Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C49C3_14
(1215 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539324|ref|NP_503089.1| putative protein family member, wit... 713 0.0
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno... 342 8e-93
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno... 114 5e-24
gi|17539326|ref|NP_503090.1| versican family member, possibly N-... 101 4e-20
gi|39591912|emb|CAE75132.1| Hypothetical protein CBG23060 [Caeno... 91 5e-17
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb... 88 4e-16
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb... 86 2e-15
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno... 74 9e-12
gi|17559816|ref|NP_505795.1| c-type lectin precursor family memb... 71 6e-11
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur... 71 6e-11
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae... 70 8e-11
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family... 70 1e-10
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno... 70 1e-10
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur... 70 1e-10
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno... 67 6e-10
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb... 67 8e-10
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ... 67 1e-09
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno... 66 1e-09
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur... 66 2e-09
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb... 65 3e-09
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)... 65 3e-09
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb... 64 7e-09
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno... 64 9e-09
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k... 63 1e-08
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb... 62 2e-08
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno... 62 2e-08
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)... 62 3e-08
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb... 61 5e-08
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb... 61 6e-08
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno... 60 8e-08
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)... 60 8e-08
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno... 59 2e-07
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)... 59 2e-07
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family... 59 3e-07
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k... 58 4e-07
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam... 58 5e-07
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family... 57 7e-07
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)... 57 7e-07
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno... 56 1e-06
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family... 56 2e-06
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno... 56 2e-06
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor... 55 3e-06
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ... 55 3e-06
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab... 55 3e-06
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or... 55 4e-06
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd... 55 4e-06
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno... 54 7e-06
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi... 53 2e-05
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb... 53 2e-05
gi|17506689|ref|NP_493310.1| putative protein family member (1N7... 53 2e-05
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno... 52 2e-05
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family... 52 4e-05
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno... 51 5e-05
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6... 51 5e-05
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno... 51 6e-05
gi|17554624|ref|NP_498491.1| putative secreted or extracellular ... 51 6e-05
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)... 51 6e-05
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno... 51 6e-05
gi|39583020|emb|CAE71799.1| Hypothetical protein CBG18810 [Caeno... 50 8e-05
gi|39587765|emb|CAE67783.1| Hypothetical protein CBG13359 [Caeno... 50 1e-04
gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)... 49 2e-04
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno... 49 2e-04
gi|39587766|emb|CAE67784.1| Hypothetical protein CBG13360 [Caeno... 49 2e-04
gi|7506707|pir||T16749 hypothetical protein R13F6.2 - Caenorhabd... 49 3e-04
gi|17554616|ref|NP_498492.1| predicted CDS, putative secreted or... 49 3e-04
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno... 48 5e-04
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno... 48 5e-04
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno... 48 5e-04
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)... 47 7e-04
gi|39582793|emb|CAE74256.1| Hypothetical protein CBG21945 [Caeno... 46 0.002
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb... 46 0.002
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno... 46 0.002
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur... 45 0.003
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno... 45 0.003
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno... 44 0.006
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb... 44 0.006
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno... 44 0.008
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam... 44 0.010
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno... 43 0.013
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno... 43 0.013
gi|17566100|ref|NP_507868.1| c-type lectin family member (5U452)... 43 0.013
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family... 43 0.017
gi|17562684|ref|NP_507837.1| putative protein family member (5U2... 43 0.017
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa... 43 0.017
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb... 42 0.022
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family... 42 0.022
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno... 42 0.029
gi|17557544|ref|NP_505863.1| putative protein family member (5L7... 41 0.050
gi|17553034|ref|NP_497946.1| c-type lectin precursor family memb... 41 0.050
gi|17531799|ref|NP_494750.1| putative protein family member (2E5... 41 0.050
gi|34922645|sp|Q9PSN0|LECG_BITAR Galactose-specific lectin (PAL)... 41 0.050
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno... 41 0.065
gi|47228322|emb|CAG07717.1| unnamed protein product [Tetraodon n... 41 0.065
gi|33332307|gb|AAQ11365.1| crotocetin [Crotalus durissus terrifi... 41 0.065
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h... 40 0.085
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb... 40 0.085
gi|39598089|emb|CAE68781.1| Hypothetical protein CBG14725 [Caeno... 40 0.085
gi|39583006|emb|CAE71785.1| Hypothetical protein CBG18789 [Caeno... 40 0.085
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 40 0.11
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f... 40 0.14
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno... 39 0.19
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno... 39 0.25
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE... 39 0.25
gi|39582517|emb|CAE65604.1| Hypothetical protein CBG10625 [Caeno... 39 0.25
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica] 39 0.25
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica] 39 0.25
gi|34922643|sp|Q9PSM4|LECG_LACST Galactose-specific lectin (Muti... 39 0.25
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B... 39 0.32
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus] 39 0.32
gi|47227138|emb|CAG00500.1| unnamed protein product [Tetraodon n... 39 0.32
gi|17532827|ref|NP_495020.1| putative protein family member (2F6... 39 0.32
gi|7674107|sp|Q9YGP1|LECG_TRIST Galactose-binding lectin precurs... 39 0.32
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens] 38 0.42
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ... 38 0.42
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi... 38 0.42
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote... 38 0.42
gi|833853|gb|AAA67565.1| versican V2 core protein precursor 38 0.42
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [... 38 0.42
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus] 38 0.42
gi|1143285|gb|AAA87847.1| brevican core protein 38 0.42
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_... 38 0.42
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr... 38 0.42
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [... 38 0.42
gi|7512195|pir||PC7027 aggretin alpha chain - Malayan pit viper ... 38 0.42
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ... 38 0.42
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus] 38 0.42
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p... 38 0.42
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens] 38 0.42
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ... 38 0.42
gi|8809812|gb|AAF79952.1| aggretin alpha chain [Calloselasma rho... 38 0.42
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ... 38 0.42
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|... 38 0.42
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID... 38 0.42
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma... 38 0.55
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_... 38 0.55
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ... 38 0.55
gi|13876739|gb|AAK43586.1| C-type lectin-like protein 1 [Bungaru... 38 0.55
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat... 38 0.55
gi|2144278|pir||S43922 versican - pig-tailed macaque (fragments) 37 0.72
gi|39589890|emb|CAE60888.1| Hypothetical protein CBG04603 [Caeno... 37 0.72
gi|30580858|sp||Q28858_3 [Segment 3 of 3] Versican core protein ... 37 0.72
gi|37182231|gb|AAQ88918.1| RPGT208 [Homo sapiens] 37 0.72
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B... 37 0.72
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (... 37 0.72
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g... 37 0.72
gi|19263589|gb|AAH25407.1| Layilin [Homo sapiens] 37 0.72
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens] 37 0.72
gi|16550435|dbj|BAB70978.1| unnamed protein product [Homo sapiens] 37 0.72
gi|30520331|ref|NP_849156.1| layilin [Homo sapiens] >gnl|BL_ORD_... 37 0.72
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul... 37 0.72
gi|15218209|ref|NP_175641.1| protein kinase family protein / C-t... 37 0.72
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ... 37 0.72
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_... 37 0.72
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec... 37 0.72
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ... 37 0.72
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ... 37 0.72
gi|11496539|ref|NP_044549.1| ribosomal protein S3 [Toxoplasma go... 37 0.94
gi|47214539|emb|CAG04559.1| unnamed protein product [Tetraodon n... 37 1.2
gi|17544382|ref|NP_502990.1| predicted CDS, c-type lectin family... 37 1.2
gi|13876735|gb|AAK43584.1| C-type lectin-like protein 1 [Bungaru... 36 1.6
gi|39589078|emb|CAE57810.1| Hypothetical protein CBG00834 [Caeno... 36 2.1
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)... 36 2.1
gi|17565348|ref|NP_507187.1| predicted CDS, putative protein, wi... 35 2.7
gi|50729858|ref|XP_416682.1| PREDICTED: similar to Chondrolectin... 35 3.6
gi|126130|sp|P21963|LECG_CROAT Galactose-specific lectin >gnl|BL... 35 3.6
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n... 35 4.7
gi|17559102|ref|NP_505754.1| predicted CDS, c-type lectin family... 35 4.7
gi|17506147|ref|NP_493487.1| predicted CDS, putative protein fam... 35 4.7
gi|33300312|emb|CAE17891.1| Hypothetical protein M199.6 [Caenorh... 35 4.7
gi|1478014|gb|AAB36401.1| ECLV IX/X-bp alpha subunit=coagulation... 35 4.7
gi|41353970|gb|AAS01426.1| C-type lectin [Bothrops insularis] 35 4.7
gi|31198959|ref|XP_308427.1| ENSANGP00000018514 [Anopheles gambi... 34 6.1
gi|17541218|ref|NP_500091.1| predicted CDS, c-type lectin family... 34 6.1
gi|17562694|ref|NP_507835.1| putative protein (5U249) [Caenorhab... 34 6.1
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna... 34 6.1
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele... 34 6.1
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga... 34 6.1
gi|47551241|ref|NP_999805.1| C-type lectin domain protein; SpC-l... 34 6.1
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n... 34 6.1
gi|47270749|gb|AAC04420.2| Hypothetical protein K03H6.4 [Caenorh... 34 6.1
gi|50750998|ref|XP_422224.1| PREDICTED: similar to regenerating ... 34 6.1
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu... 34 6.1
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b... 34 6.1
gi|17559556|ref|NP_507665.1| predicted CDS, c-type lectin family... 34 7.9
gi|33865756|ref|NP_897315.1| putative methionyl-tRNA synthetase ... 34 7.9
gi|38345754|emb|CAE03482.2| OSJNBa0065O17.7 [Oryza sativa (japon... 34 7.9
gi|3790610|gb|AAC68695.1| layilin [Cricetulus griseus] 34 7.9
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs... 34 7.9
gi|39583740|emb|CAE63844.1| Hypothetical protein CBG08400 [Caeno... 34 7.9
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor... 34 7.9
>gi|17539324|ref|NP_503089.1| putative protein family member, with a
transmembrane domain (4S289) [Caenorhabditis elegans]
gi|7497639|pir||T20055 hypothetical protein C49C3.11 - Caenorhabditis
elegans
gi|3875074|emb|CAB05156.1| Hypothetical protein C49C3.11
[Caenorhabditis elegans]
Length = 404
Score = 713 bits (1841), Expect = 0.0
Identities = 341/404 (84%), Positives = 341/404 (84%)
Frame = +1
Query: 1 MTAFYDNESLTNFLIIXXXXXXXXXXXXMTDXXXXXXXXXXXXXXXXXXXRGFICCFKFC 180
MTAFYDNESLTNFLII MTD RGFICCFKFC
Sbjct: 1 MTAFYDNESLTNFLIIDYYDDSSDDEDYMTDVPEKVSVTKKKKKVRKCVKRGFICCFKFC 60
Query: 181 KYTFLCCRCVIVWRCLWLLIIFFVGCLIFTLFYYDDRYILQIQLFSKRSVSTKTILKPYS 360
KYTFLCCRCVIVWRCLWLLIIFFVGCLIFTLFYYDDRYILQIQLFSKRSVSTKTILKPYS
Sbjct: 61 KYTFLCCRCVIVWRCLWLLIIFFVGCLIFTLFYYDDRYILQIQLFSKRSVSTKTILKPYS 120
Query: 361 SINKLRVAINFSNCFNPAQSSRFFIYKKPVSPSERVVLYRFLQTMRFLYXXXXXXXXXXX 540
SINKLRVAINFSNCFNPAQSSRFFIYKKPVSPSERVVLYRFLQTMRFLY
Sbjct: 121 SINKLRVAINFSNCFNPAQSSRFFIYKKPVSPSERVVLYRFLQTMRFLYISAVALVISVA 180
Query: 541 XXGNPFGGDDKCEEGKPTCPPGYKFQEREGKRGWCLKYFPGNTTFEEAEKICRCQGGASL 720
GNPFGGDDKCEEGKPTCPPGYKFQEREGKRGWCLKYFPGNTTFEEAEKICRCQGGASL
Sbjct: 181 AIGNPFGGDDKCEEGKPTCPPGYKFQEREGKRGWCLKYFPGNTTFEEAEKICRCQGGASL 240
Query: 721 SGIENMKELTWVIVQAKASFAEEGIQTGGIWVGAYRRKACWDKKNLNKTECSKELQYQWT 900
SGIENMKELTWVIVQAKASFAEEGIQTGGIWVGAYRRKACWDKKNLNKTECSKELQYQWT
Sbjct: 241 SGIENMKELTWVIVQAKASFAEEGIQTGGIWVGAYRRKACWDKKNLNKTECSKELQYQWT 300
Query: 901 DRNTVGNLMWKKRWTAGAPHDNTVGDHHEYCVQLQVTVDPALANKNLTGFFDNRVCVNPA 1080
DRNTVGNLMWKKRWTAGAPHDNTVGDHHEYCVQLQVTVDPALANKNLTGFFDNRVCVNPA
Sbjct: 301 DRNTVGNLMWKKRWTAGAPHDNTVGDHHEYCVQLQVTVDPALANKNLTGFFDNRVCVNPA 360
Query: 1081 AENQFPSEGFLCGRPPKYTXXXXXXXXXXXXXXXXXXXKPTKKP 1212
AENQFPSEGFLCGRPPKYT KPTKKP
Sbjct: 361 AENQFPSEGFLCGRPPKYTGGGNGGYGGGGGLVIIGAGKPTKKP 404