Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C49H3_9
(330 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539346|ref|NP_501321.1| putative nuclear protein (12.3 kD) ... 169 1e-41
gi|39595043|emb|CAE70911.1| Hypothetical protein CBG17708 [Caeno... 133 1e-30
gi|47575762|ref|NP_001001225.1| hypothetical protein MGC69408 [X... 51 7e-06
gi|47218353|emb|CAG04185.1| unnamed protein product [Tetraodon n... 49 2e-05
gi|20866290|ref|XP_125893.1| RIKEN cDNA 1190005P17 [Mus musculus... 49 2e-05
gi|11493938|gb|AAG35713.1| learning-associated protein LAPS18 [L... 48 6e-05
gi|14150124|ref|NP_115714.1| hypothetical protein MGC14817 [Homo... 47 7e-05
gi|38082976|ref|XP_128790.2| similar to RIKEN cDNA 1190005P17 [M... 47 7e-05
gi|27696447|gb|AAH43994.1| MGC53320 protein [Xenopus laevis] 47 7e-05
gi|27668260|ref|XP_234491.1| similar to RIKEN cDNA 1190005P17 [R... 47 1e-04
gi|27718471|ref|XP_216898.1| similar to RIKEN cDNA 1190005P17 [R... 47 1e-04
gi|48121682|ref|XP_396493.1| similar to MGC53320 protein [Apis m... 43 0.002
gi|46435553|gb|EAK94932.1| hypothetical protein CaO19.7742 [Cand... 38 0.058
gi|32413905|ref|XP_327432.1| hypothetical protein [Neurospora cr... 36 0.22
gi|31205159|ref|XP_311528.1| ENSANGP00000010240 [Anopheles gambi... 36 0.22
gi|25986831|gb|AAM93751.1| heat shock protein 90 [Cryptobia salm... 35 0.37
gi|39590667|emb|CAE65037.1| Hypothetical protein CBG09877 [Caeno... 35 0.37
gi|46431871|gb|EAK91393.1| hypothetical protein CaO19.6160 [Cand... 34 0.64
gi|2501243|sp|Q00313|TOP1_CANAL DNA topoisomerase I >gnl|BL_ORD_... 34 0.64
gi|49076016|ref|XP_402028.1| hypothetical protein UM04413.1 [Ust... 34 0.83
gi|50757472|ref|XP_415527.1| PREDICTED: similar to 9230102N17Rik... 34 0.83
gi|1762119|gb|AAB39507.1| topoisomerase I 34 0.83
gi|46435860|gb|EAK95233.1| hypothetical protein CaO19.96 [Candid... 34 0.83
gi|17554502|ref|NP_497888.1| putative nuclear protein, with 2 co... 33 1.1
gi|46138571|ref|XP_390976.1| hypothetical protein FG10800.1 [Gib... 33 1.1
gi|25986829|gb|AAM93750.1| heat shock protein 90 [Trypanoplasma ... 33 1.1
gi|17555542|ref|NP_498236.1| worm aRMadillo (90.3 kD) (wrm-1) [C... 33 1.1
gi|630734|pir||S43597 coiled-coil protein homolog R07E5.6 - Caen... 33 1.1
gi|7494869|pir||T15342 hypothetical protein B0336.1 - Caenorhabd... 33 1.1
gi|19074574|ref|NP_586080.1| similarity to ribosomal protein L5 ... 33 1.1
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo... 33 1.4
gi|39595358|emb|CAE60395.1| Hypothetical protein CBG03997 [Caeno... 33 1.4
gi|4454548|gb|AAD20944.1| silencing mediator of retinoic acid an... 33 1.4
gi|50417102|gb|AAH77134.1| Unknown (protein for MGC:100899) [Dan... 33 1.4
gi|17531971|ref|NP_495130.1| putative nuclear protein (12.6 kD) ... 33 1.9
gi|24657611|ref|NP_647899.1| CG15019-PA [Drosophila melanogaster... 33 1.9
gi|12643930|sp|Q9WU42|NCR2_MOUSE Nuclear receptor corepressor 2 ... 33 1.9
gi|6754804|ref|NP_035554.1| nuclear receptor co-repressor 2; sil... 33 1.9
gi|4454550|gb|AAD20945.1| silencing mediator of retinoic acid an... 33 1.9
gi|677198|gb|AAB00143.1| putative 32 2.4
gi|46431250|gb|EAK90848.1| hypothetical protein CaO19.2629 [Cand... 32 2.4
gi|31222030|ref|XP_317104.1| ENSANGP00000019655 [Anopheles gambi... 32 2.4
gi|33329051|gb|AAQ09932.1| CG18178 [Drosophila yakuba] 32 2.4
gi|3127039|gb|AAC16037.1| IL-16 precursor [Saimiri sciureus] 32 2.4
gi|6320145|ref|NP_010225.1| involved intracellular protein trans... 32 2.4
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p... 32 2.4
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae] 32 2.4
gi|47228961|emb|CAG09476.1| unnamed protein product [Tetraodon n... 32 3.2
gi|17559578|ref|NP_504584.1| immunoglobulin-like and fibronectin... 32 3.2
gi|7498955|pir||T34418 hypothetical protein F12F3.3 - Caenorhabd... 32 3.2
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans] 32 3.2
gi|50427061|ref|XP_462136.1| unnamed protein product [Debaryomyc... 32 3.2
gi|17541376|ref|NP_501845.1| putative nuclear protein, with a co... 32 3.2
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans] 32 3.2
gi|34882338|ref|XP_343672.1| similar to chromatin assembly facto... 32 4.1
gi|28210489|ref|NP_781433.1| putative surface/cell-adhesion prot... 32 4.1
gi|14669602|gb|AAK71996.1| NFRKB-like protein [Apis mellifera] 32 4.1
gi|30851290|gb|AAH52620.1| CHAF1A protein [Homo sapiens] 32 4.1
gi|7304957|ref|NP_038761.1| chromatin assembly factor 1, subunit... 32 4.1
gi|39595447|emb|CAE60485.1| Hypothetical protein CBG04099 [Caeno... 32 4.1
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl... 32 4.1
gi|32566379|ref|NP_501555.2| predicted CDS, putative nuclear pro... 31 5.4
gi|15223583|ref|NP_176058.1| expressed protein [Arabidopsis thal... 31 5.4
gi|23613096|ref|NP_703418.1| hypothetical protein [Plasmodium fa... 31 5.4
gi|17540268|ref|NP_501006.1| DNaJ domain (prokaryotic heat shock... 31 5.4
gi|2498231|sp|P55746|CGA2_HELPY CYTOTOXICITY ASSOCIATED IMMUNODO... 31 5.4
gi|50425143|ref|XP_461163.1| unnamed protein product [Debaryomyc... 31 5.4
gi|7497855|pir||T20175 hypothetical protein C53B4.2 - Caenorhabd... 31 5.4
gi|13242872|gb|AAB36371.2| prIL-16 [Homo sapiens] 31 7.0
gi|23483514|gb|EAA19159.1| hypothetical protein [Plasmodium yoel... 31 7.0
gi|34859382|ref|XP_345452.1| similar to Set alpha isoform [Rattu... 31 7.0
gi|32399111|emb|CAD98351.1| hypothetical predicted protein, unkn... 31 7.0
gi|46121951|ref|XP_385529.1| predicted protein [Gibberella zeae ... 31 7.0
gi|7650364|gb|AAF66014.1| delta Kalirin-7 [Rattus norvegicus] 31 7.0
gi|50406784|ref|XP_456662.1| unnamed protein product [Debaryomyc... 31 7.0
gi|36953836|gb|AAQ86961.1| neural interleukin 16 precursor prote... 31 7.0
gi|23508041|ref|NP_700711.1| hypothetical protein [Plasmodium fa... 31 7.0
gi|11466577|ref|NP_066467.1| NADH dehydrogenase subunit 2 [Rhodo... 31 7.0
gi|49078010|ref|XP_402801.1| hypothetical protein UM05186.1 [Ust... 31 7.0
gi|48716277|dbj|BAD22892.1| putative ubiquitin C-terminal hydrol... 31 7.0
gi|46442750|gb|EAL02037.1| hypothetical protein CaO19.13888 [Can... 31 7.0
gi|7767545|gb|AAF69144.1| Kalirin-7c isoform [Rattus norvegicus] 31 7.0
gi|27262657|ref|NP_757366.1| interleukin 16 isoform 2; lymphocyt... 31 7.0
gi|27262655|ref|NP_004504.3| interleukin 16 isoform 1 proprotein... 31 7.0
gi|1945569|gb|AAD04636.1| putative IL-16 protein precursor [Homo... 31 7.0
gi|38257904|sp|O62666|IL16_PANTR Interleukin-16 precursor (IL-16... 31 7.0
gi|2114410|gb|AAB58261.1| interleukin-16 [Homo sapiens] 31 7.0
gi|32565889|ref|NP_502274.2| UNCoordinated locomotion UNC-22, im... 30 9.2
gi|25404544|pir||F96679 hypothetical protein F5I14.2 [imported] ... 30 9.2
gi|27734072|ref|NP_775552.1| RIKEN cDNA 2810411A03 [Mus musculus... 30 9.2
gi|15220980|ref|NP_176725.1| chromatin assembly factor-1 (FASCIA... 30 9.2
gi|25986835|gb|AAM93753.1| heat shock protein 90 [Cryptobia heli... 30 9.2
gi|23510180|ref|NP_702846.1| ran binding protein 1 [Plasmodium f... 30 9.2
gi|47225353|emb|CAG09853.1| unnamed protein product [Tetraodon n... 30 9.2
gi|7511244|pir||T27935 hypothetical protein ZK617.1b - Caenorhab... 30 9.2
gi|28850293|gb|AAM45317.2| similar to Required for the transfer ... 30 9.2
gi|9626822|ref|NP_041092.1| ORF 1 [Ictalurid herpesvirus 1] >gnl... 30 9.2
>gi|17539346|ref|NP_501321.1| putative nuclear protein (12.3 kD)
(4I689) [Caenorhabditis elegans]
gi|7497691|pir||T34183 hypothetical protein C49H3.3 -
Caenorhabditis elegans
gi|9802883|gb|AAF99893.1| Hypothetical protein C49H3.3
[Caenorhabditis elegans]
Length = 109
Score = 169 bits (429), Expect = 1e-41
Identities = 86/86 (100%), Positives = 86/86 (100%)
Frame = +1
Query: 1 MAKSLRSKFKRRVRAIARTKKEPKTAALLQKAIDKRDEYEKQDAEKTKTDGTANEEKMEV 180
MAKSLRSKFKRRVRAIARTKKEPKTAALLQKAIDKRDEYEKQDAEKTKTDGTANEEKMEV
Sbjct: 1 MAKSLRSKFKRRVRAIARTKKEPKTAALLQKAIDKRDEYEKQDAEKTKTDGTANEEKMEV 60
Query: 181 TSQATINTKTLKKKDGSFPAWLSGTQ 258
TSQATINTKTLKKKDGSFPAWLSGTQ
Sbjct: 61 TSQATINTKTLKKKDGSFPAWLSGTQ 86