Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C44C1_5
(399 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25147985|ref|NP_741715.1| vacuolar protein sorting 45A (15.4 ... 261 3e-69
gi|25147980|ref|NP_741714.1| vacuolar protein sorting 45A (62.1 ... 238 2e-62
gi|39592513|emb|CAE63590.1| Hypothetical protein CBG08081 [Caeno... 221 3e-57
gi|24645413|ref|NP_649909.1| CG8228-PA [Drosophila melanogaster]... 125 1e-28
gi|47209480|emb|CAF89969.1| unnamed protein product [Tetraodon n... 123 9e-28
gi|7305631|ref|NP_038869.1| vacuolar protein sorting 45; vacuola... 122 2e-27
gi|25742604|ref|NP_742069.1| vesicular transport protein rvps45 ... 121 3e-27
gi|7447775|pir||JC5722 vacuolar protein sorting protein 45 - hum... 121 3e-27
gi|15215175|gb|AAH12691.1| Vacuolar protein sorting 45 [Mus musc... 121 4e-27
gi|18105063|ref|NP_009190.2| vacuolar protein sorting 45A; leuco... 119 1e-26
gi|4583679|emb|CAB40417.1| vacuolar protein sorting [Homo sapiens] 119 1e-26
gi|31230805|ref|XP_318430.1| ENSANGP00000014333 [Anopheles gambi... 110 8e-24
gi|50554277|ref|XP_504547.1| hypothetical protein [Yarrowia lipo... 108 2e-23
gi|38099125|gb|EAA46509.1| hypothetical protein MG08852.4 [Magna... 107 5e-23
gi|46111427|ref|XP_382771.1| hypothetical protein FG02595.1 [Gib... 106 1e-22
gi|49071150|ref|XP_399864.1| hypothetical protein UM02249.1 [Ust... 106 1e-22
gi|49098470|ref|XP_410668.1| hypothetical protein AN6531.2 [Aspe... 101 3e-21
gi|45198466|ref|NP_985495.1| AFL053Wp [Eremothecium gossypii] >g... 99 2e-20
gi|32411133|ref|XP_326047.1| hypothetical protein [Neurospora cr... 98 3e-20
gi|6321343|ref|NP_011420.1| Protein of the Sec1p family essentia... 98 4e-20
gi|468233|gb|AAA79230.1| VPS45 98 4e-20
gi|50405811|ref|XP_456546.1| unnamed protein product [Debaryomyc... 97 9e-20
gi|19113995|ref|NP_593083.1| vacuolar protein sorting homolog; S... 96 1e-19
gi|18411376|ref|NP_565150.1| vacuolar protein sorting protein 45... 96 2e-19
gi|25315466|pir||T52056 vacuolar protein sorting protein [import... 96 2e-19
gi|50288987|ref|XP_446923.1| unnamed protein product [Candida gl... 91 4e-18
gi|50259897|gb|EAL22565.1| hypothetical protein CNBB4420 [Crypto... 91 5e-18
gi|46805492|dbj|BAD16957.1| putative vacuolar protein sorting ho... 86 2e-16
gi|46805491|dbj|BAD16956.1| putative vacuolar protein sorting ho... 86 2e-16
gi|50309581|ref|XP_454802.1| unnamed protein product [Kluyveromy... 85 4e-16
gi|16805049|ref|NP_473078.1| vacuolar protein-sorting protein VP... 81 4e-15
gi|23485721|gb|EAA20542.1| VPS45-like protein [Plasmodium yoelii... 78 3e-14
gi|46440984|gb|EAL00285.1| hypothetical protein CaO19.5618 [Cand... 77 8e-14
gi|50307771|ref|XP_453879.1| unnamed protein product [Kluyveromy... 51 5e-06
gi|46437059|gb|EAK96412.1| hypothetical protein CaO19.3128 [Cand... 50 1e-05
gi|27065713|pdb|1MQS|A Chain A, Crystal Structure Of Sly1p In Co... 50 1e-05
gi|6320395|ref|NP_010475.1| Hydrophilic suppressor of YPT1 mutan... 50 1e-05
gi|101625|pir||A39610 SLY1 protein - yeast (Saccharomyces cerevi... 50 1e-05
gi|1289305|emb|CAA86695.1| Sly1p [Saccharomyces cerevisiae] 50 1e-05
gi|50287575|ref|XP_446217.1| unnamed protein product [Candida gl... 49 2e-05
gi|19075874|ref|NP_588374.1| stxbp-unc-18-sec1 family protien tr... 45 4e-04
gi|50427011|ref|XP_462110.1| unnamed protein product [Debaryomyc... 44 6e-04
gi|50257392|gb|EAL20101.1| hypothetical protein CNBF4270 [Crypto... 42 0.004
gi|2143972|pir||JC4674 Sly1 protein - rat >gnl|BL_ORD_ID|846801 ... 41 0.005
gi|9507019|ref|NP_062237.1| vesicle transport-related [Rattus no... 41 0.005
gi|45200977|ref|NP_986547.1| AGL120Wp [Eremothecium gossypii] >g... 41 0.006
gi|12851714|dbj|BAB29141.1| unnamed protein product [Mus musculus] 40 0.011
gi|26336937|dbj|BAC32152.1| unnamed protein product [Mus musculus] 40 0.011
gi|20379941|gb|AAH27793.1| Scfd1 protein [Mus musculus] 40 0.011
gi|26334141|dbj|BAC30788.1| unnamed protein product [Mus musculus] 40 0.011
gi|37360140|dbj|BAC98048.1| mKIAA0917 protein [Mus musculus] 40 0.011
gi|38050386|ref|XP_126906.2| RIKEN cDNA 3110021P21 [Mus musculus] 40 0.011
gi|33150536|gb|AAP97146.1| sly1p [Homo sapiens] 39 0.018
gi|33469978|ref|NP_878255.1| vesicle transport-related protein i... 39 0.018
gi|34327968|dbj|BAA74940.2| KIAA0917 protein [Homo sapiens] 39 0.018
gi|50748392|ref|XP_421224.1| PREDICTED: similar to vesicle trans... 39 0.018
gi|5730482|gb|AAD48586.1| vesicle transport-related protein [Hom... 39 0.018
gi|5138928|gb|AAD40381.1| vesicle transport-related protein [Hom... 39 0.018
gi|17389391|gb|AAH17734.1| Vesicle transport-related protein, is... 39 0.018
gi|12276129|gb|AAG50273.1| vesicle transport-related protein [Ho... 39 0.018
gi|33469966|ref|NP_057190.2| vesicle transport-related protein i... 39 0.018
gi|29378335|gb|AAO83849.1| neural-specific syntaxin-binding prot... 39 0.024
gi|33504505|ref|NP_878281.1| suppressor of ypt1; SI:dZ234G15.2; ... 39 0.031
gi|7485573|pir||T06619 hypothetical protein F16J13.190 - Arabido... 36 0.15
gi|18413751|ref|NP_567388.1| cytokinesis-related Sec1 protein, p... 35 0.26
gi|23491304|gb|EAA22874.1| Saccharomyces cerevisiae ORF YOR281c,... 35 0.44
gi|28201893|sp|Q9SZ77|SC1B_ARATH Protein transport Sec1b (AtSec1... 34 0.58
gi|28201563|gb|AAO34501.1| putative vesicle transport-related pr... 34 0.76
gi|50797588|ref|XP_428292.1| PREDICTED: similar to vacuolar prot... 34 0.76
gi|47226042|emb|CAG04416.1| unnamed protein product [Tetraodon n... 33 0.99
gi|37526781|ref|NP_930125.1| hypothetical protein [Photorhabdus ... 33 0.99
gi|47604958|ref|NP_990566.1| CD8 alpha chain [Gallus gallus] >gn... 33 1.3
gi|42601779|gb|AAS21628.1| CD8 alpha chain precursor [Gallus gal... 33 1.3
gi|41323180|gb|AAR99815.1| CD8 alpha chain [Gallus gallus] 33 1.3
gi|1869742|emb|CAA72259.1| CD8 alpha chain [Gallus gallus] 33 1.3
gi|49095520|ref|XP_409221.1| hypothetical protein AN5084.2 [Aspe... 33 1.7
gi|7515565|pir||C72765 hypothetical protein APE0111 - Aeropyrum ... 32 2.2
gi|50747398|ref|XP_420861.1| PREDICTED: similar to CD8 alpha cha... 32 3.8
gi|42601773|gb|AAS21625.1| CD8 alpha chain precursor [Gallus gal... 32 3.8
gi|42601781|gb|AAS21629.1| CD8 alpha chain precursor [Gallus gal... 32 3.8
gi|42601775|gb|AAS21626.1| CD8 alpha chain precursor [Gallus gal... 32 3.8
gi|50774119|ref|XP_423212.1| PREDICTED: similar to adenylate cyc... 32 3.8
gi|1869740|emb|CAA72260.1| CD8 alpha chain [Gallus gallus] 32 3.8
gi|50753707|ref|XP_414097.1| PREDICTED: similar to Adenylate cyc... 32 3.8
gi|48099219|ref|XP_392579.1| similar to casein kinase 2 beta sub... 32 3.8
gi|34328397|ref|NP_766580.2| putative homeodomain transcription ... 31 4.9
gi|730870|sp|P41252|SYI_HUMAN Isoleucyl-tRNA synthetase, cytopla... 31 4.9
gi|12314134|emb|CAC12710.1| bA62C3.2 (isoleucine-tRNA synthetase... 31 4.9
gi|31873336|emb|CAD97659.1| hypothetical protein [Homo sapiens] 31 4.9
gi|10957070|ref|NP_046426.1| putative protein [Aquifex aeolicus ... 31 4.9
gi|23508914|ref|NP_701582.1| hypothetical protein [Plasmodium fa... 31 4.9
gi|4504555|ref|NP_002152.1| isoleucine-tRNA synthetase [Homo sap... 31 4.9
gi|41351160|gb|AAH65552.1| IARS protein [Homo sapiens] 31 4.9
gi|31873360|emb|CAD97671.1| hypothetical protein [Homo sapiens] 31 4.9
gi|32425491|gb|AAH08318.2| IARS protein [Homo sapiens] 31 4.9
gi|23485883|gb|EAA20620.1| hypothetical protein [Plasmodium yoel... 31 4.9
gi|31874258|emb|CAD98022.1| hypothetical protein [Homo sapiens] 31 4.9
gi|29346908|ref|NP_810411.1| A/G-specific adenine glycosylase [B... 31 4.9
gi|6855606|gb|AAF29582.1| PRO0785 [Homo sapiens] 31 4.9
gi|13812036|ref|NP_113167.1| transcription initiation factor IIB... 31 4.9
gi|24646440|ref|NP_731761.1| CG7518-PA [Drosophila melanogaster]... 31 6.4
gi|48891286|ref|ZP_00324826.1| COG0419: ATPase involved in DNA r... 31 6.4
gi|24646442|ref|NP_650250.2| CG7518-PB [Drosophila melanogaster]... 31 6.4
gi|23483606|gb|EAA19222.1| hypothetical protein [Plasmodium yoel... 31 6.4
gi|47894391|ref|NP_001001488.1| ATPase, class I, type 8B, member... 31 6.4
gi|39584603|emb|CAE72356.1| Hypothetical protein CBG19506 [Caeno... 31 6.4
gi|15668179|ref|NP_246970.1| 2-hydroxyglutaryl-CoA dehydratase, ... 30 8.4
gi|29789383|ref|NP_742012.1| isoleucine-tRNA synthetase [Mus mus... 30 8.4
gi|44890803|gb|AAH67029.1| Isoleucine-tRNA synthetase [Mus muscu... 30 8.4
gi|12805525|gb|AAH02239.1| Iars protein [Mus musculus] 30 8.4
gi|15925182|ref|NP_372716.1| tagatose 1,6-diphosphate aldolase [... 30 8.4
gi|49484412|ref|YP_041636.1| tagatose 1,6-diphosphate aldolase [... 30 8.4
gi|49486981|ref|YP_044202.1| tagatose 1,6-diphosphate aldolase [... 30 8.4
gi|21283847|ref|NP_646935.1| tagatose 1,6-diphosphate aldolase [... 30 8.4
gi|20806651|ref|NP_621822.1| ATP-dependent Zn proteases [Thermoa... 30 8.4
gi|50749741|ref|XP_421735.1| PREDICTED: similar to methyltransfe... 30 8.4
>gi|25147985|ref|NP_741715.1| vacuolar protein sorting 45A (15.4 kD)
(XB590) [Caenorhabditis elegans]
gi|21392665|gb|AAM51527.1| Hypothetical protein C44C1.4b
[Caenorhabditis elegans]
Length = 132
Score = 261 bits (666), Expect = 3e-69
Identities = 132/132 (100%), Positives = 132/132 (100%)
Frame = -1
Query: 399 MDLVQSSRKLIQDMIQLAGSQMKLLLMDGETTPTVSCAFAQSEVMQKEVYIFDRIENKTS 220
MDLVQSSRKLIQDMIQLAGSQMKLLLMDGETTPTVSCAFAQSEVMQKEVYIFDRIENKTS
Sbjct: 1 MDLVQSSRKLIQDMIQLAGSQMKLLLMDGETTPTVSCAFAQSEVMQKEVYIFDRIENKTS 60
Query: 219 SENIKNLKCVVFVRPTPKNIERLVKELQEPRFSQYYLYFTNTINKYDVKRLAEADKNETI 40
SENIKNLKCVVFVRPTPKNIERLVKELQEPRFSQYYLYFTNTINKYDVKRLAEADKNETI
Sbjct: 61 SENIKNLKCVVFVRPTPKNIERLVKELQEPRFSQYYLYFTNTINKYDVKRLAEADKNETI 120
Query: 39 PKVFTELQKSGR 4
PKVFTELQKSGR
Sbjct: 121 PKVFTELQKSGR 132