Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C46E1_3
(893 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|7497497|pir||T19968 hypothetical protein C46E1.2 - Caenorhabd... 609 e-173
gi|50301003|gb|AAT73712.1| guanylate cyclase-like protein [Caeno... 584 e-166
gi|39596700|emb|CAE63319.1| Hypothetical protein CBG07710 [Caeno... 569 e-161
gi|32566352|ref|NP_510557.2| guanylyl cyclase (gcy-36) [Caenorha... 562 e-159
gi|39592994|emb|CAE62608.1| Hypothetical protein CBG06726 [Caeno... 416 e-115
gi|17561810|ref|NP_506319.1| predicted CDS, guanylyl cyclase (gc... 414 e-114
gi|13539160|emb|CAC35530.1| soluble guanylate cyclase [Caenorhab... 413 e-114
gi|50300997|gb|AAT73709.1| guanylate cyclase-like protein [Caeno... 413 e-114
gi|7495506|pir||T18984 hypothetical protein C06B3.8 - Caenorhabd... 402 e-111
gi|39590171|emb|CAE61169.1| Hypothetical protein CBG04937 [Caeno... 356 3e-97
gi|32566105|ref|NP_506452.3| guanylyl cyclase (gcy-32) [Caenorha... 353 4e-96
gi|20803722|emb|CAB01118.2| Hypothetical protein C06B3.8 [Caenor... 353 4e-96
gi|17507861|ref|NP_493344.1| guanylyl cyclase (85.3 kD) (gcy-35)... 248 1e-64
gi|32697993|emb|CAB03288.2| C. elegans GCY-35 protein (correspon... 248 1e-64
gi|39582958|emb|CAE73023.1| Hypothetical protein CBG20390 [Caeno... 246 4e-64
gi|50301005|gb|AAT73713.1| guanylate cyclase-like protein [Caeno... 164 2e-39
gi|39585919|emb|CAE68208.1| Hypothetical protein CBG13876 [Caeno... 155 1e-36
gi|37360975|dbj|BAC98396.1| soluble guanylyl cyclase beta1 subun... 149 6e-35
gi|1838918|dbj|BAA19199.1| soluble guanylyl cyclase beta subunit... 149 6e-35
gi|17540904|ref|NP_500171.1| predicted CDS, guanylyl cyclase (gc... 149 6e-35
gi|14495182|dbj|BAB60906.1| soluble guanylyl cyclase beta1 subun... 145 2e-33
gi|27807163|ref|NP_777066.1| guanylate cyclase 1, soluble, beta ... 144 3e-33
gi|4504215|ref|NP_000848.1| guanylate cyclase 1, soluble, beta 3... 144 3e-33
gi|2746083|gb|AAB94877.1| soluble guanylate cyclase beta-1 subun... 144 3e-33
gi|27127318|dbj|BAC44989.1| soluble guanylyl cyclase beta 1 subu... 143 4e-33
gi|27374983|dbj|BAC53773.1| soluble guanylyl cyclase beta 1 subu... 143 6e-33
gi|27552477|dbj|BAC55086.1| soluble guanylyl cyclase beta 1 subu... 142 1e-32
gi|8567358|ref|NP_059497.1| guanylate cyclase 1, soluble, beta 3... 142 1e-32
gi|29748024|gb|AAH50945.1| Gucy1b3 protein [Mus musculus] >gnl|B... 142 1e-32
gi|6980996|ref|NP_036901.1| guanylate cyclase 1, soluble, beta 3... 140 3e-32
gi|28564567|dbj|BAC55087.2| soluble guanylyl cyclase beta 1 subu... 140 3e-32
gi|47937696|gb|AAH72271.1| MGC82401 protein [Xenopus laevis] 140 3e-32
gi|31203941|ref|XP_310919.1| ENSANGP00000023905 [Anopheles gambi... 137 3e-31
gi|3372756|gb|AAC61264.1| soluble guanylyl cyclase beta-1 subuni... 133 6e-30
gi|48596915|dbj|BAD22772.1| soluble guanylyl cyclase beta 1 subu... 133 6e-30
gi|48096194|ref|XP_392410.1| similar to soluble guanylyl cyclase... 133 6e-30
gi|21956635|gb|AAF86581.2| soluble guanylyl cyclase beta 2 subun... 128 1e-28
gi|37930245|gb|AAO65585.1| nitric oxide sensitive guanylyl cycla... 126 7e-28
gi|27370208|ref|NP_766398.1| guanylate cyclase 1, soluble, beta ... 126 7e-28
gi|50752196|ref|XP_426684.1| PREDICTED: similar to guanylate cyc... 124 2e-27
gi|14245738|dbj|BAB56135.1| soluble guanylyl cyclase beta1 [Hemi... 118 2e-25
gi|24651577|ref|NP_524603.2| CG1470-PA [Drosophila melanogaster]... 109 7e-23
gi|861203|gb|AAA87941.1| soluble guanylyl cyclase beta subunit 109 7e-23
gi|50746148|ref|XP_420376.1| PREDICTED: similar to Guanylate cyc... 107 5e-22
gi|30424466|dbj|BAC76406.1| soluble guanylyl cyclase beta 2 subu... 105 1e-21
gi|6980998|ref|NP_036902.1| guanylate cyclase, soluble, beta 2; ... 105 1e-21
gi|30424470|dbj|BAC76408.1| soluble guanylyl cyclase beta 2 subu... 105 1e-21
gi|30424472|dbj|BAC76409.1| soluble guanylyl cyclase beta 2 subu... 105 1e-21
gi|15823742|dbj|BAB68564.1| soluble guanylate cyclase beta 2b [R... 105 1e-21
gi|30424468|dbj|BAC76407.1| soluble guanylyl cyclase beta 2 subu... 105 2e-21
gi|31203943|ref|XP_310920.1| ENSANGP00000012727 [Anopheles gambi... 101 3e-20
gi|4545073|gb|AAC47144.2| soluble guanylyl cyclase beta subunit ... 101 3e-20
gi|17229770|ref|NP_486318.1| similar to soluble guanylyl cyclase... 95 2e-18
gi|47218455|emb|CAG03727.1| unnamed protein product [Tetraodon n... 95 2e-18
gi|8393507|ref|NP_004120.1| guanylate cyclase 1, soluble, beta 2... 92 1e-17
gi|23129606|ref|ZP_00111432.1| hypothetical protein [Nostoc punc... 92 2e-17
gi|3511175|gb|AAD09836.1| soluble guanylyl cyclase beta-3 [Mandu... 87 7e-16
gi|48101339|ref|XP_395104.1| similar to soluble guanylyl cyclase... 83 7e-15
gi|45550752|ref|NP_650424.2| CG4154-PC [Drosophila melanogaster]... 82 1e-14
gi|34980250|gb|AAQ84038.1| guanylyl cyclase short variant [Droso... 82 1e-14
gi|34980252|gb|AAQ84039.1| guanylyl cyclase long variant [Drosop... 82 1e-14
gi|45551894|ref|NP_731974.2| CG4154-PA [Drosophila melanogaster]... 82 1e-14
gi|30526293|gb|AAP32289.1| soluble guanylyl cyclase GCY-33 [Caen... 81 3e-14
gi|17561808|ref|NP_506010.1| guanylyl cyclase (gcy-33) [Caenorha... 81 3e-14
gi|31241287|ref|XP_321074.1| ENSANGP00000018455 [Anopheles gambi... 81 4e-14
gi|39592146|emb|CAE75366.1| Hypothetical protein CBG23350 [Caeno... 80 5e-14
gi|33413439|gb|AAK97794.1| soluble guanylate cyclase subunit [Ap... 77 5e-13
gi|24647455|ref|NP_650550.1| CG14885-PA [Drosophila melanogaster... 73 1e-11
gi|21355729|ref|NP_650551.1| CG14886-PA [Drosophila melanogaster... 71 3e-11
gi|31209799|ref|XP_313866.1| ENSANGP00000003998 [Anopheles gambi... 71 3e-11
gi|47213713|emb|CAF95144.1| unnamed protein product [Tetraodon n... 69 1e-10
gi|899477|emb|CAA90393.1| alpha2i-subunit of soluble guanylyl cy... 69 1e-10
gi|4504211|ref|NP_000846.1| guanylate cyclase 1, soluble, alpha ... 69 1e-10
gi|13027400|ref|NP_076446.1| soluble guanylyl cyclase alpha2 sub... 68 2e-10
gi|26665417|dbj|BAC44887.1| soluble guanylyl cyclase alpha 2 sub... 67 4e-10
gi|30526295|gb|AAP32290.1| soluble guanylyl cyclase GCY-31a [Cae... 67 5e-10
gi|38089705|ref|XP_150145.3| similar to soluble guanylyl cyclase... 65 3e-09
gi|39591097|emb|CAE58877.1| Hypothetical protein CBG02110 [Caeno... 64 5e-09
gi|30526301|gb|AAP32292.1| soluble guanylyl cyclase GCY-31c [Cae... 63 8e-09
gi|17568389|ref|NP_508443.1| predicted CDS, guanylyl cyclase (gc... 60 5e-08
gi|3372753|gb|AAC61263.1| soluble guanylyl cyclase alpha-1 subun... 59 1e-07
gi|7507367|pir||T16822 hypothetical protein T07D1.1 - Caenorhabd... 59 2e-07
gi|38093401|ref|XP_358023.1| similar to Guanylate cyclase solubl... 53 1e-05
gi|4587267|dbj|BAA76690.1| soluble guanylyl cyclase alpha subuni... 52 1e-05
gi|1838916|dbj|BAA19198.1| soluble guanylyl cyclase alpha subuni... 52 1e-05
gi|33299967|dbj|BAC80220.1| soluble guanylyl cyclase alpha1 subu... 49 1e-04
gi|38093399|ref|XP_358022.1| similar to Guanylate cyclase solubl... 49 2e-04
gi|14495180|dbj|BAB60905.1| soluble guanylyl cyclase alpha1 subu... 48 3e-04
gi|48096192|ref|XP_392409.1| similar to soluble guanylyl cyclase... 48 3e-04
gi|17229771|ref|NP_486319.1| two-component hybrid sensor and reg... 47 6e-04
gi|3282684|gb|AAC25031.1| soluble guanylyl cyclase beta2 subunit... 46 0.001
gi|8393504|ref|NP_058786.1| guanylate cyclase 1, soluble, alpha ... 45 0.003
gi|34857867|ref|XP_346629.1| hypothetical protein XP_346628 [Rat... 45 0.003
gi|25006379|dbj|BAC24016.1| guanylyl cyclase alpha 1 subunit [Ra... 45 0.003
gi|27805457|sp|Q9ERL9|CYG3_MOUSE Guanylate cyclase soluble, alph... 44 0.004
gi|31981219|ref|NP_068696.2| guanylate cyclase 1, soluble, alpha... 44 0.004
gi|4504213|ref|NP_000847.1| guanylate cyclase 1, soluble, alpha ... 42 0.014
gi|28461183|ref|NP_786972.1| guanylate cyclase 1, soluble, alpha... 42 0.014
gi|16767968|gb|AAL28202.1| GH08311p [Drosophila melanogaster] 41 0.031
gi|24651096|ref|NP_477088.2| CG1912-PA [Drosophila melanogaster]... 41 0.031
gi|7404351|sp|Q02108|CYG3_HUMAN Guanylate cyclase soluble, alpha... 41 0.041
gi|20306359|gb|AAH28384.1| GUCY1A3 protein [Homo sapiens] 41 0.041
gi|7576903|gb|AAF64043.1| soluble guanylate cyclase large subuni... 40 0.070
gi|50746146|ref|XP_420375.1| PREDICTED: similar to Guanylate cyc... 40 0.091
gi|48862576|ref|ZP_00316472.1| hypothetical protein Mdeg02002273... 39 0.12
gi|38093405|ref|XP_358025.1| similar to Guanylate cyclase solubl... 39 0.12
gi|23129607|ref|ZP_00111433.1| COG0642: Signal transduction hist... 39 0.16
gi|729270|sp|Q07093|CYGH_DROME Head-specific guanylate cyclase >... 38 0.27
gi|33235559|dbj|BAC80151.1| soluble guanylyl cyclase alpha [Lima... 38 0.35
gi|15895055|ref|NP_348404.1| Hypothetical protein CAC1779 [Clost... 37 0.59
gi|29826842|ref|NP_821476.1| hypothetical protein SAV302 [Strept... 37 0.77
gi|50311213|ref|XP_455630.1| unnamed protein product [Kluyveromy... 35 1.7
gi|47215558|emb|CAG06288.1| unnamed protein product [Tetraodon n... 35 1.7
gi|7658249|gb|AAF66107.1| soluble guanylyl cyclase subunit beta ... 35 2.3
gi|21392032|gb|AAM48370.1| LD44641p [Drosophila melanogaster] 35 2.9
gi|32492898|gb|AAP85539.1| soluble guanylyl cyclase 1 [Bactrocer... 35 2.9
gi|7658247|gb|AAF66106.1| soluble guanylyl cyclase subunit beta ... 35 2.9
gi|31203783|ref|XP_310840.1| ENSANGP00000012438 [Anopheles gambi... 35 2.9
gi|24649543|ref|NP_651214.1| CG13605-PA [Drosophila melanogaster... 35 2.9
gi|48117283|ref|XP_393195.1| similar to CG3937-PD [Apis mellifera] 33 6.5
gi|38050443|ref|XP_357116.1| similar to hypothetical protein C23... 33 6.5
gi|23612813|ref|NP_704352.1| hypothetical protein [Plasmodium fa... 33 8.6
gi|39582353|emb|CAE67602.1| Hypothetical protein CBG13147 [Caeno... 27 9.3
>gi|7497497|pir||T19968 hypothetical protein C46E1.2 -
Caenorhabditis elegans
Length = 685
Score = 609 bits (1570), Expect = e-173
Identities = 297/297 (100%), Positives = 297/297 (100%)
Frame = +1
Query: 1 MVKYATFCRNHFGFIHESIRQLMIRTYGEAFWSKVLERAGFEAGKENIINHYYSDADTFS 180
MVKYATFCRNHFGFIHESIRQLMIRTYGEAFWSKVLERAGFEAGKENIINHYYSDADTFS
Sbjct: 1 MVKYATFCRNHFGFIHESIRQLMIRTYGEAFWSKVLERAGFEAGKENIINHYYSDADTFS 60
Query: 181 LVDAVSVILKVTREQVWEMYGCFLIQYTMETGWDDLIRSMSPNLKGFLDNLDSLHYFIDH 360
LVDAVSVILKVTREQVWEMYGCFLIQYTMETGWDDLIRSMSPNLKGFLDNLDSLHYFIDH
Sbjct: 61 LVDAVSVILKVTREQVWEMYGCFLIQYTMETGWDDLIRSMSPNLKGFLDNLDSLHYFIDH 120
Query: 361 VVYKANLRGPSFRCEDNPDGTITLHYYTGRPGLYPIVKGVLREAAKRVFKLDVSMTITGR 540
VVYKANLRGPSFRCEDNPDGTITLHYYTGRPGLYPIVKGVLREAAKRVFKLDVSMTITGR
Sbjct: 121 VVYKANLRGPSFRCEDNPDGTITLHYYTGRPGLYPIVKGVLREAAKRVFKLDVSMTITGR 180
Query: 541 TQRSVQMATGERIEEHVIFLVKTLNTDQSNEEALGTAVVQHSNNYKIRLTHMDFISTFPY 720
TQRSVQMATGERIEEHVIFLVKTLNTDQSNEEALGTAVVQHSNNYKIRLTHMDFISTFPY
Sbjct: 181 TQRSVQMATGERIEEHVIFLVKTLNTDQSNEEALGTAVVQHSNNYKIRLTHMDFISTFPY 240
Query: 721 HMVVDQDCKIVQVGRELYNHIPKDLLSVGTPLMRIFEVTRPQIPLDFDSICNFINAV 891
HMVVDQDCKIVQVGRELYNHIPKDLLSVGTPLMRIFEVTRPQIPLDFDSICNFINAV
Sbjct: 241 HMVVDQDCKIVQVGRELYNHIPKDLLSVGTPLMRIFEVTRPQIPLDFDSICNFINAV 297