 1e-07
gi|16767658|ref|NP_463273.1| putative permease [Salmonella typhi... 60 1e-07
gi|16132177|ref|NP_418776.1| putative transport protein, cryptic... 60 1e-07
gi|48768033|ref|ZP_00272385.1| COG0477: Permeases of the major f... 60 1e-07
gi|23593282|ref|NP_472983.2| hypothetical protein, conserved [Pl... 60 1e-07
gi|7494336|pir||A71619 membrane transporter PFB0275w - malaria p... 60 1e-07
gi|50084196|ref|YP_045706.1| putative permease (MFS superfamily)... 60 1e-07
gi|16763232|ref|NP_458849.1| putative sugar transporter [Salmone... 60 2e-07
gi|15802695|ref|NP_288722.1| putative transporter [Escherichia c... 60 2e-07
gi|15834570|ref|NP_313343.1| putative transport protein [Escheri... 60 2e-07
gi|15804930|ref|NP_290972.1| putative transport protein, cryptic... 60 2e-07
gi|24115586|ref|NP_710096.1| putative transport protein [Shigell... 60 2e-07
gi|50257111|gb|EAL19826.1| hypothetical protein CNBG1190 [Crypto... 60 2e-07
gi|46314957|ref|ZP_00215541.1| COG0477: Permeases of the major f... 60 2e-07
gi|19388015|gb|AAH25823.1| BC011467 protein [Mus musculus] 59 2e-07
gi|42782691|ref|NP_979938.1| conserved domain protein [Bacillus ... 59 2e-07
gi|15832285|ref|NP_311058.1| putative transport protein [Escheri... 59 2e-07
gi|46093535|dbj|BAD14994.1| putative permease [Klebsiella pneumo... 59 2e-07
gi|23102009|ref|ZP_00088541.1| COG0477: Permeases of the major f... 59 2e-07
gi|19113654|ref|NP_596862.1| putative membrane transporter; dupl... 59 2e-07
gi|19113679|ref|NP_592767.1| putative membrane transporter [Schi... 59 2e-07
gi|15613966|ref|NP_242269.1| multidrug resistance protein [Bacil... 59 3e-07
gi|48823779|ref|ZP_00285271.1| COG0477: Permeases of the major f... 59 3e-07
gi|30021721|ref|NP_833352.1| Multidrug resistance protein B [Bac... 59 3e-07
gi|4514352|dbj|BAA75389.1| YhcA [Bacillus halodurans] 59 3e-07
gi|19551626|ref|NP_599628.1| permease of the major facilitator s... 59 3e-07
gi|25027764|ref|NP_737818.1| putative multidrug resistance prote... 59 3e-07
gi|15613117|ref|NP_241420.1| multidrug resistance protein (efflu... 59 3e-07
gi|34498413|ref|NP_902628.1| D-galactonate transporter [Chromoba... 59 3e-07
gi|30020442|ref|NP_832073.1| Multidrug resistance protein B [Bac... 59 4e-07
gi|34581308|ref|ZP_00142788.1| bicyclomycin resistance protein [... 59 4e-07
gi|47567711|ref|ZP_00238421.1| peptide permease [Bacillus cereus... 59 4e-07
gi|48855714|ref|ZP_00309872.1| COG0477: Permeases of the major f... 59 4e-07
gi|16507077|gb|AAL24034.1| ExuT [Ralstonia solanacearum] 59 4e-07
gi|25026954|ref|NP_737008.1| putative efflux protein [Corynebact... 59 4e-07
gi|48850930|ref|ZP_00305172.1| COG0477: Permeases of the major f... 59 4e-07
gi|15892998|ref|NP_360712.1| bicyclomycin resistance protein [Ri... 58 5e-07
gi|25395866|pir||C88504 protein B0361.3 [imported] - Caenorhabdi... 58 5e-07
gi|26989370|ref|NP_744795.1| major facilitator family transporte... 58 5e-07
gi|26989556|ref|NP_744981.1| major facilitator family transporte... 58 5e-07
gi|17551840|ref|NP_498603.1| general substrate transporter famil... 58 5e-07
gi|31746688|gb|AAP68960.1| Hypothetical protein B0361.11 [Caenor... 58 5e-07
gi|23119808|ref|ZP_00102733.1| COG0477: Permeases of the major f... 58 5e-07
gi|28493612|ref|NP_787773.1| MFS family transporter (D-galactona... 58 5e-07
gi|17987413|ref|NP_540047.1| BICYCLOMYCIN RESISTANCE PROTEIN [Br... 58 5e-07
gi|46308809|ref|ZP_00211001.1| COG0477: Permeases of the major f... 58 5e-07
gi|16078162|ref|NP_388979.1| yitG [Bacillus subtilis subsp. subt... 58 5e-07
gi|2145399|emb|CAA70662.1| YitG [Bacillus subtilis] 58 5e-07
gi|48771257|ref|ZP_00275600.1| COG0477: Permeases of the major f... 58 5e-07
gi|4761456|gb|AAD29366.1| putative mitomycin C translocase [Stre... 58 5e-07
gi|49477458|ref|YP_036151.1| multidrug resistance protein [Bacil... 58 7e-07
gi|417165|sp|P32467|HXT4_YEAST Low-affinity glucose transporter ... 58 7e-07
gi|6321884|ref|NP_011960.1| High-affinity glucose transporter of... 58 7e-07
gi|22003538|gb|AAM88780.1| putative efflux protein [Photorhabdus... 58 7e-07
gi|47564677|ref|ZP_00235721.1| drug resistance transporter, Bcr/... 58 7e-07
gi|38233676|ref|NP_939443.1| transmembrane efflux protein, major... 58 7e-07
gi|50259821|gb|EAL22489.1| hypothetical protein CNBB3680 [Crypto... 58 7e-07
gi|16080698|ref|NP_391526.1| ywoG [Bacillus subtilis subsp. subt... 58 7e-07
gi|47569846|ref|ZP_00240515.1| multidrug resistance protein, put... 57 9e-07
gi|42779890|ref|NP_977137.1| major facilitator family transporte... 57 9e-07
gi|15672314|ref|NP_266488.1| transporter [Lactococcus lactis sub... 57 9e-07
gi|45518121|ref|ZP_00169672.1| COG0477: Permeases of the major f... 57 9e-07
gi|31242755|ref|XP_321808.1| ENSANGP00000022446 [Anopheles gambi... 57 9e-07
gi|48783661|ref|ZP_00280113.1| COG0477: Permeases of the major f... 57 9e-07
gi|23499906|ref|NP_699346.1| phthalate transporter, putative [Br... 57 9e-07
gi|49090766|ref|XP_406844.1| hypothetical protein AN2707.2 [Aspe... 57 9e-07
gi|37527931|ref|NP_931276.1| hypothetical protein [Photorhabdus ... 57 9e-07
gi|32266766|ref|NP_860798.1| conserved hypothetical protein [Hel... 57 9e-07
gi|23098736|ref|NP_692202.1| chloramphenicol resistance protein ... 57 9e-07
gi|16081109|ref|NP_391937.1| yybO [Bacillus subtilis subsp. subt... 57 9e-07
gi|5678924|gb|AAD46810.1| putative transporter protein [Mycobact... 57 9e-07
gi|49106303|ref|XP_411414.1| hypothetical protein AN7277.2 [Aspe... 57 1e-06
gi|20145256|emb|CAD29613.1| mfs-family multidrug resistance prot... 57 1e-06
gi|49476889|ref|YP_034996.1| major facilitator family transporte... 57 1e-06
gi|48733192|ref|ZP_00266935.1| COG0477: Permeases of the major f... 57 1e-06
gi|16761121|ref|NP_456738.1| putative n-hydroxybenzoate transpor... 57 1e-06
gi|50255396|gb|EAL18131.1| hypothetical protein CNBK1520 [Crypto... 57 1e-06
gi|15673485|ref|NP_267659.1| D-xylose proton-symporter [Lactococ... 57 1e-06
gi|28379060|ref|NP_785952.1| transport protein [Lactobacillus pl... 57 1e-06
gi|16121155|ref|NP_404468.1| putative sugar transporter [Yersini... 57 1e-06
gi|49477696|ref|YP_036549.1| probable multidrug resistance prote... 57 1e-06
gi|48865624|ref|ZP_00319483.1| COG0477: Permeases of the major f... 56 2e-06
gi|23502812|ref|NP_698939.1| major facilitator family transporte... 56 2e-06
gi|42781525|ref|NP_978772.1| multidrug resistance protein, putat... 56 2e-06
gi|9652186|gb|AAF91432.1| putative Na+/myo-inositol symporter [M... 56 3e-06
gi|27467114|ref|NP_763751.1| transmembrane efflux pump protein [... 56 3e-06
gi|48864750|ref|ZP_00318626.1| COG0477: Permeases of the major f... 56 3e-06
gi|15807911|ref|NP_285570.1| drug transport protein, putative [D... 56 3e-06
gi|23501720|ref|NP_697847.1| drug resistance transporter, Bcr/Cf... 56 3e-06
gi|46364346|ref|ZP_00226972.1| COG0477: Permeases of the major f... 56 3e-06
gi|49132043|ref|XP_413073.1| hypothetical protein AN8936.2 [Aspe... 56 3e-06
gi|17986388|ref|NP_539022.1| GLUCARATE TRANSPORTER [Brucella mel... 56 3e-06
gi|17989441|ref|NP_542074.1| PUTATIVE TARTRATE TRANSPORTER [Bruc... 56 3e-06
gi|49093984|ref|XP_408453.1| hypothetical protein AN4316.2 [Aspe... 56 3e-06
gi|15893318|ref|NP_346667.1| MDR-type permease [Clostridium acet... 56 3e-06
gi|16765601|ref|NP_461216.1| putative permease [Salmonella typhi... 56 3e-06
gi|34908356|ref|NP_915525.1| P0529H11.31 [Oryza sativa (japonica... 56 3e-06
gi|15227479|ref|NP_181117.1| sugar transporter family protein [A... 55 3e-06
gi|46318526|ref|ZP_00218972.1| COG0477: Permeases of the major f... 55 3e-06
gi|16151348|emb|CAC80727.1| tetracycline pump TetA(31) [Aeromona... 55 3e-06
gi|1161051|gb|AAA85344.1| efflux protein 55 3e-06
gi|27376114|ref|NP_767643.1| blr1003 [Bradyrhizobium japonicum U... 55 3e-06
gi|49076176|ref|XP_402093.1| hypothetical protein UM04478.1 [Ust... 55 3e-06
gi|42518600|ref|NP_964530.1| major facilitator superfamily perme... 55 3e-06
gi|5281442|gb|AAD41517.1| phthalate transporter [Burkholderia ce... 55 3e-06
gi|38099498|gb|EAA46836.1| hypothetical protein MG10530.4 [Magna... 55 3e-06
gi|6320549|ref|NP_010629.1| High-affinity glucose transporter of... 55 4e-06
gi|6320550|ref|NP_010630.1| High-affinity glucose transporter of... 55 4e-06
gi|46312865|ref|ZP_00213458.1| COG0477: Permeases of the major f... 55 4e-06
gi|16125240|ref|NP_419804.1| hexuronate transporter [Caulobacter... 55 4e-06
gi|30678625|ref|NP_567175.2| sugar transporter family protein [A... 55 4e-06
gi|26250735|ref|NP_756775.1| Hypothetical transport protein yjjL... 55 4e-06
gi|21400244|ref|NP_656229.1| sugar_tr, Sugar (and other) transpo... 55 4e-06
gi|49479957|ref|YP_036476.1| drug resistance transporter [Bacill... 55 4e-06
gi|23003645|ref|ZP_00047301.1| COG0477: Permeases of the major f... 55 4e-06
gi|21398703|ref|NP_654688.1| sugar_tr, Sugar (and other) transpo... 55 6e-06
gi|17935745|ref|NP_532535.1| MFS permease [Agrobacterium tumefac... 55 6e-06
gi|9652184|gb|AAF91431.1| putative Na+/myo-inositol symporter [M... 55 6e-06
gi|26249273|ref|NP_755313.1| Arabinose-proton symporter [Escheri... 55 6e-06
gi|542281|pir||S43185 hexose transport protein HXT6 - yeast (Sac... 55 6e-06
gi|24114120|ref|NP_708630.1| low-affinity L-arabinose transport ... 55 6e-06
gi|46114516|ref|XP_383276.1| hypothetical protein FG03100.1 [Gib... 55 6e-06
gi|50422025|ref|XP_459574.1| unnamed protein product [Debaryomyc... 55 6e-06
gi|48895353|ref|ZP_00328337.1| COG0477: Permeases of the major f... 55 6e-06
gi|15889156|ref|NP_354837.1| AGR_C_3403p [Agrobacterium tumefaci... 55 6e-06
gi|49085504|ref|XP_404869.1| hypothetical protein AN0732.2 [Aspe... 55 6e-06
gi|50284831|ref|XP_444843.1| unnamed protein product [Candida gl... 55 6e-06
gi|16125755|ref|NP_420319.1| major facilitator family transporte... 55 6e-06
gi|39997586|ref|NP_953537.1| major facilitator family transporte... 55 6e-06
gi|15238089|ref|NP_196581.1| transporter-related [Arabidopsis th... 55 6e-06
gi|17549833|ref|NP_523173.1| PROBABLE TRANSPORT TRANSMEMBRANE PR... 55 6e-06
gi|42781467|ref|NP_978714.1| drug resistance transporter, EmrB/Q... 55 6e-06
gi|30064182|ref|NP_838353.1| low-affinity L-arabinose transport ... 55 6e-06
gi|15803361|ref|NP_289394.1| low-affinity L-arabinose transport ... 55 6e-06
gi|882734|gb|AAB40488.1| CG Site No. 1024 55 6e-06
gi|15609983|ref|NP_217362.1| efpA [Mycobacterium tuberculosis H3... 55 6e-06
gi|31794023|ref|NP_856516.1| POSSIBLE INTEGRAL MEMBRANE EFFLUX P... 55 6e-06
gi|25029087|ref|NP_739141.1| putative lincomycin-resistance prot... 55 6e-06
gi|28378058|ref|NP_784950.1| multidrug transport protein [Lactob... 55 6e-06
gi|28377626|ref|NP_784518.1| multidrug transport protein [Lactob... 55 6e-06
gi|50123298|ref|YP_052465.1| probable sugar transporter [Erwinia... 55 6e-06
gi|20090708|ref|NP_616783.1| membrane transport protein [Methano... 54 7e-06
gi|30260839|ref|NP_843216.1| proton/peptide symporter family pro... 54 7e-06
gi|6322247|ref|NP_012321.1| Protein of unknown function with sim... 54 7e-06
gi|37527021|ref|NP_930365.1| hypothetical protein [Photorhabdus ... 54 7e-06
gi|47567904|ref|ZP_00238611.1| multidrug resistance protein B [B... 54 7e-06
gi|6323653|ref|NP_013724.1| High-affinity glucose transporter of... 54 7e-06
gi|49070416|ref|XP_399497.1| hypothetical protein UM01882.1 [Ust... 54 7e-06
gi|15890776|ref|NP_356448.1| AGR_L_1300p [Agrobacterium tumefaci... 54 7e-06
gi|15899433|ref|NP_344038.1| Permease [Sulfolobus solfataricus P... 54 7e-06
gi|48786181|ref|ZP_00282390.1| COG0477: Permeases of the major f... 54 7e-06
gi|21672945|ref|NP_661010.1| multidrug resistance protein [Chlor... 54 7e-06
gi|47568818|ref|ZP_00239512.1| di-/tripeptide transporter [Bacil... 54 1e-05
gi|42779835|ref|NP_977082.1| proton/peptide symporter family pro... 54 1e-05
gi|23105460|ref|ZP_00091916.1| COG0477: Permeases of the major f... 54 1e-05
gi|16761794|ref|NP_457411.1| L-arabinose isomerase [Salmonella e... 54 1e-05
gi|15889635|ref|NP_355316.1| AGR_C_4286p [Agrobacterium tumefaci... 54 1e-05
gi|6014622|gb|AAF01426.1| Mfs1.1 [Coprinus cinereus] 54 1e-05
gi|17549055|ref|NP_522395.1| PROBABLE HEXURONATE TRANSPORTER TRA... 54 1e-05
gi|23023747|ref|ZP_00062978.1| COG0477: Permeases of the major f... 54 1e-05
gi|16766318|ref|NP_461933.1| L-arabinose/proton symport protein ... 54 1e-05
gi|16799944|ref|NP_470212.1| similar to antibiotic resistance pr... 54 1e-05
gi|48732311|ref|ZP_00266054.1| COG0477: Permeases of the major f... 54 1e-05
gi|30018916|ref|NP_830547.1| Bicyclomycin resistance protein [Ba... 54 1e-05
gi|227416|prf||1703286A tetracycline resistance gene 54 1e-05
gi|532330|dbj|BAA02119.1| TET.BSR [Bacillus subtilis] 54 1e-05
gi|16081129|ref|NP_391957.1| multifunctional tetracycline-metal/... 54 1e-05
gi|23102062|ref|ZP_00088590.1| COG0477: Permeases of the major f... 54 1e-05
gi|45916269|ref|ZP_00197413.1| COG0477: Permeases of the major f... 54 1e-05
gi|49084954|ref|XP_404635.1| hypothetical protein AN0498.2 [Aspe... 54 1e-05
gi|6322242|ref|NP_012316.1| Putative hexose transporter that is ... 54 1e-05
gi|1730047|sp|P53387|KHT2_KLULA Hexose transporter 2 >gnl|BL_ORD... 54 1e-05
gi|14289342|gb|AAK58907.1| benzoate transport protein [Rhodococc... 54 1e-05
gi|17548273|ref|NP_521613.1| PROBABLE METABOLITE TRANSPORT TRANS... 53 2e-05
gi|50306165|ref|XP_453044.1| unnamed protein product [Kluyveromy... 53 2e-05
gi|474915|emb|CAA55564.1| unnamed protein product [Coxiella burn... 53 2e-05
gi|628866|pir||S44207 hypothetical protein 337 - Coxiella burnetii 53 2e-05
gi|13541909|ref|NP_111597.1| Permease (major facilitator superfa... 53 2e-05
gi|16080701|ref|NP_391529.1| ywoD [Bacillus subtilis subsp. subt... 53 2e-05
gi|26989895|ref|NP_745320.1| major facilitator family transporte... 53 2e-05
gi|48865589|ref|ZP_00319448.1| COG0477: Permeases of the major f... 53 2e-05
gi|38099509|gb|EAA46845.1| hypothetical protein MG10539.4 [Magna... 53 2e-05
gi|21224597|ref|NP_630376.1| putative integral membrane transpor... 53 2e-05
gi|29655250|ref|NP_820942.1| drug resistance transporter, Bcr/Cf... 53 2e-05
gi|15965332|ref|NP_385685.1| PUTATIVE TRANSPORT TRANSMEMBRANE PR... 53 2e-05
gi|21244972|ref|NP_644554.1| hexuranate transporter [Xanthomonas... 53 2e-05
gi|25027763|ref|NP_737817.1| putative multidrug resistance prote... 53 2e-05
gi|21220812|ref|NP_626591.1| putative integral membrane transpor... 53 2e-05
gi|15802074|ref|NP_288096.1| putative transport protein [Escheri... 53 2e-05
gi|48838052|ref|ZP_00295002.1| COG0477: Permeases of the major f... 53 2e-05
gi|46142444|ref|ZP_00149137.2| COG0477: Permeases of the major f... 53 2e-05
gi|16077907|ref|NP_388721.1| yfiU [Bacillus subtilis subsp. subt... 53 2e-05
gi|1353516|gb|AAB06594.1| sugar transporter 53 2e-05
gi|23117153|ref|ZP_00101348.1| COG0477: Permeases of the major f... 53 2e-05
gi|19552363|ref|NP_600365.1| permease of the major facilitator s... 53 2e-05
gi|15235767|ref|NP_193381.1| sugar transporter family protein [A... 53 2e-05
gi|17549791|ref|NP_523131.1| PUTATIVE TRANSPORT TRANSMEMBRANE PR... 53 2e-05
gi|47094879|ref|ZP_00232493.1| major facilitator family transpor... 53 2e-05
gi|19112250|ref|NP_595458.1| putative membrane transport protein... 53 2e-05
gi|50424811|ref|XP_460995.1| unnamed protein product [Debaryomyc... 53 2e-05
gi|15898361|ref|NP_342966.1| Multidrug resistance transporter re... 53 2e-05
gi|15598663|ref|NP_252157.1| probable MFS transporter [Pseudomon... 53 2e-05
gi|32038567|ref|ZP_00136839.1| COG0477: Permeases of the major f... 53 2e-05
gi|49081130|ref|XP_404006.1| hypothetical protein UM06391.1 [Ust... 53 2e-05
gi|17979638|gb|AAL50337.1| major facilitator superfamily-like pr... 52 3e-05
gi|28871437|ref|NP_794056.1| drug resistance transporter, EmrB/Q... 52 3e-05
gi|16122465|ref|NP_405778.1| putative integral membrane protein ... 52 3e-05
gi|50291419|ref|XP_448142.1| unnamed protein product [Candida gl... 52 3e-05
gi|50256298|gb|EAL19023.1| hypothetical protein CNBH1250 [Crypto... 52 3e-05
gi|32410455|ref|XP_325708.1| hypothetical protein [Neurospora cr... 52 3e-05
gi|25026960|ref|NP_737014.1| putative transport protein [Coryneb... 52 3e-05
gi|49071848|ref|XP_400213.1| hypothetical protein UM02598.1 [Ust... 52 3e-05
gi|46115766|ref|XP_383901.1| hypothetical protein FG03725.1 [Gib... 52 3e-05
gi|13470366|ref|NP_101934.1| bicyclomycin resistance protein [Me... 52 3e-05
gi|16081842|ref|NP_394237.1| sugar transport protein related pro... 52 3e-05
gi|46104093|ref|ZP_00198873.1| COG0477: Permeases of the major f... 52 3e-05
gi|15601725|ref|NP_233356.1| conserved hypothetical protein [Vib... 52 3e-05
gi|46114312|ref|XP_383174.1| hypothetical protein FG02998.1 [Gib... 52 3e-05
gi|49475966|ref|YP_034007.1| Transport protein [Bartonella hense... 52 3e-05
gi|15615871|ref|NP_244175.1| multidrug resistance protein [Bacil... 52 4e-05
gi|49087886|ref|XP_405828.1| hypothetical protein AN1691.2 [Aspe... 52 4e-05
gi|16080636|ref|NP_391464.1| ywtG [Bacillus subtilis subsp. subt... 52 4e-05
gi|32141119|ref|NP_733510.1| putative transmembrane efflux prote... 52 4e-05
gi|17548403|ref|NP_521743.1| PROBABLE TRANSPORTER TRANSMEMBRANE ... 52 4e-05
gi|46228125|gb|EAK89024.1| 12 transmembrane domain protein MFS f... 52 4e-05
gi|46907105|ref|YP_013494.1| major facilitator family transporte... 52 4e-05
gi|46363517|ref|ZP_00189667.3| COG0477: Permeases of the major f... 52 4e-05
gi|49184858|ref|YP_028110.1| transporter protein [Bacillus anthr... 52 4e-05
gi|46106652|ref|ZP_00187576.2| COG0477: Permeases of the major f... 52 4e-05
gi|16077317|ref|NP_388130.1| ycbE [Bacillus subtilis subsp. subt... 52 4e-05
gi|47093215|ref|ZP_00230988.1| major facilitator family transpor... 52 4e-05
gi|46909033|ref|YP_015422.1| major facilitator family transporte... 52 4e-05
gi|16804882|ref|NP_466367.1| similar to transmembrane efflux pro... 52 4e-05
gi|2507447|sp|P37597|YDHC_ECOLI Hypothetical transport protein y... 52 5e-05
gi|30063176|ref|NP_837347.1| putative transport protein [Shigell... 52 5e-05
gi|49176132|ref|YP_025306.1| putative transport protein; putativ... 52 5e-05
gi|47566783|ref|ZP_00237501.1| multidrug resistance protein, put... 52 5e-05
gi|23015523|ref|ZP_00055297.1| COG0477: Permeases of the major f... 52 5e-05
gi|16130844|ref|NP_417418.1| galactose-proton symport of transpo... 52 5e-05
gi|15803482|ref|NP_289515.1| galactose-proton symport of transpo... 52 5e-05
gi|26990106|ref|NP_745531.1| tartrate MFS transporter, putative ... 52 5e-05
gi|46107656|ref|XP_380887.1| hypothetical protein FG00711.1 [Gib... 52 5e-05
gi|42454142|ref|ZP_00154049.1| hypothetical protein Rick102901 [... 52 5e-05
gi|46114732|ref|XP_383384.1| hypothetical protein FG03208.1 [Gib... 52 5e-05
gi|49117687|ref|XP_412220.1| hypothetical protein AN8083.2 [Aspe... 52 5e-05
gi|46318264|ref|ZP_00218739.1| COG0477: Permeases of the major f... 52 5e-05
gi|46131522|ref|ZP_00169763.2| COG0477: Permeases of the major f... 52 5e-05
gi|24114198|ref|NP_708708.1| galactose-proton symport of transpo... 52 5e-05
gi|26249364|ref|NP_755404.1| Galactose-proton symporter [Escheri... 52 5e-05
gi|1361071|pir||S56583 hypothetical protein f261b - Escherichia ... 52 5e-05
gi|30064259|ref|NP_838430.1| galactose:proton symporter, MFS fam... 52 5e-05
gi|27380705|ref|NP_772234.1| MFS permease [Bradyrhizobium japoni... 52 5e-05
gi|29469215|gb|AAO65328.1| putative transmembrane efflux protein... 52 5e-05
gi|7487305|pir||T12997 hypothetical protein T21L8.170 - Arabidop... 52 5e-05
gi|18408421|ref|NP_566891.1| glycerol-3-phosphate transporter, p... 52 5e-05
gi|16802913|ref|NP_464398.1| similar to antibiotic resistance pr... 52 5e-05
gi|16077257|ref|NP_388070.1| ybcL [Bacillus subtilis subsp. subt... 52 5e-05
gi|15678132|ref|NP_275247.1| multidrug transporter homolog [Meth... 51 6e-05
gi|24113050|ref|NP_707560.1| Bicyclomycin resistance protein (Su... 51 6e-05
gi|9801985|gb|AAF99573.1| fluconazole resistance protein [Candid... 51 6e-05
gi|42520142|ref|NP_966057.1| drug resistance transporter [Wolbac... 51 6e-05
gi|50311699|ref|XP_455877.1| unnamed protein product [Kluyveromy... 51 6e-05
gi|46113279|ref|ZP_00182596.2| COG0477: Permeases of the major f... 51 6e-05
gi|30018866|ref|NP_830497.1| Di-/tripeptide transporter [Bacillu... 51 6e-05
gi|15218229|ref|NP_177937.1| transporter-related [Arabidopsis th... 51 6e-05
gi|23098415|ref|NP_691881.1| multidrug resistance protein [Ocean... 51 6e-05
gi|46124167|ref|XP_386637.1| hypothetical protein FG06461.1 [Gib... 51 6e-05
gi|21233541|ref|NP_639458.1| putative hexuronate transporter [Xa... 51 6e-05
gi|46319482|ref|ZP_00219887.1| COG0477: Permeases of the major f... 51 6e-05
gi|16330428|ref|NP_441156.1| quinolene resistance protein; NorA ... 51 6e-05
gi|16762493|ref|NP_458110.1| putative membrane transport protein... 51 6e-05
gi|12658422|gb|AAK01131.1| putative hexuronate transporter [Xant... 51 6e-05
gi|48788018|ref|ZP_00283997.1| COG0477: Permeases of the major f... 51 6e-05
gi|6324417|ref|NP_014486.1| Putative hexose transporter that is ... 51 6e-05
gi|6320552|ref|NP_010632.1| Low affinity glucose transporter of ... 51 6e-05
gi|21673820|ref|NP_661885.1| drug resistance protein, putative [... 51 6e-05
gi|15920943|ref|NP_376612.1| 478aa long hypothetical transporter... 51 6e-05
gi|48786004|ref|ZP_00282213.1| COG0477: Permeases of the major f... 51 6e-05
gi|41409013|ref|NP_961849.1| EfpA_2 [Mycobacterium avium subsp. ... 51 6e-05
gi|13471679|ref|NP_103246.1| probable transporter [Mesorhizobium... 51 8e-05
gi|15806345|ref|NP_295051.1| multidrug-efflux transporter [Deino... 51 8e-05
gi|46114426|ref|XP_383231.1| hypothetical protein FG03055.1 [Gib... 51 8e-05
gi|50302537|ref|XP_451203.1| unnamed protein product [Kluyveromy... 51 8e-05
gi|48866283|ref|ZP_00320139.1| COG0477: Permeases of the major f... 51 8e-05
gi|5833395|gb|AAD53495.1| HpaX [Salmonella enterica subsp. enter... 51 8e-05
gi|16506128|dbj|BAB70702.1| putative benzoate transporter [Rhodo... 51 8e-05
gi|48787405|ref|ZP_00283487.1| COG0477: Permeases of the major f... 51 8e-05
gi|27367831|ref|NP_763358.1| Permease of the major facilitator s... 51 8e-05
gi|39935943|ref|NP_948219.1| possible MDR related permease [Rhod... 51 8e-05
gi|46322921|ref|ZP_00223288.1| COG0477: Permeases of the major f... 51 8e-05
gi|46237511|emb|CAG14958.1| putative transmembrane efflux protei... 51 8e-05
gi|21400778|ref|NP_656763.1| sugar_tr, Sugar (and other) transpo... 51 8e-05
gi|28870366|ref|NP_792985.1| membrane protein, putative [Pseudom... 51 8e-05
gi|6014624|gb|AAF01427.1| Mfs1.2 [Coprinus cinereus] 51 8e-05
gi|37537174|ref|NP_922890.1| putative sugar transporter protein ... 51 8e-05
gi|46366833|ref|ZP_00229023.1| COG0477: Permeases of the major f... 51 8e-05
gi|49480256|ref|YP_035093.1| multidrug resistance protein B [Bac... 51 8e-05
gi|23023737|ref|ZP_00062968.1| COG0477: Permeases of the major f... 51 8e-05
gi|47571910|ref|ZP_00241958.1| COG0477: Permeases of the major f... 51 8e-05
gi|23105248|ref|ZP_00091706.1| COG2814: Arabinose efflux permeas... 51 8e-05
gi|15898017|ref|NP_342622.1| Multidrug resistance protein [Sulfo... 51 8e-05
gi|50289667|ref|XP_447265.1| unnamed protein product [Candida gl... 51 8e-05
gi|5420310|emb|CAB46647.1| putative multiple drug resistance pro... 51 8e-05
gi|37675960|ref|NP_936356.1| permease [Vibrio vulnificus YJ016] ... 51 8e-05
gi|46317722|ref|ZP_00218300.1| COG0477: Permeases of the major f... 51 8e-05
gi|6093708|sp|O24723|PHDK_NOCSK Probable 1-hydroxy-2-naphthoate ... 51 8e-05
gi|50417593|ref|XP_457702.1| unnamed protein product [Debaryomyc... 51 8e-05
gi|48772714|ref|ZP_00277056.1| COG0477: Permeases of the major f... 51 8e-05
gi|46187518|ref|ZP_00127320.2| COG0477: Permeases of the major f... 51 8e-05
gi|46205092|ref|ZP_00049044.2| COG0477: Permeases of the major f... 51 8e-05
gi|46137209|ref|XP_390296.1| hypothetical protein FG10120.1 [Gib... 50 1e-04
gi|16759986|ref|NP_455603.1| putative 4-hydroxyphenylacetate per... 50 1e-04
gi|15004827|ref|NP_149287.1| Permease, MDR related, probably tet... 50 1e-04
gi|11357408|pir||T45634 hypothetical protein F13I12.30 - Arabido... 50 1e-04
gi|19553879|ref|NP_601881.1| permease of the major facilitator s... 50 1e-04
gi|50084962|ref|YP_046472.1| putative benzoate transport protein... 50 1e-04
gi|16761866|ref|NP_457483.1| galactose-proton symport (galactose... 50 1e-04
gi|21224155|ref|NP_629934.1| transmembrane efflux protein [Strep... 50 1e-04
gi|50419855|ref|XP_458460.1| unnamed protein product [Debaryomyc... 50 1e-04
gi|46314695|ref|ZP_00215280.1| COG0477: Permeases of the major f... 50 1e-04
gi|37527689|ref|NP_931033.1| Fosmidomycin resistance protein [Ph... 50 1e-04
gi|38111919|gb|EAA57414.1| hypothetical protein MG08384.4 [Magna... 50 1e-04
gi|29829831|ref|NP_824465.1| putative membrane protein [Streptom... 50 1e-04
gi|30021002|ref|NP_832633.1| Peptide permease [Bacillus cereus A... 50 1e-04
gi|49090940|ref|XP_406931.1| hypothetical protein AN2794.2 [Aspe... 50 1e-04
gi|15004812|ref|NP_149272.1| Permease MDR type [Clostridium acet... 50 1e-04
gi|42572593|ref|NP_974392.1| transporter-related [Arabidopsis th... 50 1e-04
gi|37805851|dbj|BAC99502.1| putative Glycerol-3-phosphate transp... 50 1e-04
gi|16081777|ref|NP_394163.1| transport protein related protein [... 50 1e-04
gi|46126477|ref|XP_387792.1| hypothetical protein FG07616.1 [Gib... 50 1e-04
gi|22331630|ref|NP_190282.2| transporter-related [Arabidopsis th... 50 1e-04
gi|45546843|ref|ZP_00186910.1| COG0477: Permeases of the major f... 50 1e-04
gi|17064732|gb|AAL32520.1| putative protein [Arabidopsis thaliana] 50 1e-04
gi|23121415|ref|ZP_00103719.1| COG0477: Permeases of the major f... 50 1e-04
gi|28869110|ref|NP_791729.1| major facilitator family transporte... 50 1e-04
gi|46126331|ref|XP_387719.1| hypothetical protein FG07543.1 [Gib... 50 1e-04
gi|49073584|ref|XP_400999.1| hypothetical protein UM03384.1 [Ust... 50 1e-04
gi|16767664|ref|NP_463279.1| sugar transporter [Salmonella typhi... 50 1e-04
gi|16263819|ref|NP_436611.1| putative efflux protein [Sinorhizo... 50 1e-04
gi|23024130|ref|ZP_00063352.1| COG0477: Permeases of the major f... 50 1e-04
gi|49092118|ref|XP_407520.1| hypothetical protein AN3383.2 [Aspe... 50 1e-04
gi|28870089|ref|NP_792708.1| tartrate transporter, putative [Pse... 50 1e-04
gi|49477463|ref|YP_036164.1| multidrug resistance protein [Bacil... 50 1e-04
gi|6321886|ref|NP_011962.1| Low-affinity glucose transporter of ... 50 1e-04
gi|30262031|ref|NP_844408.1| multidrug resistance protein, putat... 50 1e-04
gi|45530975|ref|ZP_00182062.1| COG0477: Permeases of the major f... 50 1e-04
gi|38345584|emb|CAD41637.2| OSJNBb0012E24.2 [Oryza sativa (japon... 50 1e-04
gi|171741|gb|AAA34700.1| hexose transporter 50 1e-04
gi|48850461|ref|ZP_00304703.1| COG0477: Permeases of the major f... 50 1e-04
gi|16080340|ref|NP_391167.1| yusP [Bacillus subtilis subsp. subt... 50 1e-04
gi|46105874|ref|ZP_00186259.2| COG0477: Permeases of the major f... 50 1e-04
gi|48786535|ref|ZP_00282669.1| COG0477: Permeases of the major f... 50 1e-04
gi|21399880|ref|NP_655865.1| sugar_tr, Sugar (and other) transpo... 50 1e-04
gi|31217122|ref|XP_316366.1| ENSANGP00000022675 [Anopheles gambi... 50 1e-04
gi|26541551|gb|AAN85538.1| antibiotic efflux protein [Streptomyc... 50 1e-04
gi|17545812|ref|NP_519214.1| PUTATIVE 4-HYDROXYBENZOATE TRANSPOR... 50 1e-04
gi|48733504|ref|ZP_00267247.1| COG0477: Permeases of the major f... 50 1e-04
gi|2246647|gb|AAC46359.1| probable transmembrane protein [Pantoe... 50 1e-04
gi|48852376|ref|ZP_00306563.1| COG0477: Permeases of the major f... 50 1e-04
gi|50553624|ref|XP_504223.1| hypothetical protein [Yarrowia lipo... 50 1e-04
gi|29830095|ref|NP_824729.1| putative integral membrane transpor... 50 1e-04
>gi|17539092|ref|NP_502513.1| spinster-like family member (53.5 kD)
(4N853) [Caenorhabditis elegans]
gi|7497215|pir||T19854 hypothetical protein C39E9.10 - Caenorhabditis
elegans
gi|3874846|emb|CAA94337.1| Hypothetical protein C39E9.10
[Caenorhabditis elegans]
Length = 488
Score = 942 bits (2435), Expect = 0.0
Identities = 473/488 (96%), Positives = 473/488 (96%)
Frame = +1
Query: 1 MVNSQQDYISVTALFVVNLLNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVF 180
MVNSQQDYISVTALFVVNLLNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVF
Sbjct: 1 MVNSQQDYISVTALFVVNLLNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVF 60
Query: 181 SPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPANHFWLFLVLRSFVGIGEASYSNVA 360
SPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPANHFWLFLVLRSFVGIGEASYSNVA
Sbjct: 61 SPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPANHFWLFLVLRSFVGIGEASYSNVA 120
Query: 361 PSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGHWQWGIRVSAIAGLIVM 540
PSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGHWQWGIRVSAIAGLIVM
Sbjct: 121 PSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGHWQWGIRVSAIAGLIVM 180
Query: 541 IALVLFTYEPERGAADKAMGESKDVVVTTNTTYLEDLVILLKTPTLVACTWGYTALVFVS 720
IALVLFTYEPERGAADKAMGESKDVVVTTNTTYLEDLVILLKTPTLVACTWGYTALVFVS
Sbjct: 181 IALVLFTYEPERGAADKAMGESKDVVVTTNTTYLEDLVILLKTPTLVACTWGYTALVFVS 240
Query: 721 GTLSWWEPTVIQHLTAWHQGLNDTKDLASTDKDRVALYFGAITTAGGLIGVIFGSMLSKW 900
GTLSWWEPTVIQHLTAWHQGLNDTKDLASTDKDRVALYFGAITTAGGLIGVIFGSMLSKW
Sbjct: 241 GTLSWWEPTVIQHLTAWHQGLNDTKDLASTDKDRVALYFGAITTAGGLIGVIFGSMLSKW 300
Query: 901 LVAGWGPFRRLQTDRAQPLVXXXXXXXXXXXXXXXMIFGDKSLVLLYIMIFFGITFMCFN 1080
LVAGWGPFRRLQTDRAQPLV MIFGDKSLVLLYIMIFFGITFMCFN
Sbjct: 301 LVAGWGPFRRLQTDRAQPLVAGGGALLAAPFLLIGMIFGDKSLVLLYIMIFFGITFMCFN 360
Query: 1081 WGLNIDMLTTVIHPNRRSTAFSYFVLVSHLFGDASGPYLIGLISDAIRHGSTYPKDQYHS 1260
WGLNIDMLTTVIHPNRRSTAFSYFVLVSHLFGDASGPYLIGLISDAIRHGSTYPKDQYHS
Sbjct: 361 WGLNIDMLTTVIHPNRRSTAFSYFVLVSHLFGDASGPYLIGLISDAIRHGSTYPKDQYHS 420
Query: 1261 LVSATYCCVALLLLSAGLYFVSSLTLVSDRKKFRAEMGLDDLQSKPIRTSTDSLERIGIN 1440
LVSATYCCVALLLLSAGLYFVSSLTLVSDRKKFRAEMGLDDLQSKPIRTSTDSLERIGIN
Sbjct: 421 LVSATYCCVALLLLSAGLYFVSSLTLVSDRKKFRAEMGLDDLQSKPIRTSTDSLERIGIN 480
Query: 1441 DDVASSRL 1464
DDVASSRL
Sbjct: 481 DDVASSRL 488
>gi|39587724|emb|CAE58662.1| Hypothetical protein CBG01831
[Caenorhabditis briggsae]
Length = 488
Score = 893 bits (2307), Expect = 0.0
Identities = 441/488 (90%), Positives = 458/488 (93%)
Frame = +1
Query: 1 MVNSQQDYISVTALFVVNLLNYVDRYTVAGVLTQVQTYYNISDSLGGLIQTVFLISFMVF 180
MVNSQ+DYISVT LFVVNLLNYVDRYTVAGVLT VQTYYNISDSLGGLIQTVFLISFMVF
Sbjct: 1 MVNSQEDYISVTVLFVVNLLNYVDRYTVAGVLTAVQTYYNISDSLGGLIQTVFLISFMVF 60
Query: 181 SPVCGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPANHFWLFLVLRSFVGIGEASYSNVA 360
SP+CGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPANHFWLFLVLRSFVGIGEASYSNVA
Sbjct: 61 SPICGYLGDRFNRKWIMIIGVGIWLGAVLGSSFVPANHFWLFLVLRSFVGIGEASYSNVA 120
Query: 361 PSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGHWQWGIRVSAIAGLIVM 540
PSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGHWQWGIRVSAIAG IVM
Sbjct: 121 PSLISDMFNGQKRSTVFMIFYFAIPVGSGLGFIVGSNVATLTGHWQWGIRVSAIAGFIVM 180
Query: 541 IALVLFTYEPERGAADKAMGESKDVVVTTNTTYLEDLVILLKTPTLVACTWGYTALVFVS 720
IALVLFTYEPERGAAD+A G++KD VV TNTTYLEDLVILLKTPTLVACTWGYTALVFVS
Sbjct: 181 IALVLFTYEPERGAADRANGDAKDTVVATNTTYLEDLVILLKTPTLVACTWGYTALVFVS 240
Query: 721 GTLSWWEPTVIQHLTAWHQGLNDTKDLASTDKDRVALYFGAITTAGGLIGVIFGSMLSKW 900
GTLSWWEPTVIQHLTAWHQGLNDTK+L +TDKDRVALYFGAITTAGGLIGVIFGSMLSKW
Sbjct: 241 GTLSWWEPTVIQHLTAWHQGLNDTKELPTTDKDRVALYFGAITTAGGLIGVIFGSMLSKW 300
Query: 901 LVAGWGPFRRLQTDRAQPLVXXXXXXXXXXXXXXXMIFGDKSLVLLYIMIFFGITFMCFN 1080
LVAGWGPF+R QT+RA PLV MIFG+ SLVLLY+MIFFG+TF+CFN
Sbjct: 301 LVAGWGPFKRFQTERAPPLVSGGGALLAAPLLLIGMIFGEMSLVLLYVMIFFGLTFLCFN 360
Query: 1081 WGLNIDMLTTVIHPNRRSTAFSYFVLVSHLFGDASGPYLIGLISDAIRHGSTYPKDQYHS 1260
WGLNIDMLTTVIHPNRRSTAFSYFVLVSHLFGDASGPYLIGLISD IRHGST PKDQYHS
Sbjct: 361 WGLNIDMLTTVIHPNRRSTAFSYFVLVSHLFGDASGPYLIGLISDLIRHGSTLPKDQYHS 420
Query: 1261 LVSATYCCVALLLLSAGLYFVSSLTLVSDRKKFRAEMGLDDLQSKPIRTSTDSLERIGIN 1440
LV+ATYCCVALLL+SAGLYFVSSLTLVSDR+KFR EMGLDDLQSKPIRTSTDSLERIG N
Sbjct: 421 LVTATYCCVALLLISAGLYFVSSLTLVSDRRKFRMEMGLDDLQSKPIRTSTDSLERIGAN 480
Query: 1441 DDVASSRL 1464
D+V SSRL
Sbjct: 481 DEVMSSRL 488