Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C49C3_14
         (1215 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17539324|ref|NP_503089.1| putative protein family member, wit...   713   0.0
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno...   342   8e-93
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno...   114   5e-24
gi|17539326|ref|NP_503090.1| versican family member, possibly N-...   101   4e-20
gi|39591912|emb|CAE75132.1| Hypothetical protein CBG23060 [Caeno...    91   5e-17
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb...    88   4e-16
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb...    86   2e-15
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno...    74   9e-12
gi|17559816|ref|NP_505795.1| c-type lectin precursor family memb...    71   6e-11
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur...    71   6e-11
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae...    70   8e-11
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family...    70   1e-10
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno...    70   1e-10
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur...    70   1e-10
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno...    67   6e-10
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb...    67   8e-10
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ...    67   1e-09
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno...    66   1e-09
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur...    66   2e-09
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb...    65   3e-09
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)...    65   3e-09
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb...    64   7e-09
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno...    64   9e-09
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k...    63   1e-08
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb...    62   2e-08
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno...    62   2e-08
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)...    62   3e-08
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb...    61   5e-08
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb...    61   6e-08
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno...    60   8e-08
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)...    60   8e-08
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno...    59   2e-07
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)...    59   2e-07
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family...    59   3e-07
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k...    58   4e-07
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam...    58   5e-07
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family...    57   7e-07
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)...    57   7e-07
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno...    56   1e-06
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family...    56   2e-06
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno...    56   2e-06
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor...    55   3e-06
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ...    55   3e-06
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab...    55   3e-06
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or...    55   4e-06
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd...    55   4e-06
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno...    54   7e-06
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi...    53   2e-05
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb...    53   2e-05
gi|17506689|ref|NP_493310.1| putative protein family member (1N7...    53   2e-05
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno...    52   2e-05
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family...    52   4e-05
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno...    51   5e-05
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6...    51   5e-05
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno...    51   6e-05
gi|17554624|ref|NP_498491.1| putative secreted or extracellular ...    51   6e-05
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)...    51   6e-05
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno...    51   6e-05
gi|39583020|emb|CAE71799.1| Hypothetical protein CBG18810 [Caeno...    50   8e-05
gi|39587765|emb|CAE67783.1| Hypothetical protein CBG13359 [Caeno...    50   1e-04
gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)...    49   2e-04
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno...    49   2e-04
gi|39587766|emb|CAE67784.1| Hypothetical protein CBG13360 [Caeno...    49   2e-04
gi|7506707|pir||T16749 hypothetical protein R13F6.2 - Caenorhabd...    49   3e-04
gi|17554616|ref|NP_498492.1| predicted CDS, putative secreted or...    49   3e-04
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno...    48   5e-04
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno...    48   5e-04
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno...    48   5e-04
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)...    47   7e-04
gi|39582793|emb|CAE74256.1| Hypothetical protein CBG21945 [Caeno...    46   0.002
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb...    46   0.002
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno...    46   0.002
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur...    45   0.003
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno...    45   0.003
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno...    44   0.006
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb...    44   0.006
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno...    44   0.008
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam...    44   0.010
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno...    43   0.013
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno...    43   0.013
gi|17566100|ref|NP_507868.1| c-type lectin family member (5U452)...    43   0.013
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family...    43   0.017
gi|17562684|ref|NP_507837.1| putative protein family member (5U2...    43   0.017
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa...    43   0.017
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb...    42   0.022
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family...    42   0.022
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno...    42   0.029
gi|17557544|ref|NP_505863.1| putative protein family member (5L7...    41   0.050
gi|17553034|ref|NP_497946.1| c-type lectin precursor family memb...    41   0.050
gi|17531799|ref|NP_494750.1| putative protein family member (2E5...    41   0.050
gi|34922645|sp|Q9PSN0|LECG_BITAR Galactose-specific lectin (PAL)...    41   0.050
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno...    41   0.065
gi|47228322|emb|CAG07717.1| unnamed protein product [Tetraodon n...    41   0.065
gi|33332307|gb|AAQ11365.1| crotocetin [Crotalus durissus terrifi...    41   0.065
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h...    40   0.085
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb...    40   0.085
gi|39598089|emb|CAE68781.1| Hypothetical protein CBG14725 [Caeno...    40   0.085
gi|39583006|emb|CAE71785.1| Hypothetical protein CBG18789 [Caeno...    40   0.085
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb...    40   0.11
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f...    40   0.14
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno...    39   0.19
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno...    39   0.25
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE...    39   0.25
gi|39582517|emb|CAE65604.1| Hypothetical protein CBG10625 [Caeno...    39   0.25
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica]        39   0.25
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica]        39   0.25
gi|34922643|sp|Q9PSM4|LECG_LACST Galactose-specific lectin (Muti...    39   0.25
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B...    39   0.32
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus]                 39   0.32
gi|47227138|emb|CAG00500.1| unnamed protein product [Tetraodon n...    39   0.32
gi|17532827|ref|NP_495020.1| putative protein family member (2F6...    39   0.32
gi|7674107|sp|Q9YGP1|LECG_TRIST Galactose-binding lectin precurs...    39   0.32
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens]        38   0.42
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ...    38   0.42
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi...    38   0.42
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote...    38   0.42
gi|833853|gb|AAA67565.1| versican V2 core protein precursor            38   0.42
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [...    38   0.42
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus]                     38   0.42
gi|1143285|gb|AAA87847.1| brevican core protein                        38   0.42
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_...    38   0.42
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr...    38   0.42
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [...    38   0.42
gi|7512195|pir||PC7027 aggretin alpha chain - Malayan pit viper ...    38   0.42
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ...    38   0.42
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus]        38   0.42
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p...    38   0.42
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens]        38   0.42
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ...    38   0.42
gi|8809812|gb|AAF79952.1| aggretin alpha chain [Calloselasma rho...    38   0.42
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ...    38   0.42
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|...    38   0.42
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID...    38   0.42
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma...    38   0.55
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_...    38   0.55
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ...    38   0.55
gi|13876739|gb|AAK43586.1| C-type lectin-like protein 1 [Bungaru...    38   0.55
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat...    38   0.55
gi|2144278|pir||S43922 versican - pig-tailed macaque (fragments)       37   0.72
gi|39589890|emb|CAE60888.1| Hypothetical protein CBG04603 [Caeno...    37   0.72
gi|30580858|sp||Q28858_3 [Segment 3 of 3] Versican core protein ...    37   0.72
gi|37182231|gb|AAQ88918.1| RPGT208 [Homo sapiens]                      37   0.72
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B...    37   0.72
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (...    37   0.72
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g...    37   0.72
gi|19263589|gb|AAH25407.1| Layilin [Homo sapiens]                      37   0.72
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens]          37   0.72
gi|16550435|dbj|BAB70978.1| unnamed protein product [Homo sapiens]     37   0.72
gi|30520331|ref|NP_849156.1| layilin [Homo sapiens] >gnl|BL_ORD_...    37   0.72
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul...    37   0.72
gi|15218209|ref|NP_175641.1| protein kinase family protein / C-t...    37   0.72
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ...    37   0.72
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_...    37   0.72
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec...    37   0.72
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ...    37   0.72
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ...    37   0.72
gi|11496539|ref|NP_044549.1| ribosomal protein S3 [Toxoplasma go...    37   0.94
gi|47214539|emb|CAG04559.1| unnamed protein product [Tetraodon n...    37   1.2
gi|17544382|ref|NP_502990.1| predicted CDS, c-type lectin family...    37   1.2
gi|13876735|gb|AAK43584.1| C-type lectin-like protein 1 [Bungaru...    36   1.6
gi|39589078|emb|CAE57810.1| Hypothetical protein CBG00834 [Caeno...    36   2.1
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)...    36   2.1
gi|17565348|ref|NP_507187.1| predicted CDS, putative protein, wi...    35   2.7
gi|50729858|ref|XP_416682.1| PREDICTED: similar to Chondrolectin...    35   3.6
gi|126130|sp|P21963|LECG_CROAT Galactose-specific lectin >gnl|BL...    35   3.6
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n...    35   4.7
gi|17559102|ref|NP_505754.1| predicted CDS, c-type lectin family...    35   4.7
gi|17506147|ref|NP_493487.1| predicted CDS, putative protein fam...    35   4.7
gi|33300312|emb|CAE17891.1| Hypothetical protein M199.6 [Caenorh...    35   4.7
gi|1478014|gb|AAB36401.1| ECLV IX/X-bp alpha subunit=coagulation...    35   4.7
gi|41353970|gb|AAS01426.1| C-type lectin [Bothrops insularis]          35   4.7
gi|31198959|ref|XP_308427.1| ENSANGP00000018514 [Anopheles gambi...    34   6.1
gi|17541218|ref|NP_500091.1| predicted CDS, c-type lectin family...    34   6.1
gi|17562694|ref|NP_507835.1| putative protein (5U249) [Caenorhab...    34   6.1
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna...    34   6.1
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele...    34   6.1
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga...    34   6.1
gi|47551241|ref|NP_999805.1| C-type lectin domain protein; SpC-l...    34   6.1
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n...    34   6.1
gi|47270749|gb|AAC04420.2| Hypothetical protein K03H6.4 [Caenorh...    34   6.1
gi|50750998|ref|XP_422224.1| PREDICTED: similar to regenerating ...    34   6.1
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu...    34   6.1
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b...    34   6.1
gi|17559556|ref|NP_507665.1| predicted CDS, c-type lectin family...    34   7.9
gi|33865756|ref|NP_897315.1| putative methionyl-tRNA synthetase ...    34   7.9
gi|38345754|emb|CAE03482.2| OSJNBa0065O17.7 [Oryza sativa (japon...    34   7.9
gi|3790610|gb|AAC68695.1| layilin [Cricetulus griseus]                 34   7.9
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs...    34   7.9
gi|39583740|emb|CAE63844.1| Hypothetical protein CBG08400 [Caeno...    34   7.9
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor...    34   7.9


>gi|17539324|ref|NP_503089.1| putative protein family member, with a
            transmembrane domain (4S289) [Caenorhabditis elegans]
 gi|7497639|pir||T20055 hypothetical protein C49C3.11 - Caenorhabditis
            elegans
 gi|3875074|emb|CAB05156.1| Hypothetical protein C49C3.11
            [Caenorhabditis elegans]
          Length = 404

 Score =  713 bits (1841), Expect = 0.0
 Identities = 341/404 (84%), Positives = 341/404 (84%)
 Frame = +1

Query: 1    MTAFYDNESLTNFLIIXXXXXXXXXXXXMTDXXXXXXXXXXXXXXXXXXXRGFICCFKFC 180
            MTAFYDNESLTNFLII            MTD                   RGFICCFKFC
Sbjct: 1    MTAFYDNESLTNFLIIDYYDDSSDDEDYMTDVPEKVSVTKKKKKVRKCVKRGFICCFKFC 60

Query: 181  KYTFLCCRCVIVWRCLWLLIIFFVGCLIFTLFYYDDRYILQIQLFSKRSVSTKTILKPYS 360
            KYTFLCCRCVIVWRCLWLLIIFFVGCLIFTLFYYDDRYILQIQLFSKRSVSTKTILKPYS
Sbjct: 61   KYTFLCCRCVIVWRCLWLLIIFFVGCLIFTLFYYDDRYILQIQLFSKRSVSTKTILKPYS 120

Query: 361  SINKLRVAINFSNCFNPAQSSRFFIYKKPVSPSERVVLYRFLQTMRFLYXXXXXXXXXXX 540
            SINKLRVAINFSNCFNPAQSSRFFIYKKPVSPSERVVLYRFLQTMRFLY
Sbjct: 121  SINKLRVAINFSNCFNPAQSSRFFIYKKPVSPSERVVLYRFLQTMRFLYISAVALVISVA 180

Query: 541  XXGNPFGGDDKCEEGKPTCPPGYKFQEREGKRGWCLKYFPGNTTFEEAEKICRCQGGASL 720
              GNPFGGDDKCEEGKPTCPPGYKFQEREGKRGWCLKYFPGNTTFEEAEKICRCQGGASL
Sbjct: 181  AIGNPFGGDDKCEEGKPTCPPGYKFQEREGKRGWCLKYFPGNTTFEEAEKICRCQGGASL 240

Query: 721  SGIENMKELTWVIVQAKASFAEEGIQTGGIWVGAYRRKACWDKKNLNKTECSKELQYQWT 900
            SGIENMKELTWVIVQAKASFAEEGIQTGGIWVGAYRRKACWDKKNLNKTECSKELQYQWT
Sbjct: 241  SGIENMKELTWVIVQAKASFAEEGIQTGGIWVGAYRRKACWDKKNLNKTECSKELQYQWT 300

Query: 901  DRNTVGNLMWKKRWTAGAPHDNTVGDHHEYCVQLQVTVDPALANKNLTGFFDNRVCVNPA 1080
            DRNTVGNLMWKKRWTAGAPHDNTVGDHHEYCVQLQVTVDPALANKNLTGFFDNRVCVNPA
Sbjct: 301  DRNTVGNLMWKKRWTAGAPHDNTVGDHHEYCVQLQVTVDPALANKNLTGFFDNRVCVNPA 360

Query: 1081 AENQFPSEGFLCGRPPKYTXXXXXXXXXXXXXXXXXXXKPTKKP 1212
            AENQFPSEGFLCGRPPKYT                   KPTKKP
Sbjct: 361  AENQFPSEGFLCGRPPKYTGGGNGGYGGGGGLVIIGAGKPTKKP 404




[DB home][top]