Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C49C3_15
(645 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539326|ref|NP_503090.1| versican family member, possibly N-... 431 e-120
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno... 253 2e-66
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno... 104 2e-21
gi|17539324|ref|NP_503089.1| putative protein family member, wit... 101 1e-20
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno... 87 4e-16
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb... 85 1e-15
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)... 78 1e-13
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ... 78 2e-13
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno... 77 2e-13
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb... 75 1e-12
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)... 74 2e-12
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k... 73 5e-12
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb... 72 9e-12
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno... 71 2e-11
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb... 71 2e-11
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)... 69 6e-11
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb... 69 6e-11
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)... 69 1e-10
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb... 68 1e-10
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb... 68 1e-10
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab... 68 2e-10
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor... 68 2e-10
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ... 68 2e-10
gi|39592447|emb|CAE63524.1| Hypothetical protein CBG08003 [Caeno... 67 2e-10
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae... 67 3e-10
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno... 67 3e-10
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)... 66 5e-10
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb... 66 7e-10
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)... 65 9e-10
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family... 65 9e-10
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur... 65 1e-09
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno... 65 1e-09
gi|39592446|emb|CAE63523.1| Hypothetical protein CBG08002 [Caeno... 65 1e-09
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family... 63 4e-09
gi|17508069|ref|NP_493489.1| c-type lectin family member (1O843)... 62 7e-09
gi|17560214|ref|NP_507154.1| predicted CDS, c-type lectin precur... 62 7e-09
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno... 62 7e-09
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno... 62 9e-09
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family... 61 2e-08
gi|17560662|ref|NP_507006.1| c-type lectin family member (5Q453)... 60 3e-08
gi|17506689|ref|NP_493310.1| putative protein family member (1N7... 60 4e-08
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno... 59 6e-08
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur... 59 6e-08
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb... 59 6e-08
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi... 58 1e-07
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family... 58 2e-07
gi|39592428|emb|CAE63505.1| Hypothetical protein CBG07982 [Caeno... 57 3e-07
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno... 57 3e-07
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae... 57 4e-07
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb... 57 4e-07
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family... 57 4e-07
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur... 55 9e-07
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur... 55 9e-07
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno... 55 1e-06
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd... 55 2e-06
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)... 54 3e-06
gi|17531799|ref|NP_494750.1| putative protein family member (2E5... 54 3e-06
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno... 54 3e-06
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or... 53 6e-06
gi|39582793|emb|CAE74256.1| Hypothetical protein CBG21945 [Caeno... 53 6e-06
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k... 52 1e-05
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno... 52 1e-05
gi|39579666|emb|CAE56464.1| Hypothetical protein CBG24174 [Caeno... 52 1e-05
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb... 52 1e-05
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno... 52 1e-05
gi|39580257|emb|CAE69649.1| Hypothetical protein CBG15894 [Caeno... 52 1e-05
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ... 51 2e-05
gi|17510431|ref|NP_493431.1| putative endoplasmic reticulum prot... 51 2e-05
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6... 51 2e-05
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno... 51 2e-05
gi|47228322|emb|CAG07717.1| unnamed protein product [Tetraodon n... 51 2e-05
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa... 50 3e-05
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno... 50 4e-05
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno... 50 4e-05
gi|39580388|emb|CAE70947.1| Hypothetical protein CBG17757 [Caeno... 50 5e-05
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens] 49 6e-05
gi|833853|gb|AAA67565.1| versican V2 core protein precursor 49 6e-05
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|... 49 6e-05
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno... 49 6e-05
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens] 49 6e-05
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam... 49 6e-05
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p... 49 6e-05
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ... 49 6e-05
gi|39583048|emb|CAE71827.1| Hypothetical protein CBG18868 [Caeno... 49 6e-05
gi|17566546|ref|NP_507913.1| c-type lectin precursor family memb... 49 8e-05
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno... 49 1e-04
gi|17554888|ref|NP_497956.1| predicted CDS, c-type lectin family... 49 1e-04
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n... 48 1e-04
gi|39583006|emb|CAE71785.1| Hypothetical protein CBG18789 [Caeno... 48 1e-04
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [... 48 2e-04
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [... 48 2e-04
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote... 48 2e-04
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi... 48 2e-04
gi|17506147|ref|NP_493487.1| predicted CDS, putative protein fam... 47 2e-04
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus] 47 2e-04
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ... 47 2e-04
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ... 47 2e-04
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID... 47 2e-04
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ... 47 2e-04
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr... 47 2e-04
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_... 47 3e-04
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B... 47 3e-04
gi|4337050|gb|AAD18055.1| fibrinogen clotting inhibitor A chain ... 47 3e-04
gi|39593989|emb|CAE70099.1| Hypothetical protein CBG16543 [Caeno... 47 3e-04
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)... 47 3e-04
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus] 47 3e-04
gi|18252680|gb|AAL66391.1| antithrombin 1 A chain [Deinagkistrod... 47 4e-04
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb... 47 4e-04
gi|17557544|ref|NP_505863.1| putative protein family member (5L7... 47 4e-04
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga... 47 4e-04
gi|17553032|ref|NP_497944.1| predicted CDS, c-type lectin family... 47 4e-04
gi|23321261|gb|AAN23125.1| agglucetin-alpha 2 subunit precursor ... 46 5e-04
gi|33341210|gb|AAQ15166.1| stejaggregin-A alpha chain [Trimeresu... 46 5e-04
gi|17553034|ref|NP_497946.1| c-type lectin precursor family memb... 46 5e-04
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno... 46 5e-04
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno... 46 7e-04
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam... 45 0.001
gi|34098769|sp|Q9YGG9|MMHA_AGKHA Mamushigin alpha chain precurso... 45 0.001
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec... 45 0.001
gi|40889260|pdb|1OZ7|A Chain A, Crystal Structure Of Echicetin F... 45 0.001
gi|181168|gb|AAA35726.1| proteoglycan core protein 45 0.001
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic... 45 0.001
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (... 45 0.001
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr... 45 0.001
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n... 45 0.001
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr... 45 0.001
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA... 45 0.001
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno... 45 0.002
gi|17554624|ref|NP_498491.1| putative secreted or extracellular ... 45 0.002
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb... 44 0.002
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro... 44 0.002
gi|206105|gb|AAA41836.1| proteoglycan 44 0.002
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ... 44 0.002
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca... 44 0.002
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr... 44 0.002
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family... 44 0.002
gi|33332307|gb|AAQ11365.1| crotocetin [Crotalus durissus terrifi... 44 0.002
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (... 44 0.002
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h... 44 0.003
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno... 44 0.003
gi|39582517|emb|CAE65604.1| Hypothetical protein CBG10625 [Caeno... 44 0.003
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro... 43 0.005
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ... 43 0.005
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 43 0.005
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo... 43 0.005
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna... 43 0.005
gi|1514645|emb|CAA42701.1| cartilage aggregating proteoglycan [S... 43 0.005
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu... 43 0.005
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b... 43 0.005
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno... 43 0.006
gi|13876739|gb|AAK43586.1| C-type lectin-like protein 1 [Bungaru... 43 0.006
gi|7497627|pir||T20046 hypothetical protein C49A1.9 - Caenorhabd... 43 0.006
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor... 43 0.006
gi|7512195|pir||PC7027 aggretin alpha chain - Malayan pit viper ... 43 0.006
gi|17506151|ref|NP_493484.1| predicted CDS, putative protein fam... 43 0.006
gi|8809812|gb|AAF79952.1| aggretin alpha chain [Calloselasma rho... 43 0.006
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno... 42 0.008
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno... 42 0.008
gi|1364010|pir||JC4329 coagulation factor IX-binding protein A c... 42 0.008
gi|31879369|dbj|BAC77706.1| EMS16 A chain [Echis multisquamatus] 42 0.008
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat... 42 0.008
gi|20562939|gb|AAM22787.1| C-type lectin [Deinagkistrodon acutus... 42 0.008
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ... 42 0.008
gi|33243082|gb|AAQ01211.1| C-type lectin CTL-1 [Echis ocellatus] 42 0.008
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno... 42 0.008
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ... 42 0.008
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele... 42 0.008
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ... 42 0.008
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ... 42 0.010
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo... 42 0.010
gi|37619781|emb|CAA84655.3| Hypothetical protein F10F2.5 [Caenor... 42 0.010
gi|33341212|gb|AAQ15167.1| stejaggregin-A beta chain-1 [Trimeres... 42 0.010
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus] 42 0.013
gi|47228554|emb|CAG05374.1| unnamed protein product [Tetraodon n... 42 0.013
gi|14719570|pdb|1IOD|A Chain A, Crystal Structure Of The Complex... 42 0.013
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)... 42 0.013
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris] 42 0.013
gi|27734228|sp|P81508|CHBA_CROHO CHH-B alpha subunit 42 0.013
gi|17566100|ref|NP_507868.1| c-type lectin family member (5U452)... 42 0.013
gi|33341216|gb|AAQ15169.1| stejaggregin-A beta chain-3 [Trimeres... 42 0.013
gi|33341214|gb|AAQ15168.1| stejaggregin-A beta chain-2 [Trimeres... 42 0.013
gi|39580384|emb|CAE70943.1| Hypothetical protein CBG17751 [Caeno... 41 0.017
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh... 41 0.017
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma... 41 0.023
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs... 41 0.023
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family... 41 0.023
gi|33332305|gb|AAQ11364.1| crotocetin-1 [Crotalus durissus terri... 41 0.023
gi|33243086|gb|AAQ01213.1| C-type lectin CTL-3 [Echis carinatus ... 41 0.023
gi|33243080|gb|AAQ01210.1| C-type lectin CTL-8 [Bitis arietans] ... 41 0.023
gi|33243098|gb|AAQ01219.1| C-type lectin CTL-4 [Echis pyramidum ... 41 0.023
gi|33243078|gb|AAQ01209.1| C-type lectin CTL-6 [Bitis arietans] 41 0.023
gi|33243090|gb|AAQ01215.1| C-type lectin CTL-8 [Echis carinatus ... 41 0.023
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8... 41 0.023
gi|13876735|gb|AAK43584.1| C-type lectin-like protein 1 [Bungaru... 40 0.030
gi|39579641|emb|CAE56640.1| Hypothetical protein CBG24401 [Caeno... 40 0.030
gi|33243076|gb|AAQ01208.1| C-type lectin CTL-5 [Bitis arietans] 40 0.030
gi|37993395|gb|AAR06853.1| C-type lectin-3 [Bitis gabonica] 40 0.030
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus] 40 0.030
gi|2134245|pir||JC5059 bitiscetin beta chain - puff adder >gnl|B... 40 0.030
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co... 40 0.039
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ... 40 0.039
gi|33341200|gb|AAQ15161.1| stejaggregin-B alpha chain-2 [Trimere... 40 0.039
gi|33341208|gb|AAQ15165.1| stejaggregin-B alpha chain-4 [Trimere... 40 0.039
gi|33341198|gb|AAQ15160.1| stejaggregin-B alpha chain-1 [Trimere... 40 0.039
gi|25245561|gb|AAN72438.1| flavocetin-A alpha chain [Trimeresuru... 40 0.039
gi|21260584|gb|AAM43809.1| C-type lectin-like protein TMVA B cha... 40 0.039
gi|211655|gb|AAA48720.1| proteoglycan core protein 40 0.039
gi|16758114|ref|NP_445835.1| lymphocyte antigen 68 [Rattus norve... 40 0.050
gi|21541989|sp|Q9ET61|CD93_RAT Complement component C1q receptor... 40 0.050
gi|20562937|gb|AAM22786.1| ACF 1/2 A-chain [Deinagkistrodon acutus] 40 0.050
gi|8980619|dbj|BAA99281.1| anticoagulant protein A [Deinagkistro... 40 0.050
gi|33341184|gb|AAQ15153.1| factor IX/X binding protein alpha cha... 39 0.066
gi|25245527|gb|AAN72437.1| flavocetin-A beta chain [Trimeresurus... 39 0.066
gi|2773304|gb|AAB96767.1| aggrecan core protein [Equus caballus] 39 0.066
gi|33243102|gb|AAQ01221.1| C-type lectin CTL-7 [Echis pyramidum ... 39 0.066
gi|34922645|sp|Q9PSN0|LECG_BITAR Galactose-specific lectin (PAL)... 39 0.066
gi|7245413|pdb|1C3A|B Chain B, Crystal Structure Of Flavocetin-A... 39 0.066
gi|33341202|gb|AAQ15162.1| stejaggregin-B alpha chain-3 [Trimere... 39 0.086
gi|7674107|sp|Q9YGP1|LECG_TRIST Galactose-binding lectin precurs... 39 0.086
gi|399125|sp|P22029|BOTA_BOTJA Botrocetin, alpha chain (Platelet... 39 0.086
gi|3212543|pdb|1IXX|A Chain A, Crystal Structure Of Coagulation ... 39 0.086
gi|12583677|dbj|BAB21452.1| factor XI/factor X binding protein A... 39 0.086
gi|33391736|gb|AAQ17468.1| factor X activator light chain 1 prec... 39 0.086
gi|23321263|gb|AAN23126.1| agglucetin-beta 1 subunit precursor [... 39 0.086
gi|3287904|sp|P81398|RHCB_AGKRH Rhodocetin beta subunit 39 0.086
gi|33243094|gb|AAQ01217.1| C-type lectin CTL-9 [Echis carinatus ... 39 0.086
gi|2851435|sp|P23806|IXA_TRIFL Coagulation factor IX/factor X-bi... 39 0.086
gi|6754578|ref|NP_034870.1| complement component 1, q subcompone... 39 0.086
gi|3023231|sp|P81113|ABA3_TRIAB Alboaggregin A subunit 3 39 0.086
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno... 39 0.086
gi|1478014|gb|AAB36401.1| ECLV IX/X-bp alpha subunit=coagulation... 39 0.11
gi|17561852|ref|NP_506804.1| predicted CDS, c-type lectin family... 39 0.11
gi|40889261|pdb|1OZ7|B Chain B, Crystal Structure Of Echicetin F... 39 0.11
gi|19263589|gb|AAH25407.1| Layilin [Homo sapiens] 39 0.11
gi|16550435|dbj|BAB70978.1| unnamed protein product [Homo sapiens] 39 0.11
gi|30520331|ref|NP_849156.1| layilin [Homo sapiens] >gnl|BL_ORD_... 39 0.11
gi|32450776|gb|AAP41219.2| echicetin B-chain [Echis carinatus] 39 0.11
gi|37182231|gb|AAQ88918.1| RPGT208 [Homo sapiens] 39 0.11
gi|38493055|pdb|1UKM|A Chain A, Crystal Structure Of Ems16, An A... 39 0.11
gi|6677705|ref|NP_033069.1| regenerating islet-derived 2; rat re... 39 0.11
gi|3023229|sp|P81111|ABA1_TRIAB Alboaggregin A subunit 1 38 0.15
gi|17543488|ref|NP_500445.1| c-type lectin family member (65.9 k... 38 0.15
gi|33243072|gb|AAQ01206.1| C-type lectin CTL-1 [Bitis arietans] 38 0.15
gi|17559882|ref|NP_504948.1| predicted CDS, putative protein (5I... 38 0.15
gi|17562684|ref|NP_507837.1| putative protein family member (5U2... 38 0.15
gi|39655010|pdb|1V4L|B Chain B, Crystal Structure Of A Platelet ... 38 0.15
gi|13876737|gb|AAK43585.1| C-type lectin-like protein 2 [Bungaru... 38 0.19
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno... 38 0.19
gi|39589078|emb|CAE57810.1| Hypothetical protein CBG00834 [Caeno... 38 0.19
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno... 38 0.19
gi|17536719|ref|NP_493771.1| c-type lectin family member (2A900)... 38 0.19
gi|37575443|gb|AAQ93686.1| mucrocetin alpha chain [Protobothrops... 37 0.25
gi|21260582|gb|AAM43808.1| C-type lectin-like protein TMVA A cha... 37 0.25
gi|1839441|gb|AAB47092.1| platelet glycoprotein Ib-binding prote... 37 0.25
gi|39587766|emb|CAE67784.1| Hypothetical protein CBG13360 [Caeno... 37 0.25
gi|34098771|sp|Q9YI92|MMHB_AGKHA Mamushigin beta chain precursor... 37 0.33
gi|6715115|gb|AAF26287.1| agkisacutacin B chain [Deinagkistrodon... 37 0.33
gi|11277029|pir||JC7135 agkisacutacin beta chain precursor - sha... 37 0.33
gi|38493056|pdb|1UKM|B Chain B, Crystal Structure Of Ems16, An A... 37 0.33
gi|17540466|ref|NP_500450.1| c-type lectin family member (65.9 k... 37 0.33
gi|17559100|ref|NP_505753.1| putative protein family member (5L2... 37 0.33
gi|34922643|sp|Q9PSM4|LECG_LACST Galactose-specific lectin (Muti... 37 0.33
gi|39583019|emb|CAE71798.1| Hypothetical protein CBG18809 [Caeno... 37 0.43
gi|37575445|gb|AAQ93687.1| mucrocetin beta chain [Protobothrops ... 37 0.43
gi|7993934|sp|P81996|ECHB_ECHCA Echicetin beta subunit >gnl|BL_O... 36 0.56
gi|2144278|pir||S43922 versican - pig-tailed macaque (fragments) 36 0.56
gi|30580858|sp||Q28858_3 [Segment 3 of 3] Versican core protein ... 36 0.56
gi|17507421|ref|NP_493450.1| putative protein family member (1O6... 36 0.56
gi|7245412|pdb|1C3A|A Chain A, Crystal Structure Of Flavocetin-A... 36 0.56
gi|31203403|ref|XP_310650.1| ENSANGP00000020762 [Anopheles gambi... 36 0.56
gi|1478015|gb|AAB36402.1| ECLV IX/X-bp beta subunit=Ca(2+)-depen... 36 0.56
gi|113926|sp|P05140|ANP_HEMAM Type II antifreeze protein precurs... 36 0.73
gi|33341194|gb|AAQ15158.1| stejaggregin-B beta chain-1 [Trimeres... 36 0.73
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE... 36 0.73
gi|37537732|gb|AAQ92957.1| BJcuL precursor [Bothrops jararacussu] 36 0.73
gi|3023230|sp|P81112|ABA2_TRIAB Alboaggregin A subunit 2 36 0.73
gi|213874|gb|AAA49617.1| antifreeze polypeptide (AFP) precursor 36 0.73
gi|31879371|dbj|BAC77707.1| EMS16 B chain [Echis multisquamatus] 36 0.73
gi|33416211|gb|AAQ18640.1| factor IX binding protein A chain [Gl... 36 0.73
gi|18252678|gb|AAL66390.1| antithrombin 1 B chain [Deinagkistrod... 35 0.95
gi|23321265|gb|AAN23127.1| agglucetin-beta 2 subunit precursor [... 35 0.95
gi|48375116|gb|AAT42221.1| mannan-binding C-type lectin [Stichop... 35 0.95
gi|2829697|sp|P81017|ECHA_ECHCA Echicetin alpha subunit 35 1.2
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g... 35 1.2
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens] 35 1.2
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul... 35 1.2
gi|31542313|ref|NP_525126.2| C-type lectin, superfamily member 8... 35 1.2
gi|17226268|gb|AAL37713.1| C-type lectin-like receptor CLEC-6 [H... 35 1.2
gi|7497641|pir||T20063 hypothetical protein C49C3.13 - Caenorhab... 35 1.2
gi|50730821|ref|XP_417032.1| PREDICTED: similar to antithrombin ... 35 1.2
gi|37993391|gb|AAR06851.1| C-type lectin-1 [Bitis gabonica] 35 1.2
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans] 35 1.2
gi|32566191|ref|NP_503091.2| c-type lectin family member (4S295)... 35 1.2
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_... 35 1.2
gi|32450274|gb|AAH53817.1| MGC64513 protein [Xenopus laevis] 35 1.6
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens] 35 1.6
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]... 35 1.6
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ... 35 1.6
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ... 35 1.6
gi|25090033|sp|O93426|CVXA_CRODU Convulxin alpha precursor (CVX ... 35 1.6
gi|39591376|emb|CAE73430.1| Hypothetical protein CBG20873 [Caeno... 35 1.6
gi|17531337|ref|NP_493698.1| c-type lectin precursor family memb... 35 1.6
gi|283849|pir||B42972 coagulation factor X activating enzyme (EC... 34 2.1
gi|50750998|ref|XP_422224.1| PREDICTED: similar to regenerating ... 34 2.1
gi|39587016|emb|CAE62951.1| Hypothetical protein CBG07164 [Caeno... 34 2.8
gi|34922459|sp|P83519|LECG_BOTJR Galactose-specific lectin (BJcuL) 34 2.8
gi|39583020|emb|CAE71799.1| Hypothetical protein CBG18810 [Caeno... 34 2.8
gi|17542442|ref|NP_501639.1| putative protein (4K93) [Caenorhabd... 33 3.6
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica] 33 3.6
gi|41353970|gb|AAS01426.1| C-type lectin [Bothrops insularis] 33 3.6
gi|17506693|ref|NP_493312.1| putative protein family member (1N7... 33 3.6
gi|32396016|gb|AAP42417.1| c-type lectin [Bothrops jararacussu] 33 3.6
gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)... 33 3.6
gi|31615312|pdb|1GZ2|A Chain A, Crystal Structure Of The Ovoclei... 33 3.6
gi|4337052|gb|AAD18056.1| fibrinogen clotting inhibitor B chain ... 33 3.6
gi|17556711|ref|NP_499651.1| c2, putative phospholipid binding d... 33 3.6
gi|39655009|pdb|1V4L|A Chain A, Crystal Structure Of A Platelet ... 33 3.6
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu... 33 4.7
gi|23489845|gb|EAA21757.1| chloroquine resistance marker protein... 33 4.7
gi|39579486|emb|CAE56876.1| Hypothetical protein CBG24712 [Caeno... 33 4.7
gi|39585191|emb|CAE57434.1| Hypothetical protein CBG00395 [Caeno... 33 4.7
gi|33341196|gb|AAQ15159.1| stejaggregin-B beta chain-2 [Trimeres... 33 4.7
gi|47551241|ref|NP_999805.1| C-type lectin domain protein; SpC-l... 33 4.7
gi|41406896|ref|NP_959732.1| hypothetical protein MAP0798 [Mycob... 33 4.7
gi|28976187|ref|NP_803241.1| C3 protein [Tomato leaf curl Laos v... 33 4.7
gi|32699622|sp|Q9PRS8|OC17_CHICK Ovocleidin 17 (OC-17) >gnl|BL_O... 33 4.7
gi|17535547|ref|NP_493851.1| predicted CDS, receptor for egg jel... 33 4.7
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s... 33 4.7
gi|39587015|emb|CAE62950.1| Hypothetical protein CBG07163 [Caeno... 33 6.2
gi|20562945|gb|AAM22790.1| antithrombin A A-chain [Deinagkistrod... 33 6.2
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B... 33 6.2
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus] 33 6.2
gi|1143285|gb|AAA87847.1| brevican core protein 33 6.2
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_... 33 6.2
gi|49077258|ref|XP_402511.1| hypothetical protein UM04896.1 [Ust... 33 6.2
gi|17554616|ref|NP_498492.1| predicted CDS, putative secreted or... 33 6.2
gi|7506707|pir||T16749 hypothetical protein R13F6.2 - Caenorhabd... 33 6.2
gi|17558312|ref|NP_506807.1| c-type lectin family member (5P828)... 33 6.2
gi|29827980|ref|NP_822614.1| putative TetR-family transcriptiona... 33 6.2
gi|47230558|emb|CAF99751.1| unnamed protein product [Tetraodon n... 33 6.2
gi|27734229|sp|P81509|CHBB_CROHO CHH-B beta subunit 33 6.2
gi|399126|sp|P22030|BOTB_BOTJA Botrocetin, beta chain (Platelet ... 33 6.2
gi|45382181|ref|NP_990761.1| receptor tyrosine kinase [Gallus ga... 32 8.0
gi|11967285|gb|AAG42040.1| agkicetin alpha subunit precursor [De... 32 8.0
gi|50259700|gb|EAL22370.1| hypothetical protein CNBB5430 [Crypto... 32 8.0
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica] 32 8.0
gi|6677703|ref|NP_033068.1| regenerating islet-derived 1; rat re... 32 8.0
gi|126130|sp|P21963|LECG_CROAT Galactose-specific lectin >gnl|BL... 32 8.0
gi|26346052|dbj|BAC36677.1| unnamed protein product [Mus musculus] 32 8.0
gi|32697984|emb|CAB02800.2| Hypothetical protein C29F3.4 [Caenor... 32 8.0
gi|16332124|ref|NP_442852.1| hypothetical protein [Synechocystis... 32 8.0
gi|17511041|ref|NP_492870.1| putative secreted or extracellular ... 32 8.0
>gi|17539326|ref|NP_503090.1| versican family member, possibly
N-myristoylated (4S290) [Caenorhabditis elegans]
gi|7497640|pir||T20056 hypothetical protein C49C3.12 -
Caenorhabditis elegans
gi|3875075|emb|CAB05157.1| Hypothetical protein C49C3.12
[Caenorhabditis elegans]
Length = 214
Score = 431 bits (1108), Expect = e-120
Identities = 205/214 (95%), Positives = 205/214 (95%)
Frame = -1
Query: 645 MGVPMGNGDCGAEFKCPPNFHKSNRVNGVWCIKVYPGNMTWWEAERECRCTIKGGHLSGI 466
MGVPMGNGDCGAEFKCPPNFHKSNRVNGVWCIKVYPGNMTWWEAERECRCTIKGGHLSGI
Sbjct: 1 MGVPMGNGDCGAEFKCPPNFHKSNRVNGVWCIKVYPGNMTWWEAERECRCTIKGGHLSGI 60
Query: 465 ESNSEKRYVEEQTLSILDDKNIKNGAVWLGAYRRKECPSGKVSSDSICHDEKTFQFTDQH 286
ESNSEKRYVEEQTLSILDDKNIKNGAVWLGAYRRKECPSGKVSSDSICHDEKTFQFTDQH
Sbjct: 61 ESNSEKRYVEEQTLSILDDKNIKNGAVWLGAYRRKECPSGKVSSDSICHDEKTFQFTDQH 120
Query: 285 TCKTLIFQDWAANQPTNNAGDDCAVLLASTEASGSNSEASGKAAVKNCLHVQGTTPILSS 106
TCKTLIFQDWAANQPTNNAGDDCAVLLASTEASGSNSEASGKAAVKNCLHVQGTTPILSS
Sbjct: 121 TCKTLIFQDWAANQPTNNAGDDCAVLLASTEASGSNSEASGKAAVKNCLHVQGTTPILSS 180
Query: 105 VGFVCGVKAAQEXXXXXXXXXGDFMVIGAAKPKH 4
VGFVCGVKAAQE GDFMVIGAAKPKH
Sbjct: 181 VGFVCGVKAAQEGGNYGGYGGGDFMVIGAAKPKH 214