Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C44C11_2
(639 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535679|ref|NP_496623.1| R-RAS related, viral oncogene homol... 392 e-108
gi|39591432|emb|CAE73486.1| Hypothetical protein CBG20938 [Caeno... 378 e-104
gi|7497401|pir||T32953 hypothetical protein C44C11.1 - Caenorhab... 335 3e-91
gi|24636154|gb|AAN63433.1| R-ras related protein 1, isoform b [C... 259 2e-68
gi|31206299|ref|XP_312101.1| ENSANGP00000016959 [Anopheles gambi... 223 2e-57
gi|50747790|ref|XP_420993.1| PREDICTED: similar to related RAS v... 222 5e-57
gi|47230460|emb|CAF99653.1| unnamed protein product [Tetraodon n... 221 9e-57
gi|68947|pir||TVHUC2 GTP-binding protein RAS/TC21 - human >gnl|B... 221 1e-56
gi|21361416|ref|NP_036382.2| related RAS viral (r-ras) oncogene ... 221 1e-56
gi|26347567|dbj|BAC37432.1| unnamed protein product [Mus musculus] 221 1e-56
gi|48105901|ref|XP_393035.1| similar to ENSANGP00000016959 [Apis... 220 2e-56
gi|13399308|ref|NP_080122.1| related RAS viral (r-ras) oncogene ... 218 6e-56
gi|34871550|ref|XP_220535.2| similar to Ras-related protein R-Ra... 213 3e-54
gi|49118305|gb|AAH73313.1| Unknown (protein for MGC:80716) [Xeno... 212 4e-54
gi|6677819|ref|NP_033127.1| Harvey rat sarcoma oncogene, subgrou... 212 6e-54
gi|24657269|ref|NP_523917.2| CG1167-PA [Drosophila melanogaster]... 211 7e-54
gi|34856057|ref|XP_341852.1| similar to RAS-RELATED PROTEIN R-RA... 209 4e-53
gi|30583789|gb|AAP36143.1| Homo sapiens related RAS viral (r-ras... 209 5e-53
gi|5454028|ref|NP_006261.1| related RAS viral (r-ras) oncogene h... 209 5e-53
gi|730474|sp|P38976|RAS2_HYDMA Ras-like protein RAS2 >gnl|BL_ORD... 205 5e-52
gi|4150910|emb|CAA77070.1| ras protein [Suberites domuncula] 202 3e-51
gi|68944|pir||TVFFR transforming protein homolog ras-64B - fruit... 202 3e-51
gi|49068624|ref|XP_398601.1| RASL_COPCI 24 kDa RAS-like protein ... 201 7e-51
gi|6919948|sp|O74650|RAS_CRYNE Ras-like protein >gnl|BL_ORD_ID|9... 199 4e-50
gi|131888|sp|P28775|RAS_LENED Ras-like protein >gnl|BL_ORD_ID|67... 198 8e-50
gi|5916199|gb|AAD55937.1| RAS1 [Filobasidiella neoformans] 198 8e-50
gi|417588|sp|P32252|RASB_DICDI Ras-like protein rasB >gnl|BL_ORD... 197 1e-49
gi|131860|sp|P22278|RAS1_RHIRA Ras-like protein 1 >gnl|BL_ORD_ID... 196 2e-49
gi|10953764|gb|AAG25584.1| RAS protein [Cryptococcus neoformans ... 196 3e-49
gi|13195562|gb|AAK15758.1| ras-like protein [Pisolithus sp. 441] 196 3e-49
gi|464550|sp|Q05058|RASL_COPCI 24 kDa RAS-like protein >gnl|BL_O... 196 3e-49
gi|7638417|gb|AAF65465.1| Ras1p [Suillus bovinus] 195 5e-49
gi|422507|pir||S09554 transforming protein (D-ras-2) - fruit fly... 195 7e-49
gi|6531636|gb|AAF15517.1| TC21 ras-related [Drosophila melanogas... 195 7e-49
gi|46136525|ref|XP_389954.1| RASL_COLTR Ras-like protein [Gibber... 194 9e-49
gi|3929359|sp|O42785|RASL_COLTR Ras-like protein (Ct-Ras) >gnl|B... 194 1e-48
gi|6919950|sp|P87018|RAS_BOTCI Ras-like protein >gnl|BL_ORD_ID|8... 194 2e-48
gi|38106759|gb|EAA53026.1| hypothetical protein MG06154.4 [Magna... 194 2e-48
gi|29467612|dbj|BAC67198.1| ras protein [Fusarium oxysporum] 193 2e-48
gi|50346854|gb|AAT75139.1| ras protein [Sclerotinia sclerotiorum] 191 8e-48
gi|825440|gb|AAB07703.1| RAS [Aspergillus fumigatus] >gnl|BL_ORD... 191 1e-47
gi|68942|pir||TVBYSR transforming protein ras - fission yeast (... 190 2e-47
gi|11274531|pir||T45545 transforming protein ras - fission yeast... 190 2e-47
gi|49084202|ref|XP_404319.1| RAS_EMENI RAS-LIKE PROTEIN [Aspergi... 190 2e-47
gi|6919951|sp|Q12526|RAS_EMENI Ras-like protein >gnl|BL_ORD_ID|3... 190 2e-47
gi|6919949|sp|O93856|RAS_LACBI Ras-like protein >gnl|BL_ORD_ID|1... 189 4e-47
gi|37926420|gb|AAO64439.1| RAS GTPase [Penicillium marneffei] 189 5e-47
gi|5036|emb|CAA27399.1| put. ras protein [Schizosaccharomyces po... 188 7e-47
gi|19114491|ref|NP_593579.1| ras-like protein 1. [Schizosaccharo... 188 7e-47
gi|131862|sp|P15064|RASG_DICDI Ras-like protein rasG >gnl|BL_ORD... 188 7e-47
gi|730475|sp|P03967|RASD_DICDI Ras-like protein rasD (Transformi... 187 1e-46
gi|6324675|ref|NP_014744.1| ras proto-oncogene homolog; Ras1p [S... 187 1e-46
gi|172361|gb|AAA34958.1| RAS1 protein 187 1e-46
gi|464547|sp|P34729|RAS1_PHYPO Ras-like protein 1 >gnl|BL_ORD_ID... 186 4e-46
gi|131867|sp|P22280|RAS3_RHIRA Ras-like protein 3 >gnl|BL_ORD_ID... 185 6e-46
gi|100997|pir||C36365 transforming protein homolog MRAS3 - Rhizo... 185 6e-46
gi|464548|sp|P34726|RAS2_PHYPO Ras-like protein 2 >gnl|BL_ORD_ID... 184 9e-46
gi|131881|sp|P22126|RAS1_NEUCR Ras-1 protein >gnl|BL_ORD_ID|7298... 184 2e-45
gi|32189357|ref|NP_036351.2| muscle RAS oncogene homolog; muscle... 182 5e-45
gi|6226045|sp|O14807|RASM_HUMAN Ras-related protein M-Ras (Ras-r... 182 5e-45
gi|6678930|ref|NP_032650.1| muscle and microspikes RAS [Mus musc... 181 8e-45
gi|6981222|ref|NP_037113.1| muscle and microspikes RAS [Rattus n... 181 8e-45
gi|45383191|ref|NP_989820.1| R-Ras3 [Gallus gallus] >gnl|BL_ORD_... 181 1e-44
gi|49115017|gb|AAH72861.1| Unknown (protein for MGC:80266) [Xeno... 181 1e-44
gi|68948|pir||TVDORS transforming protein ras - slime mold (Dict... 181 1e-44
gi|7438362|pir||JC6328 Ras2 protein - slime mold (Dictyostelium ... 180 2e-44
gi|1575028|gb|AAB09439.1| Psmras1 [Schistosoma mansoni] 180 2e-44
gi|3097258|emb|CAA76679.1| p21-ras protein [Platichthys flesus] 179 4e-44
gi|2147995|pir||S58220 transforming protein ras-2 - Dictyosteliu... 179 5e-44
gi|41053758|ref|NP_956552.1| similar to Kirsten rat sarcoma onco... 178 9e-44
gi|6103365|gb|AAF03566.1| Ras homolog type A [Candida albicans] 178 9e-44
gi|223831|prf||1001202A protein c-ras sc1 178 9e-44
gi|15214239|sp|Q9UQX7|RAS1_CANAL Ras-like protein 1 (Ras homolog... 178 9e-44
gi|46435925|gb|EAK95297.1| hypothetical protein CaO19.9329 [Cand... 178 9e-44
gi|6572473|gb|AAF17287.1| G-protein [Oncorhynchus mykiss] 177 2e-43
gi|6572471|gb|AAF17286.1| G-protein [Oncorhynchus mykiss] 177 2e-43
gi|167869|gb|AAA33245.1| ras protein 177 2e-43
gi|13928698|ref|NP_113703.1| c-K-ras2 protein; c-Kirsten-ras pro... 177 2e-43
gi|22203744|ref|NP_067259.2| c-K-ras2 protein [Mus musculus] >gn... 177 2e-43
gi|48097817|ref|XP_393895.1| similar to muscle RAS oncogene homo... 177 2e-43
gi|939930|emb|CAA80675.1| proto-oncogene protein [Kirsten murine... 177 2e-43
gi|6919953|sp|Q9YH38|RASK_CYPCA Transforming protein p21 (K-Ras)... 176 3e-43
gi|280689|pir||A37355 transforming protein (ras) - African clawe... 176 3e-43
gi|627253|pir||A54321 transforming protein c-Ki-ras-1, hepatic -... 176 3e-43
gi|50729116|ref|XP_416436.1| PREDICTED: similar to turkey K-Ras ... 176 3e-43
gi|15718761|ref|NP_004976.2| c-K-ras2 protein isoform b; Kirsten... 176 3e-43
gi|186764|gb|AAB41942.1| K-ras oncogene protein [Homo sapiens] 176 3e-43
gi|6919952|sp|O42277|RASK_ORYLA Transforming protein p21/K-ras-1... 176 3e-43
gi|422713|pir||S31720 transforming protein (K-ras) - short-taile... 176 3e-43
gi|3097256|emb|CAA76678.1| p21-ras protein [Platichthys flesus] 176 3e-43
gi|131873|sp|P20171|RASH_RAT Transforming protein p21/H-Ras-1 (c... 176 3e-43
gi|18031734|gb|AAK64517.1| small G-protein H-Ras [Xenopus laevis] 176 3e-43
gi|576243|pdb|1PLK| C-H-Ras P21 Protein Mutant With Gly 12 Repl... 176 4e-43
gi|14595125|dbj|BAB61870.1| Rai-chu 101X [synthetic construct] 176 4e-43
gi|38303987|gb|AAH61885.1| Unknown (protein for IMAGE:6311846) [... 176 4e-43
gi|208115|gb|AAA72806.1| p21 protein >gnl|BL_ORD_ID|1323920 gi|2... 176 4e-43
gi|46048705|ref|NP_990623.1| v-Ha-ras Harvey rat sarcoma viral o... 176 4e-43
gi|4885425|ref|NP_005334.1| v-Ha-ras Harvey rat sarcoma viral on... 176 4e-43
gi|131872|sp|P23175|RASH_MSVNS Transforming protein p21 >gnl|BL_... 176 4e-43
gi|230266|pdb|1Q21| c-H-Ras p21 Protein Catalytic Domain Comple... 176 4e-43
gi|230680|pdb|2Q21| c-H-Ras p21 Protein Catalytic Domain (Mutan... 176 4e-43
gi|14595123|dbj|BAB61869.1| Rai-chu 101 [synthetic construct] 176 4e-43
gi|515076|pdb|1AGP| C-H-Ras P21 Protein Mutant With Gly 12 Repl... 175 6e-43
gi|231162|pdb|5P21| c-H-Ras p21 Protein (Amino Acids 1 - 166) C... 175 6e-43
gi|494936|pdb|821P| C-H-Ras P21 Protein (Residues 1 - 166) Muta... 175 6e-43
gi|494886|pdb|421P| H-Ras P21 Protein Mutant With Gly 12 Replac... 175 6e-43
gi|5107686|pdb|1RVD|A Chain A, H-Ras Complexed With Diaminobenzo... 175 6e-43
gi|50424369|ref|XP_460771.1| unnamed protein product [Debaryomyc... 175 6e-43
gi|280937|pir||A43816 transforming protein ras - rabbit 175 6e-43
gi|417590|sp|P32883|RASK_MOUSE Transforming protein p21 (K-Ras 2... 175 8e-43
gi|4930054|pdb|1LFD|B Chain B, Crystal Structure Of The Active R... 174 1e-42
gi|47214681|emb|CAF97205.1| unnamed protein product [Tetraodon n... 174 1e-42
gi|17554726|ref|NP_497972.1| R-RAS related, associated to muscle... 174 1e-42
gi|420621|pir||S34138 transforming protein (K-ras) - Kirsten mur... 174 1e-42
gi|50724567|emb|CAH05038.1| ras GTPase [Echinococcus multilocula... 174 1e-42
gi|243893|gb|AAB21190.1| K-rev-1=transformation-suppressor [mice... 174 1e-42
gi|131871|sp|P01115|RASH_MSVHA Transforming protein p29 [Contain... 174 1e-42
gi|47217082|emb|CAG02393.1| unnamed protein product [Tetraodon n... 174 1e-42
gi|332189|gb|AAA46570.1| p21 v-has transforming protein 174 1e-42
gi|32565695|ref|NP_502213.2| RAS protein, LEThal LET-60, abnorma... 174 1e-42
gi|50285477|ref|XP_445167.1| unnamed protein product [Candida gl... 174 1e-42
gi|15488883|gb|AAH13572.1| C-K-ras2 protein, isoform b [Homo sap... 174 1e-42
gi|126498|sp|P22981|LT60_CAEEL Ras protein let-60 >gnl|BL_ORD_ID... 174 1e-42
gi|131886|sp|P05774|RAS_CARAU Ras-like protein >gnl|BL_ORD_ID|15... 174 1e-42
gi|131870|sp|P01113|RASH_MSV Transforming protein p21 >gnl|BL_OR... 174 1e-42
gi|61559|emb|CAA25322.1| transforming protein p21 [Murine sarcom... 174 1e-42
gi|30585231|gb|AAP36888.1| Homo sapiens v-Ki-ras2 Kirsten rat sa... 174 1e-42
gi|494721|pdb|221P| H-Ras P21 Protein Mutant With Asp 38 Replac... 174 2e-42
gi|494910|pdb|521P| H-Ras P21 Protein Mutant With Gly 12 Replac... 174 2e-42
gi|24987567|pdb|1LF0|A Chain A, Crystal Structure Of Rasa59g In ... 174 2e-42
gi|14488521|pdb|1IAQ|A Chain A, C-H-Ras P21 Protein Mutant With ... 174 2e-42
gi|47219806|emb|CAG03433.1| unnamed protein product [Tetraodon n... 174 2e-42
gi|6680271|ref|NP_032310.1| Harvey rat sarcoma virus oncogene 1 ... 174 2e-42
gi|15718763|ref|NP_203524.1| c-K-ras2 protein isoform a; Kirsten... 174 2e-42
gi|2815620|gb|AAB97888.1| c-Ki-ras-2 protooncogene [Oryzias lati... 174 2e-42
gi|48094861|ref|XP_394288.1| similar to ENSANGP00000013477 [Apis... 173 2e-42
gi|1093939|prf||2105181A c-Ki-ras protooncogene 173 2e-42
gi|494922|pdb|621P| H-Ras P21 Protein Mutant With Gln 61 Replac... 173 2e-42
gi|29726772|pdb|1NVV|Q Chain Q, Structural Evidence For Feedback... 173 2e-42
gi|3290012|gb|AAC25633.1| GTPase K-rasB [Parophrys vetula] 173 2e-42
gi|1172842|sp|Q07983|RASK_MONDO Transforming protein p21 (K-Ras)... 173 2e-42
gi|50760413|ref|XP_418011.1| PREDICTED: similar to GTP-binding p... 173 2e-42
gi|131874|sp|P01114|RASH_RRASV Transforming protein p29 [Contain... 173 3e-42
gi|100996|pir||B36365 transforming protein homolog MRAS2 - Rhizo... 173 3e-42
gi|1346954|sp|P22279|RAS2_RHIRA Ras-like protein 2 >gnl|BL_ORD_I... 173 3e-42
gi|494925|pdb|721P| H-Ras P21 Protein Mutant With Gln 61 Replac... 172 4e-42
gi|39591566|emb|CAE71142.1| Hypothetical protein CBG17997 [Caeno... 172 4e-42
gi|7242162|ref|NP_035067.1| neuroblastoma ras oncogene [Mus musc... 172 4e-42
gi|39593776|emb|CAE62069.1| Hypothetical protein CBG06092 [Caeno... 172 4e-42
gi|4505451|ref|NP_002515.1| neuroblastoma RAS viral (v-ras) onco... 172 4e-42
gi|12847999|dbj|BAB27790.1| unnamed protein product [Mus musculu... 172 4e-42
gi|223752|prf||0909261A protein Calu1 Ki-ras 172 4e-42
gi|18158431|ref|NP_542944.1| neuroblastoma RAS viral (v-ras) onc... 172 4e-42
gi|15082146|gb|AAK84038.1| N-ras [Monodelphis domestica] 172 4e-42
gi|131884|sp|P08556|RASN_MOUSE Transforming protein N-Ras >gnl|B... 172 4e-42
gi|131882|sp|P12825|RASN_CAVPO Transforming protein N-Ras >gnl|B... 172 4e-42
gi|3334309|sp|Q91806|RASN_XENLA Ras-related protein N-Ras >gnl|B... 172 4e-42
gi|464552|sp|Q05147|RASK_XENLA Transforming protein p21 (K-Ras) ... 172 5e-42
gi|17136430|ref|NP_476699.1| CG9375-PA [Drosophila melanogaster]... 172 5e-42
gi|34881271|ref|XP_346330.1| similar to Transforming protein p21... 172 6e-42
gi|13173395|gb|AAK14389.1| Ras [Marsupenaeus japonicus] 171 8e-42
gi|45187611|ref|NP_983834.1| ADL262Wp [Eremothecium gossypii] >g... 171 8e-42
gi|131877|sp|P01117|RASK_MSVKI Transforming protein p21 (K-Ras) ... 171 8e-42
gi|2072749|emb|CAA73253.1| proto-oncogene K-Ras2A [Xenopus laevis] 171 8e-42
gi|172363|gb|AAA34959.1| RAS2 protein 171 1e-41
gi|6324231|ref|NP_014301.1| Ras proto-oncogene homolog. Ras2 is ... 171 1e-41
gi|49904671|gb|AAH76419.1| Unknown (protein for MGC:100761) [Dan... 171 1e-41
gi|225550|prf||1306284A gene Dmras85D 170 2e-41
gi|422506|pir||S35097 transforming protein (D-ras-1) - fruit fly... 170 2e-41
gi|4291|emb|CAA25207.1| unnamed protein product [Saccharomyces c... 170 2e-41
gi|19070091|emb|CAD24769.1| small G protein [Oscheius tipulae] 169 3e-41
gi|417591|sp|P32254|RASS_DICDI Ras-like protein rasS >gnl|BL_ORD... 169 5e-41
gi|226746|prf||1604384A ras oncogene 169 5e-41
gi|131885|sp|P18262|RAS_ARTSA Ras-like protein >gnl|BL_ORD_ID|14... 168 7e-41
gi|31198035|ref|XP_307965.1| ENSANGP00000013477 [Anopheles gambi... 168 9e-41
gi|417589|sp|P32253|RASC_DICDI Ras-like protein rasC >gnl|BL_ORD... 168 9e-41
gi|18859133|ref|NP_571220.1| N-ras oncogene p21; etID18709.8 [Da... 167 1e-40
gi|3599487|gb|AAC35360.1| Ras protein [Xenopus laevis] 167 2e-40
gi|48132532|ref|XP_396692.1| similar to ENSANGP00000020068 [Apis... 167 2e-40
gi|6093896|sp|P51539|RAS1_HYDMA Ras-like protein RAS1 >gnl|BL_OR... 165 6e-40
gi|17542026|ref|NP_501549.1| vertebrate Rap GTPase homolog, RAS ... 164 2e-39
gi|4204833|gb|AAD10840.1| Rap1b 163 2e-39
gi|17136706|ref|NP_476857.1| CG1956-PA [Drosophila melanogaster]... 163 2e-39
gi|1674499|gb|AAB19064.1| RAS-protein [Pristionchus pacificus] 162 4e-39
gi|539995|pir||A61216 transforming protein rap1b - rat (strain C... 162 4e-39
gi|31241521|ref|XP_321191.1| ENSANGP00000020068 [Anopheles gambi... 162 5e-39
gi|37682135|gb|AAQ97994.1| RAP1B, member of RAS oncogene family ... 162 5e-39
gi|7661678|ref|NP_056461.1| RAP1B, member of RAS oncogene family... 161 9e-39
gi|49069938|ref|XP_399258.1| hypothetical protein UM01643.1 [Ust... 161 9e-39
gi|29747856|gb|AAH50837.1| Unknown (protein for IMAGE:6509827) [... 161 1e-38
gi|27924412|gb|AAH44988.1| Rap1b-prov protein [Xenopus laevis] 161 1e-38
gi|14595132|dbj|BAB61868.1| Raichu404X [Homo sapiens] 160 2e-38
gi|50344960|ref|NP_001002152.1| zgc:86676 [Danio rerio] >gnl|BL_... 160 2e-38
gi|34222246|ref|NP_789765.1| v-Ha-ras Harvey rat sarcoma viral o... 160 2e-38
gi|50259164|gb|EAL21841.1| hypothetical protein CNBC5420 [Crypto... 160 2e-38
gi|1942609|pdb|1GUA|A Chain A, Human Rap1a, Residues 1-167, Doub... 159 3e-38
gi|50418419|gb|AAH78173.1| RAP1B, member of RAS oncogene family ... 159 3e-38
gi|41054748|ref|NP_955827.1| RAS related protein 1b [Danio rerio... 159 3e-38
gi|4506413|ref|NP_002875.1| RAP1A, member of RAS oncogene family... 159 3e-38
gi|5821936|pdb|1C1Y|A Chain A, Crystal Structure Of Rap.Gmppnp I... 159 4e-38
gi|50760377|ref|XP_417994.1| PREDICTED: similar to turkey RAP1Ab... 159 4e-38
gi|47559058|gb|AAT35577.1| Rap 1A2 GTPase [Xenopus laevis] >gnl|... 158 7e-38
gi|17137290|ref|NP_477211.1| CG8418-PA [Drosophila melanogaster]... 158 7e-38
gi|28556888|dbj|BAC57522.1| ras-related protein RAP-1B homologue... 158 7e-38
gi|131854|sp|P22123|RAPA_DISOM Ras-related protein O-Krev >gnl|B... 158 7e-38
gi|48101484|ref|XP_395139.1| similar to ENSANGP00000015690 [Apis... 158 7e-38
gi|46129264|ref|XP_388993.1| hypothetical protein FG08817.1 [Gib... 158 1e-37
gi|47559056|gb|AAT35576.1| Rap 1A GTPase [Xenopus laevis] >gnl|B... 157 1e-37
gi|47212340|emb|CAF95609.1| unnamed protein product [Tetraodon n... 157 1e-37
gi|31210165|ref|XP_314049.1| ENSANGP00000015690 [Anopheles gambi... 157 2e-37
gi|103719|pir||F38625 GTP-binding protein o-Krev - electric ray ... 156 3e-37
gi|6677755|ref|NP_033095.1| Ras-like without CAAX 1; RAS-like pr... 156 3e-37
gi|1710782|sp|P52498|RSR1_CANAL Ras-related protein RSR1 >gnl|BL... 156 4e-37
gi|23506657|gb|AAN37908.1| ras-like protein Ras1 [Ustilago maydis] 156 4e-37
gi|50305553|ref|XP_452736.1| unnamed protein product [Kluyveromy... 156 4e-37
gi|131850|sp|P18613|RAP1_DICDI Ras-related protein Rap-1 >gnl|BL... 155 5e-37
gi|50556738|ref|XP_505777.1| hypothetical protein [Yarrowia lipo... 155 5e-37
gi|50603602|gb|AAH77235.1| Unknown (protein for MGC:79097) [Xeno... 155 6e-37
gi|6321591|ref|NP_011668.1| Gtp-binding protein of the ras super... 154 1e-36
gi|5902050|ref|NP_008843.1| Ras-like without CAAX 1; Ric-like, e... 154 1e-36
gi|48136808|ref|XP_396784.1| similar to ENSANGP00000009196 [Apis... 153 2e-36
gi|2118466|pir||I80324 PR371 c-K-ras oncogene - human (fragment)... 153 2e-36
gi|9297051|sp|Q94694|RAP1_PHYPO Ras-related protein Rap-1 (Pprap... 153 2e-36
gi|2130655|gb|AAB58345.1| Pprap1 protein [Physarum polycephalum] 153 2e-36
gi|50428145|ref|XP_458406.1| unnamed protein product [Debaryomyc... 153 3e-36
gi|45198982|ref|NP_986011.1| AFR464Wp [Eremothecium gossypii] >g... 152 4e-36
gi|38107600|gb|EAA53749.1| hypothetical protein MG09499.4 [Magna... 152 4e-36
gi|19705451|ref|NP_599173.1| RAP1B, member of RAS oncogene famil... 152 5e-36
gi|31240013|ref|XP_320420.1| ENSANGP00000009196 [Anopheles gambi... 152 7e-36
gi|47229149|emb|CAG03901.1| unnamed protein product [Tetraodon n... 152 7e-36
gi|17933550|ref|NP_525063.1| CG2849-PC [Drosophila melanogaster]... 151 9e-36
gi|2118467|pir||I59431 PR310 c-K-ras oncogene - human (fragment)... 151 9e-36
gi|31240015|ref|XP_320421.1| ENSANGP00000023453 [Anopheles gambi... 151 9e-36
gi|24639550|ref|NP_726881.1| CG2849-PB [Drosophila melanogaster]... 150 2e-35
gi|1890611|emb|CAA72269.1| Ras protein homologue [Schistosoma ma... 150 2e-35
gi|32404610|ref|XP_322918.1| RAS-2 PROTEIN [Neurospora crassa] >... 150 2e-35
gi|1109582|gb|AAA83022.1| RAS gene product 150 2e-35
gi|37619841|emb|CAB02777.2| Hypothetical protein C25D7.7 [Caenor... 150 3e-35
gi|49070746|ref|XP_399662.1| hypothetical protein UM02047.1 [Ust... 149 3e-35
gi|50811628|ref|XP_422862.1| PREDICTED: similar to GTP-binding p... 149 3e-35
gi|47122956|gb|AAH70626.1| Unknown (protein for MGC:81417) [Xeno... 149 3e-35
gi|34811640|pdb|1UAD|A Chain A, Crystal Structure Of The Rala-Gp... 149 4e-35
gi|47214376|emb|CAG00857.1| unnamed protein product [Tetraodon n... 149 4e-35
gi|190850|gb|AAA36542.1| GTP-binding protein (ral) >gnl|BL_ORD_I... 149 4e-35
gi|48143221|ref|XP_397415.1| similar to CG3204-PA [Apis mellifera] 149 4e-35
gi|33946329|ref|NP_005393.2| ras related v-ral simian leukemia v... 149 4e-35
gi|1113079|dbj|BAA03708.1| NC-ras-2 protein [Neurospora crassa] 149 6e-35
gi|50547057|ref|XP_500998.1| hypothetical protein [Yarrowia lipo... 149 6e-35
gi|39583352|emb|CAE66326.1| Hypothetical protein CBG11577 [Caeno... 149 6e-35
gi|13592039|ref|NP_112355.1| ras related v-ral simian leukemia v... 149 6e-35
gi|50417056|gb|AAH78184.1| Unknown (protein for MGC:100801) [Dan... 148 8e-35
gi|27695324|gb|AAH43066.1| Unknown (protein for IMAGE:5709337) [... 148 8e-35
gi|40254160|ref|NP_083795.2| RIKEN cDNA 5830461H18 [Mus musculus... 148 8e-35
gi|29144971|gb|AAH49084.1| Unknown (protein for IMAGE:5706690) [... 148 8e-35
gi|50732996|ref|XP_418863.1| PREDICTED: similar to ras related v... 148 8e-35
gi|17556130|ref|NP_497689.1| v-ral simian leukemia viral oncogen... 148 1e-34
gi|13386338|ref|NP_082988.1| RAP2B, member of RAS oncogene famil... 148 1e-34
gi|68950|pir||TVHUR2 transforming protein rap2b - human >gnl|BL_... 148 1e-34
gi|131837|sp|P22124|RAL_DISOM Ras-related protein O-RAL >gnl|BL_... 148 1e-34
gi|2780995|pdb|1KAO| Crystal Structure Of The Small G Protein R... 147 1e-34
gi|48926639|ref|NP_001001729.1| RAP2B, member of RAS oncogene fa... 147 1e-34
gi|28175267|gb|AAH45215.1| Rap-2-prov protein [Xenopus laevis] >... 147 1e-34
gi|10518344|ref|NP_066361.1| RAP2A, member of RAS oncogene famil... 147 1e-34
gi|9247092|gb|AAF86279.1| Ras related small G protein RAL-A [Xen... 147 1e-34
gi|12851417|dbj|BAB29033.1| unnamed protein product [Mus musculus] 147 1e-34
gi|46137197|ref|XP_390290.1| conserved hypothetical protein [Gib... 147 1e-34
gi|39588853|emb|CAE69483.1| Hypothetical protein CBG15686 [Caeno... 147 2e-34
gi|39578579|gb|AAR28683.1| small GTPase Rap2 [Xenopus laevis] >g... 147 2e-34
gi|41056021|ref|NP_957312.1| similar to v-ral simian leukemia vi... 147 2e-34
gi|50344902|ref|NP_001002123.1| zgc:86798 [Danio rerio] >gnl|BL_... 147 2e-34
gi|47225282|emb|CAG09782.1| unnamed protein product [Tetraodon n... 147 2e-34
gi|47937473|gb|AAH72046.1| MGC78904 protein [Xenopus laevis] 147 2e-34
gi|34098770|sp|Q9YH09|RALB_XENLA Ras-related protein Ral-B >gnl|... 147 2e-34
gi|30584187|gb|AAP36342.1| Homo sapiens v-ral simian leukemia vi... 146 3e-34
gi|3434937|dbj|BAA32410.1| krev-1 [Neurospora crassa] 146 3e-34
gi|47222817|emb|CAF96484.1| unnamed protein product [Tetraodon n... 146 3e-34
gi|27694827|gb|AAH43998.1| Rap2c-prov protein [Xenopus laevis] 146 3e-34
gi|50750662|ref|XP_422085.1| PREDICTED: similar to Ras-related p... 146 3e-34
gi|4506405|ref|NP_002872.1| v-ral simian leukemia viral oncogene... 146 3e-34
gi|47208127|emb|CAF98163.1| unnamed protein product [Tetraodon n... 146 3e-34
gi|17390126|gb|AAH18060.1| Ras-like without CAAX 2 [Homo sapiens] 146 4e-34
gi|4506533|ref|NP_002921.1| Ras-like without CAAX 2; Ric-like, e... 146 4e-34
gi|29477081|gb|AAH50056.1| Rap2c protein [Mus musculus] 145 5e-34
gi|40675538|gb|AAH64814.1| Rap2c protein [Mus musculus] 145 5e-34
gi|47933428|gb|AAT39341.1| Ras-related protein RAP1 [Oikopleura ... 145 5e-34
gi|27369539|ref|NP_766001.1| RAP2C, member of RAS oncogene famil... 145 5e-34
gi|16758670|ref|NP_446273.1| v-ral simian leukemia viral oncogen... 145 5e-34
gi|11612509|ref|NP_071722.1| v-ral simian leukemia viral oncogen... 145 5e-34
gi|103721|pir||E38625 GTP-binding protein o-ral - electric ray (... 145 6e-34
gi|50745736|ref|XP_420220.1| PREDICTED: similar to Rap2c-prov pr... 145 6e-34
gi|37779076|gb|AAP20198.1| RAP2B-like protein [Pagrus major] 145 6e-34
gi|26338129|dbj|BAC32750.1| unnamed protein product [Mus musculus] 145 8e-34
gi|27693629|gb|AAH27363.2| RIKEN cDNA 2010200P20 gene [Mus muscu... 144 1e-33
gi|50286789|ref|XP_445824.1| unnamed protein product [Candida gl... 144 1e-33
gi|6677747|ref|NP_033091.1| Ras-like without CAAX 2; RAS-like pr... 144 1e-33
gi|13097300|gb|AAH03403.1| RAP2C, member of RAS oncogene family ... 144 1e-33
gi|34878614|ref|XP_214590.2| similar to GTP-binding protein ROC2... 144 1e-33
gi|41015992|dbj|BAD07406.1| Ras-related protein 3 [Entamoeba his... 144 2e-33
gi|26328909|dbj|BAC28193.1| unnamed protein product [Mus musculus] 144 2e-33
gi|1656003|gb|AAB42214.1| rin [Homo sapiens] 144 2e-33
gi|20147737|gb|AAM12636.1| Ras family small GTP binding protein ... 143 2e-33
gi|42733682|gb|AAS38626.1| hypothetical protein [Dictyostelium d... 142 4e-33
gi|31228386|ref|XP_318045.1| ENSANGP00000010698 [Anopheles gambi... 142 4e-33
gi|213478|gb|AAA49429.1| ras-1 protein 142 5e-33
gi|12751117|gb|AAK07551.1| PNAS-140 [Homo sapiens] 142 7e-33
gi|17137620|ref|NP_477402.1| CG3204-PA [Drosophila melanogaster]... 142 7e-33
gi|34932861|ref|XP_233322.2| similar to Transforming protein N-R... 140 2e-32
gi|7768785|gb|AAD56718.2| H-ras [Mus musculus] 140 2e-32
gi|405066|gb|AAA21444.1| rap homologue 1 140 3e-32
gi|33112058|gb|AAP94030.1| RasB [Aspergillus fumigatus] >gnl|BL_... 139 3e-32
gi|1771555|emb|CAA64716.1| R-ras protein [Rivulus marmoratus] 139 5e-32
gi|47221168|emb|CAG05489.1| unnamed protein product [Tetraodon n... 139 6e-32
gi|32417758|ref|XP_329357.1| hypothetical protein [Neurospora cr... 139 6e-32
gi|405072|gb|AAA21447.1| ras homologue 2 138 8e-32
gi|50552590|ref|XP_503705.1| hypothetical protein [Yarrowia lipo... 138 8e-32
gi|405070|gb|AAA21446.1| ras homologue 1 138 1e-31
gi|47219673|emb|CAG02718.1| unnamed protein product [Tetraodon n... 137 1e-31
gi|38707392|dbj|BAD04019.1| Ras protein [Schizophyllum commune] 137 1e-31
gi|47227031|emb|CAG05923.1| unnamed protein product [Tetraodon n... 137 2e-31
gi|28828051|gb|AAO50735.1| similar to Dictyostelium discoideum (... 136 3e-31
gi|50255782|gb|EAL18514.1| hypothetical protein CNBJ1560 [Crypto... 136 3e-31
gi|227605|prf||1707302A ras oncogene 136 4e-31
gi|29841014|gb|AAP06027.1| similar to NM_012219 muscle RAS oncog... 136 4e-31
gi|34534687|dbj|BAC87080.1| unnamed protein product [Homo sapiens] 135 5e-31
gi|40644070|emb|CAE18159.1| Ral protein [Echinococcus multilocul... 135 5e-31
gi|405068|gb|AAA21445.1| rap homologue 2 135 9e-31
gi|14249704|ref|NP_116307.1| RAS-like, estrogen-regulated, growt... 135 9e-31
gi|50729046|ref|XP_416404.1| PREDICTED: similar to RAS-like, est... 135 9e-31
gi|17558200|ref|NP_506707.1| vertebrate Rap GTPase homolog (rap-... 134 1e-30
gi|32526869|ref|NP_871788.1| RAS-like, estrogen-regulated, growt... 134 1e-30
gi|8133108|gb|AAF73473.1| Ras1p [Schizophyllum commune] 133 3e-30
gi|47208126|emb|CAF98162.1| unnamed protein product [Tetraodon n... 133 3e-30
gi|9972134|gb|AAG10598.1| Ras2 [Filobasidiella neoformans] 133 3e-30
gi|49256313|gb|AAH74392.1| Unknown (protein for MGC:84355) [Xeno... 133 3e-30
gi|40644072|emb|CAE18160.1| Ral protein [Echinococcus multilocul... 132 4e-30
gi|21392164|gb|AAM48436.1| RE62293p [Drosophila melanogaster] 130 2e-29
gi|7638419|gb|AAF65466.1| Ras2p [Suillus bovinus] 130 3e-29
gi|68952|pir||TVFFR3 transforming protein ras3 - fruit fly (Dros... 129 6e-29
gi|2116982|dbj|BAA20127.1| Rap 1B [Rattus norvegicus] 128 8e-29
gi|49094722|ref|XP_408822.1| hypothetical protein AN4685.2 [Aspe... 127 2e-28
gi|17538562|ref|NP_502095.1| predicted CDS, vertebrate Rap GTPas... 126 3e-28
gi|39593724|emb|CAE62016.1| Hypothetical protein CBG06025 [Caeno... 126 3e-28
gi|1617077|emb|CAA25624.1| p21 protein [Homo sapiens] 125 7e-28
gi|29841085|gb|AAP06098.1| similar to XM_003032 RAP2B, member of... 123 3e-27
gi|47226854|emb|CAG06696.1| unnamed protein product [Tetraodon n... 123 3e-27
gi|49097018|ref|XP_409969.1| hypothetical protein AN5832.2 [Aspe... 122 8e-27
gi|14388336|dbj|BAB60730.1| hypothetical protein [Macaca fascicu... 121 1e-26
gi|21703367|ref|NP_060064.2| Di-Ras2 [Homo sapiens] >gnl|BL_ORD_... 120 2e-26
gi|27683409|ref|XP_225214.1| similar to Di-Ras2 [Rattus norvegic... 120 2e-26
gi|2286103|gb|AAB64247.1| RIBA [Homo sapiens] 120 2e-26
gi|49258009|gb|AAH74244.1| Unknown (protein for MGC:83985) [Xeno... 119 6e-26
gi|50767046|ref|XP_423026.1| PREDICTED: similar to Azi2 protein ... 118 8e-26
gi|28839498|gb|AAH47690.1| MRAS protein [Homo sapiens] 116 4e-25
gi|50554407|ref|XP_504612.1| hypothetical protein [Yarrowia lipo... 116 4e-25
gi|47218272|emb|CAF96309.1| unnamed protein product [Tetraodon n... 115 5e-25
gi|46445071|gb|EAL04342.1| hypothetical protein CaO19.13415 [Can... 115 5e-25
gi|27695152|gb|AAH43818.1| Rheb-prov protein [Xenopus laevis] 115 7e-25
gi|50408325|ref|XP_456771.1| unnamed protein product [Debaryomyc... 114 1e-24
gi|41152266|ref|NP_957023.1| hypothetical protein MGC73144 [Dani... 113 3e-24
gi|38100347|gb|EAA47484.1| hypothetical protein MG02727.4 [Magna... 112 5e-24
gi|42733742|gb|AAS38677.1| similar to putative ras-related GTP-b... 112 8e-24
gi|1890279|gb|AAB50559.1| c-H-ras [Mus musculus] >gnl|BL_ORD_ID|... 111 1e-23
gi|2500062|sp|Q60529|RASH_MESAU Transforming protein p21/H-Ras-1... 111 1e-23
gi|15029734|gb|AAH11083.1| Hras1 protein [Mus musculus] 111 1e-23
gi|627254|pir||B54321 transforming protein ras-2, hepatic - rain... 111 1e-23
gi|1109580|gb|AAA83021.1| RAS gene product 111 1e-23
gi|28571523|ref|NP_730950.2| CG1081-PA [Drosophila melanogaster]... 111 1e-23
gi|31241467|ref|XP_321164.1| ENSANGP00000020811 [Anopheles gambi... 111 1e-23
gi|34933451|ref|XP_228756.2| similar to small GTPase protein E-R... 110 2e-23
gi|21553323|ref|NP_660156.1| small GTP-binding tumor suppressor ... 110 2e-23
gi|34862705|ref|XP_345791.1| similar to small GTP-binding tumor ... 110 2e-23
gi|21644583|ref|NP_660252.1| DIRAS family, GTP-binding RAS-like ... 110 2e-23
gi|280922|pir||A43808 transforming protein (ras-1) - bovine (fra... 110 3e-23
gi|2116980|dbj|BAA20126.1| Rap 1A [Rattus norvegicus] 110 3e-23
gi|2924319|emb|CAA05774.1| GTP binding protein [Trypanosoma brucei] 109 4e-23
gi|50305673|ref|XP_452797.1| unnamed protein product [Kluyveromy... 109 4e-23
gi|553635|gb|AAA36554.1| c-Ki-ras p21 protein 109 4e-23
gi|9488655|gb|AAC60676.2| N-ras [Rattus sp.] 109 5e-23
gi|553633|gb|AAA36548.1| N-ras protein 109 5e-23
gi|68928|pir||TVGPRT GTP-binding protein N-ras, short splice for... 109 5e-23
gi|553638|gb|AAA36556.1| N-ras protein (transforming allele) 109 5e-23
gi|41054159|ref|NP_956125.1| small GTP-binding tumor suppressor ... 109 5e-23
gi|30584151|gb|AAP36324.1| Homo sapiens Ras homolog enriched in ... 108 7e-23
gi|554503|gb|AAA42011.1| Ki-ras protein 108 7e-23
gi|6981476|ref|NP_037348.1| Ras homolog enriched in brain [Rattu... 108 7e-23
gi|5032041|ref|NP_005605.1| Ras homolog enriched in brain; Ras-h... 108 7e-23
gi|28626508|ref|NP_444305.2| RAS-homolog enriched in brain [Mus ... 108 7e-23
gi|47223056|emb|CAG07143.1| unnamed protein product [Tetraodon n... 108 1e-22
gi|3043765|gb|AAC13247.1| ras p21 [Canis familiaris] >gnl|BL_ORD... 107 1e-22
gi|3043763|gb|AAC13246.1| ras p21 [Canis familiaris] >gnl|BL_ORD... 107 1e-22
gi|42490908|gb|AAH66307.1| Ras homolog enriched in brain [Homo s... 107 1e-22
gi|48098905|ref|XP_392564.1| similar to CG1081-PA [Apis mellifera] 106 3e-22
gi|47229898|emb|CAG10312.1| unnamed protein product [Tetraodon n... 106 3e-22
gi|32420993|ref|XP_330940.1| hypothetical protein ( (AF342329) r... 106 3e-22
gi|10119859|dbj|BAB13483.1| Ras homolog [Mus musculus] 106 4e-22
gi|1772345|dbj|BAA11211.1| ras-related GTP-binding protein [Homo... 105 6e-22
gi|19111986|ref|NP_595194.1| putative ras-related GTP-binding pr... 104 1e-21
gi|31559801|ref|NP_853526.1| ES cell-expressed Ras; small GTPase... 104 1e-21
gi|12962251|gb|AAK10807.1| ras protein [Sclerotinia sclerotiorum... 104 2e-21
gi|24645521|ref|NP_649948.1| CG8500-PA [Drosophila melanogaster]... 103 2e-21
gi|47229573|emb|CAG06769.1| unnamed protein product [Tetraodon n... 103 3e-21
gi|6093897|sp|Q91079|RAS_LIMLI RAS-LIKE PROTEIN >gnl|BL_ORD_ID|4... 103 4e-21
gi|49074732|ref|XP_401480.1| hypothetical protein UM03865.1 [Ust... 102 5e-21
gi|23613148|ref|NP_703470.1| GTPase, putative [Plasmodium falcip... 102 6e-21
gi|3334326|sp|O14462|SEC4_CANAL Ras-related protein SEC4 >gnl|BL... 102 8e-21
gi|28522596|ref|XP_138272.2| similar to RAP2A, member of RAS onc... 101 1e-20
gi|17532559|ref|NP_494989.1| small GTP-binding tumor suppressor ... 101 1e-20
gi|23307609|gb|AAN17787.1| Ras homolog enriched in brain [Asperg... 101 1e-20
gi|31559833|ref|NP_853510.1| small GTPase protein E-Ras; v-Ha-ra... 101 1e-20
gi|31982401|ref|NP_858054.1| Ras homolog enriched in brain like ... 100 2e-20
gi|33414521|ref|NP_877977.1| Ras homolog enriched in brain-like ... 100 3e-20
gi|34935505|ref|XP_345726.1| similar to RAP2A, member of RAS onc... 100 4e-20
gi|47215264|emb|CAF96991.1| unnamed protein product [Tetraodon n... 99 5e-20
gi|213476|gb|AAA49428.1| ras p21 99 7e-20
gi|49257586|gb|AAH74172.1| Unknown (protein for MGC:81985) [Xeno... 99 7e-20
gi|23479748|gb|EAA16491.1| putative GTPase [Plasmodium yoelii yo... 99 9e-20
gi|17553566|ref|NP_499079.1| ras-related GTP-binding protein lik... 99 9e-20
gi|46126191|ref|XP_387649.1| conserved hypothetical protein [Gib... 99 9e-20
gi|38083654|ref|XP_356992.1| similar to rin [Mus musculus] 99 9e-20
gi|25294107|pir||JC7589 Sec4p homolog - yeast (Pichia pastoris) ... 98 1e-19
gi|50424201|ref|XP_460687.1| unnamed protein product [Debaryomyc... 98 1e-19
gi|1364081|pir||PC4098 Ha-ras protein - red mullet (fragment) >g... 98 2e-19
gi|213474|gb|AAA49427.1| ras-1 protein 98 2e-19
gi|21070385|gb|AAM34283.1| putative ras-related GTP binding prot... 97 2e-19
gi|41056181|ref|NP_956826.1| hypothetical protein MGC65909 [Dani... 97 2e-19
gi|16758566|ref|NP_446193.1| rap2A-like protein [Rattus norvegic... 97 3e-19
gi|213481|gb|AAA49430.1| ras-2 protein 97 3e-19
gi|47202518|emb|CAF87531.1| unnamed protein product [Tetraodon n... 97 3e-19
gi|47202387|emb|CAF87426.1| unnamed protein product [Tetraodon n... 97 3e-19
gi|50308977|ref|XP_454494.1| unnamed protein product [Kluyveromy... 97 3e-19
gi|31208125|ref|XP_313029.1| ENSANGP00000011746 [Anopheles gambi... 97 3e-19
gi|41055313|ref|NP_956689.1| hypothetical protein MGC63633 [Dani... 97 3e-19
gi|19115492|ref|NP_594580.1| ypt1-related protein 2 [Schizosacch... 97 3e-19
gi|21389385|ref|NP_653194.1| Ras homolog enriched in brain like ... 97 3e-19
gi|49130957|ref|XP_413005.1| conserved hypothetical protein [Asp... 96 6e-19
gi|21312218|ref|NP_081243.1| Ras homolog enriched in brain-like ... 96 6e-19
gi|34871425|ref|XP_341051.1| similar to paired immunoglobin-like... 96 8e-19
gi|32492050|gb|AAP85297.1| Rab1b [Babesia bovis] 96 8e-19
gi|46440039|gb|EAK99350.1| hypothetical protein CaO19.2614 [Cand... 96 8e-19
gi|31200295|ref|XP_309095.1| ENSANGP00000019585 [Anopheles gambi... 96 8e-19
gi|39590840|emb|CAE65213.1| Hypothetical protein CBG10088 [Caeno... 95 1e-18
gi|5738168|gb|AAD50281.1| putative intermediate compartment prot... 95 1e-18
gi|50732231|ref|XP_418539.1| PREDICTED: similar to RAS-homolog e... 95 1e-18
gi|32414807|ref|XP_327883.1| hypothetical protein [Neurospora cr... 95 1e-18
gi|50287271|ref|XP_446065.1| unnamed protein product [Candida gl... 95 1e-18
gi|14318517|ref|NP_116650.1| Secretory vesicle associated Rab GT... 95 1e-18
gi|12834582|dbj|BAB22967.1| unnamed protein product [Mus musculus] 95 1e-18
gi|83216|pir||S19438 hypothetical protein YCR027c - yeast (Sacch... 95 1e-18
gi|10383790|ref|NP_009956.2| rheb homologue; Rhb1p [Saccharomyce... 95 1e-18
gi|45201075|ref|NP_986645.1| AGL021Wp [Eremothecium gossypii] >g... 94 2e-18
gi|50728808|ref|XP_416293.1| PREDICTED: similar to GTP-binding p... 94 2e-18
gi|3930774|gb|AAC82784.1| N-ras [Mesocricetus auratus] 94 2e-18
gi|49079192|ref|XP_403269.1| hypothetical protein UM05654.1 [Ust... 94 2e-18
gi|12084567|pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanos... 94 2e-18
gi|20875149|ref|XP_131124.1| similar to Ras-related protein RAP-... 94 3e-18
gi|50413456|ref|XP_457265.1| unnamed protein product [Debaryomyc... 93 4e-18
gi|15077428|gb|AAK83158.1| small GTP-binding protein Ypt1p [Cand... 93 4e-18
gi|50404925|ref|YP_054017.1| GTP-binding protein RAB2 homolog [P... 93 4e-18
gi|2133238|pir||S51495 GTP-binding protein RYL1 - yeast (Yarrowi... 93 4e-18
gi|18266415|gb|AAL67567.1| small GTP binding protein rab6 [Babes... 93 4e-18
gi|49257826|gb|AAH74632.1| Unknown (protein for MGC:69558) [Xeno... 93 5e-18
gi|49257196|gb|AAH71068.1| Unknown (protein for MGC:78967) [Xeno... 93 5e-18
gi|50553762|ref|XP_504292.1| YlRYL1 [Yarrowia lipolytica] >gnl|B... 93 5e-18
gi|41148993|ref|XP_372086.1| similar to RAB1B, member RAS oncoge... 93 5e-18
gi|131787|sp|P05711|RB1A_RAT Ras-related protein Rab-1A >gnl|BL_... 93 5e-18
gi|45360529|ref|NP_988937.1| hypothetical protein MGC75978 [Xeno... 93 5e-18
gi|32418088|ref|XP_329522.1| GTP-BINDING PROTEIN YPT1 [Neurospor... 93 5e-18
gi|50730669|ref|XP_425593.1| PREDICTED: similar to rap2A-like pr... 92 6e-18
gi|39586261|emb|CAE66672.1| Hypothetical protein CBG12011 [Caeno... 92 6e-18
gi|38014530|gb|AAH60498.1| MGC68816 protein [Xenopus laevis] 92 6e-18
gi|4092830|emb|CAA18456.1| dJ569D19.1 (similar to mouse Ras, Dex... 92 6e-18
gi|11558649|emb|CAC17833.1| secretion related GTPase (SrgB) [Asp... 92 6e-18
gi|7533034|gb|AAF63333.1| YptA [Aspergillus awamori] 92 6e-18
gi|22027486|ref|NP_055125.2| RASD family, member 2; tumor endoth... 92 6e-18
gi|22651417|gb|AAL12244.1| Rab39 [Homo sapiens] 92 6e-18
gi|49093914|ref|XP_408418.1| YPT1_NEUCR GTP-binding protein ypt1... 92 6e-18
gi|10129780|emb|CAC08198.1| putative GTP-binding protein [Kluyve... 92 8e-18
gi|33859751|ref|NP_077774.1| RAB21, member RAS oncogene family [... 92 8e-18
gi|17507539|ref|NP_491233.1| RAB family member (23.6 kD) (rab-2)... 92 8e-18
gi|34864862|ref|XP_216895.2| similar to Ras-related protein Rab-... 92 8e-18
gi|15219943|ref|NP_173688.1| Ras-related protein (RAB7) / AtRab7... 92 8e-18
gi|92339|pir||S06147 GTP-binding protein rab1B - rat >gnl|BL_ORD... 92 8e-18
gi|50510367|dbj|BAD32169.1| mKIAA0118 protein [Mus musculus] 92 8e-18
gi|25188193|ref|NP_741995.1| RAB39B, member RAS oncogene family ... 92 8e-18
gi|30424726|ref|NP_780331.1| RAB39B, member RAS oncogene family ... 92 8e-18
gi|38512236|gb|AAH60898.1| Zgc:73061 protein [Danio rerio] 92 8e-18
gi|12084563|pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp >g... 92 8e-18
gi|13509187|emb|CAB92946.2| putative Rab7 GTPase [Plasmodium fal... 92 1e-17
gi|45185452|ref|NP_983169.1| ABR220Wp [Eremothecium gossypii] >g... 92 1e-17
gi|47199784|emb|CAF89306.1| unnamed protein product [Tetraodon n... 92 1e-17
gi|9988838|gb|AAG10794.1| Rab5 [Toxoplasma gondii] 92 1e-17
gi|131785|sp|P22125|RAB1_DISOM Ras-related protein ORAB-1 >gnl|B... 91 1e-17
gi|27924279|gb|AAH45014.1| Rab1-prov protein [Xenopus laevis] >g... 91 1e-17
gi|1370170|emb|CAA98162.1| RAB1E [Lotus corniculatus var. japoni... 91 1e-17
gi|27817324|emb|CAD61089.1| SI:zC101N13.3 (novel protein similar... 91 1e-17
gi|45360657|ref|NP_989002.1| hypothetical protein MGC75714 [Xeno... 91 1e-17
gi|2500076|sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT... 91 1e-17
gi|49065350|emb|CAG38493.1| RAB1B [Homo sapiens] 91 1e-17
gi|46138717|ref|XP_391049.1| YPT1_NEUCR GTP-binding protein ypt1... 91 2e-17
gi|82803|pir||S04590 GTP-binding protein ypt1 - fission yeast (... 91 2e-17
>gi|17535679|ref|NP_496623.1| R-RAS related, viral oncogene homolog,
has N myristoylation and prenylation domains (24.4 kD)
(ras-1) [Caenorhabditis elegans]
gi|1399721|gb|AAB03320.1| R-ras1 homolog
gi|1399727|gb|AAB66712.1| GTP binding protein [Caenorhabditis
elegans]
gi|14702099|gb|AAK72295.1| R-ras related protein 1, isoform a
[Caenorhabditis elegans]
Length = 212
Score = 392 bits (1008), Expect = e-108
Identities = 199/212 (93%), Positives = 199/212 (93%)
Frame = -1
Query: 639 MGGRSNSATTAAQQNAVLRIXXXXXXXXGKSALTIQFIQRYFVQDYDPTIEDSYTKQCFV 460
MGGRSNSATTAAQQNAVLRI GKSALTIQFIQRYFVQDYDPTIEDSYTKQCFV
Sbjct: 1 MGGRSNSATTAAQQNAVLRIVVVGGGGVGKSALTIQFIQRYFVQDYDPTIEDSYTKQCFV 60
Query: 459 DEDLCKLEILDTAGQEEFSTMREQYLRTGSGFLIVFAVTDRNSFEEVKKLHELICRIKDR 280
DEDLCKLEILDTAGQEEFSTMREQYLRTGSGFLIVFAVTDRNSFEEVKKLHELICRIKDR
Sbjct: 61 DEDLCKLEILDTAGQEEFSTMREQYLRTGSGFLIVFAVTDRNSFEEVKKLHELICRIKDR 120
Query: 279 DDFPIILVGNKADLENERHVARHEAEELAHRLSIPYLECSAKIRKNVDEAFFDIVRLVRK 100
DDFPIILVGNKADLENERHVARHEAEELAHRLSIPYLECSAKIRKNVDEAFFDIVRLVRK
Sbjct: 121 DDFPIILVGNKADLENERHVARHEAEELAHRLSIPYLECSAKIRKNVDEAFFDIVRLVRK 180
Query: 99 YQHDERMPIHPHDDRKLESPIXXXXXKNCRIQ 4
YQHDERMPIHPHDDRKLESPI KNCRIQ
Sbjct: 181 YQHDERMPIHPHDDRKLESPIKLKKKKNCRIQ 212