Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C52E2_4
         (903 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17532545|ref|NP_494094.1| cyclin-like F-box family member (2C...   600   e-170
gi|17532533|ref|NP_494097.1| cyclin-like F-box family member (2C...   288   2e-76
gi|32565225|ref|NP_494093.2| putative cytoplasmic protein family...   263   5e-69
gi|49035188|gb|AAK67220.3| Hypothetical protein C52E2.6 [Caenorh...   253   4e-66
gi|7511050|pir||T32417 hypothetical protein ZK250.6 - Caenorhabd...   220   3e-56
gi|17537845|ref|NP_494136.1| predicted CDS, Meprin/TRAF-like MAT...   220   3e-56
gi|17531811|ref|NP_494100.1| predicted CDS, cyclin-like F-box fa...   213   4e-54
gi|17510373|ref|NP_493458.1| cyclin-like F-box family member (1O...   176   5e-43
gi|17510369|ref|NP_493456.1| cyclin-like F-box family member (1O...   176   8e-43
gi|17555104|ref|NP_497155.1| cyclin-like F-box family member (3A...    83   7e-15
gi|17510357|ref|NP_493459.1| predicted CDS, cyclin-like F-box fa...    76   9e-13
gi|17561462|ref|NP_507756.1| predicted CDS, cyclin-like F-box fa...    76   1e-12
gi|17555320|ref|NP_499788.1| cyclin-like F-box family member (3O...    72   1e-11
gi|17537759|ref|NP_494024.1| cyclin-like F-box family member (2B...    72   2e-11
gi|17555108|ref|NP_497157.1| very Early Transcript VET-3, cyclin...    68   3e-10
gi|17510355|ref|NP_493460.1| cyclin-like F-box family member (1O...    67   5e-10
gi|17536893|ref|NP_494653.1| predicted CDS, cyclin-like F-box fa...    67   7e-10
gi|17541840|ref|NP_500565.1| cyclin-like F-box family member (4F...    65   3e-09
gi|7506472|pir||T29660 hypothetical protein R08C7.9 - Caenorhabd...    64   6e-09
gi|17550770|ref|NP_510808.1| cyclin-like F-box family member (XR...    64   6e-09
gi|29570440|gb|AAO91704.1| Hypothetical protein R08C7.13 [Caenor...    63   8e-09
gi|17534271|ref|NP_494693.1| cyclin-like F-box family member (2E...    63   1e-08
gi|17555102|ref|NP_497154.1| cyclin-like F-box family member (3A...    63   1e-08
gi|17533147|ref|NP_494640.1| short-chain dehydrogenase family me...    62   2e-08
gi|17561952|ref|NP_503305.1| cyclin-like F-box family member (5B...    62   2e-08
gi|17554632|ref|NP_499389.1| cyclin-like F-box family member (3L...    61   3e-08
gi|17552604|ref|NP_499398.1| cyclin-like F-box family member (3L...    60   9e-08
gi|17532977|ref|NP_494357.1| cyclin-like F-box family member (2D...    55   2e-06
gi|17534511|ref|NP_494041.1| predicted CDS, cyclin-like F-box fa...    55   3e-06
gi|17556284|ref|NP_499547.1| predicted CDS, cyclin-like F-box fa...    55   3e-06
gi|7507908|pir||T33429 hypothetical protein T17A3.6 - Caenorhabd...    55   3e-06
gi|7496931|pir||T15749 hypothetical protein C33F10.8 - Caenorhab...    55   3e-06
gi|17555106|ref|NP_497156.1| putative cytoplasmic protein family...    55   3e-06
gi|25153988|ref|NP_740980.1| cyclin-like F-box family member (42...    55   3e-06
gi|17536311|ref|NP_494178.1| predicted CDS, cyclin-like F-box fa...    54   6e-06
gi|17534091|ref|NP_493878.1| cyclin-like F-box family member (2B...    53   8e-06
gi|17561468|ref|NP_507759.1| predicted CDS, cyclin-like F-box fa...    53   1e-05
gi|17536783|ref|NP_493764.1| predicted CDS, cyclin-like F-box fa...    53   1e-05
gi|37859213|gb|AAF39821.2| Hypothetical protein F45D11.13 [Caeno...    52   1e-05
gi|17541590|ref|NP_501431.1| cyclin-like F-box family member (4J...    52   2e-05
gi|17568467|ref|NP_508301.1| predicted CDS, putative protein fam...    52   2e-05
gi|17531651|ref|NP_494079.1| cyclin-like F-box family member (2C...    52   2e-05
gi|17507459|ref|NP_493499.1| cyclin-like F-box family member (1O...    51   4e-05
gi|7503792|pir||T22401 hypothetical protein F49B2.1 - Caenorhabd...    51   4e-05
gi|17534923|ref|NP_493995.1| cyclin-like F-box family member (2B...    51   4e-05
gi|17534099|ref|NP_493881.1| putative protein family member (2B2...    50   7e-05
gi|17532265|ref|NP_494204.1| cyclin-like F-box family member (2C...    50   9e-05
gi|17532979|ref|NP_494358.1| predicted CDS, cyclin-like F-box fa...    49   1e-04
gi|17537289|ref|NP_494560.1| predicted CDS, cyclin-like F-box fa...    49   1e-04
gi|17509951|ref|NP_493362.1| cyclin-like F-box family member (1O...    49   1e-04
gi|17534513|ref|NP_494042.1| cyclin-like F-box family member (2B...    49   1e-04
gi|17561456|ref|NP_507753.1| cyclin-like F-box family member (5T...    49   2e-04
gi|17534505|ref|NP_494036.1| cyclin-like F-box family member (2B...    49   2e-04
gi|32564823|ref|NP_493891.2| Meprin/TRAF-like MATH family member...    49   2e-04
gi|25395396|pir||B88035 protein M01D1.2 [imported] - Caenorhabdi...    49   2e-04
gi|17533767|ref|NP_494067.1| cyclin-like F-box family member (2C...    49   2e-04
gi|38176033|gb|AAB70998.3| Hypothetical protein M01D1.2 [Caenorh...    49   2e-04
gi|7497305|pir||T32324 hypothetical protein C41H7.2 - Caenorhabd...    48   3e-04
gi|17532983|ref|NP_494360.1| cyclin-like F-box family member (2D...    48   3e-04
gi|32565853|ref|NP_872062.1| predicted CDS, putative cytoplasmic...    48   3e-04
gi|7498363|pir||T32607 hypothetical protein E04A4.1 - Caenorhabd...    48   3e-04
gi|17532913|ref|NP_494167.1| cyclin-like F-box family member (36...    47   6e-04
gi|32566327|ref|NP_500625.2| predicted CDS, cyclin-like F-box fa...    47   6e-04
gi|17537755|ref|NP_494026.1| cyclin-like F-box family member (2B...    47   8e-04
gi|7505154|pir||T32391 hypothetical protein K02E7.5 - Caenorhabd...    46   0.001
gi|17537761|ref|NP_494025.1| cyclin-like F-box family member (2B...    46   0.001
gi|7498624|pir||T25674 hypothetical protein F08D12.6 - Caenorhab...    46   0.001
gi|17564740|ref|NP_507740.1| cyclin-like F-box family member (5T...    46   0.001
gi|17532973|ref|NP_494355.1| predicted CDS, cyclin-like F-box fa...    46   0.001
gi|17536137|ref|NP_494083.1| predicted CDS, cyclin-like F-box fa...    45   0.002
gi|17564748|ref|NP_507736.1| acyltransferase 3 family (5T697) [C...    45   0.002
gi|17564736|ref|NP_507742.1| cyclin-like F-box family member (5T...    45   0.003
gi|17535155|ref|NP_493897.1| cyclin-like F-box family member (2B...    44   0.004
gi|17534501|ref|NP_494039.1| cyclin-like F-box family member (2B...    44   0.004
gi|17558582|ref|NP_507766.1| cyclin-like F-box family member (5T...    44   0.004
gi|17534919|ref|NP_493991.1| predicted CDS, serum paraoxonase ar...    44   0.004
gi|17533549|ref|NP_494354.1| cyclin-like F-box family member (2D...    44   0.005
gi|17507461|ref|NP_493498.1| cyclin-like F-box family member (1O...    44   0.006
gi|7497385|pir||T19919 hypothetical protein C44B9.5 - Caenorhabd...    43   0.008
gi|17567597|ref|NP_508559.1| cyclin-like F-box family member (XD...    43   0.011
gi|17540942|ref|NP_502146.1| predicted CDS, cyclin-like F-box fa...    43   0.011
gi|17566476|ref|NP_507899.1| cyclin-like F-box family member (5U...    42   0.014
gi|17532981|ref|NP_494359.1| cyclin-like F-box family member (2D...    42   0.014
gi|17543002|ref|NP_500634.1| cyclin-like F-box family member (4F...    42   0.014
gi|17539858|ref|NP_500533.1| putative protein family member (4F5...    42   0.019
gi|17561450|ref|NP_507750.1| cyclin-like F-box family member (5T...    42   0.019
gi|17556272|ref|NP_499540.1| cyclin-like F-box family member (3M...    42   0.019
gi|17534523|ref|NP_494048.1| cyclin-like F-box family member (2B...    41   0.032
gi|17537757|ref|NP_494023.1| predicted CDS, cyclin-like F-box fa...    41   0.042
gi|17556282|ref|NP_499546.1| cyclin-like F-box family member (3M...    41   0.042
gi|17565318|ref|NP_507398.1| predicted CDS, putative protein fam...    40   0.055
gi|29570442|gb|AAO91706.1| Hypothetical protein R08C7.9 [Caenorh...    40   0.055
gi|7505335|pir||T32848 hypothetical protein K05F6.7 - Caenorhabd...    40   0.071
gi|17533773|ref|NP_494069.1| cyclin-like F-box family member (2C...    39   0.12
gi|17539594|ref|NP_500624.1| predicted CDS, putative cytoplasmic...    39   0.16
gi|7498705|pir||T20640 hypothetical protein F09C3.3 - Caenorhabd...    39   0.16
gi|17506553|ref|NP_493495.1| predicted CDS, cyclin-like F-box fa...    39   0.16
gi|17534055|ref|NP_494058.1| cyclin-like F-box family member (2C...    39   0.21
gi|17511127|ref|NP_493609.1| putative mitochondrial protein fami...    39   0.21
gi|17534911|ref|NP_493998.1| predicted CDS, putative cytoplasmic...    38   0.27
gi|17540100|ref|NP_500515.1| predicted CDS, transposase (4E982) ...    38   0.27
gi|39581936|emb|CAE72898.1| Hypothetical protein CBG20212 [Caeno...    38   0.35
gi|17541606|ref|NP_502237.1| cyclin-like F-box family member (4M...    38   0.35
gi|17535231|ref|NP_494601.1| predicted CDS, putative protein fam...    38   0.35
gi|17561464|ref|NP_507757.1| predicted CDS, attractin like famil...    37   0.46
gi|17541818|ref|NP_502100.1| putative cytoplasmic protein family...    37   0.46
gi|17558588|ref|NP_507762.1| serpentine Receptor, class H (srh-2...    37   0.60
gi|17561470|ref|NP_507760.1| cyclin-like F-box family member (5T...    37   0.60
gi|38174876|emb|CAE53731.1| Hypothetical protein C43D7.9 [Caenor...    37   0.60
gi|28828088|gb|AAO50771.1| similar to Derepression of GCN4 expre...    37   0.79
gi|7510650|pir||T25956 hypothetical protein ZC204.7 - Caenorhabd...    37   0.79
gi|42733956|gb|AAS38858.1| similar to Derepression of GCN4 expre...    37   0.79
gi|50507808|emb|CAB04476.2| Hypothetical protein F55C9.11 [Caeno...    37   0.79
gi|17533763|ref|NP_494071.1| predicted CDS, cyclin-like F-box fa...    36   1.0
gi|17535149|ref|NP_493895.1| cyclin-like F-box family member (2B...    36   1.0
gi|39587416|emb|CAE75070.1| Hypothetical protein CBG22986 [Caeno...    36   1.0
gi|23618975|ref|NP_704937.1| hypothetical protein [Plasmodium fa...    36   1.3
gi|17537295|ref|NP_494557.1| putative protein family member (2D7...    36   1.3
gi|17564738|ref|NP_507741.1| cyclin-like F-box family member (5T...    36   1.3
gi|49035103|gb|AAB66212.2| Hypothetical protein F45C12.14 [Caeno...    35   1.8
gi|17538558|ref|NP_502092.1| cyclin-like F-box family member (4L...    35   1.8
gi|17534073|ref|NP_494056.1| predicted CDS, cyclin-like F-box fa...    35   1.8
gi|17535153|ref|NP_493899.1| cyclin-like F-box family member (2B...    35   2.3
gi|17534915|ref|NP_493994.1| predicted CDS, putative cytoplasmic...    35   2.3
gi|39581934|emb|CAE72896.1| Hypothetical protein CBG20210 [Caeno...    35   3.0
gi|23479270|gb|EAA16145.1| hypothetical protein [Plasmodium yoel...    34   3.9
gi|17534097|ref|NP_493880.1| predicted CDS, cyclin-like F-box fa...    34   3.9
gi|39585523|emb|CAE65283.1| Hypothetical protein CBG10183 [Caeno...    34   3.9
gi|23003457|ref|ZP_00047119.1| COG1230: Co/Zn/Cd efflux system c...    34   5.1
gi|14193306|gb|AAK55890.1| ATP synthase gamma subunit [Candidatu...    34   5.1
gi|46227471|gb|EAK88406.1| large protein with a SPRY domain and ...    33   6.7
gi|25573212|gb|AAN75180.1| STE11 [Cryptococcus neoformans var. g...    33   6.7
gi|15792159|ref|NP_281982.1| UDP-N-acetylglucosamine pyrophospho...    33   6.7
gi|17558592|ref|NP_507761.1| cyclin-like F-box family member (5T...    33   8.7


>gi|17532545|ref|NP_494094.1| cyclin-like F-box family member
           (2C124) [Caenorhabditis elegans]
 gi|14550359|gb|AAK67221.1| Hypothetical protein C52E2.7
           [Caenorhabditis elegans]
          Length = 300

 Score =  600 bits (1548), Expect = e-170
 Identities = 300/300 (100%), Positives = 300/300 (100%)
 Frame = -1

Query: 903 MSAPSFPILRLPSKALHATLQTFDFVDLMSFSLISPTSVRPLNTGAASVYVILDNVITIV 724
           MSAPSFPILRLPSKALHATLQTFDFVDLMSFSLISPTSVRPLNTGAASVYVILDNVITIV
Sbjct: 1   MSAPSFPILRLPSKALHATLQTFDFVDLMSFSLISPTSVRPLNTGAASVYVILDNVITIV 60

Query: 723 AGFVIFYLNPPSDQIDRIKVFPQCRWLNESFSVKKCVENLLVALDLQEVEKLVISKEHVD 544
           AGFVIFYLNPPSDQIDRIKVFPQCRWLNESFSVKKCVENLLVALDLQEVEKLVISKEHVD
Sbjct: 61  AGFVIFYLNPPSDQIDRIKVFPQCRWLNESFSVKKCVENLLVALDLQEVEKLVISKEHVD 120

Query: 543 CDELKGFKFKMITMNVKNLKMFDLYYRDAKEISIADRAIFGEQSRALFSENLDCLEFLAE 364
           CDELKGFKFKMITMNVKNLKMFDLYYRDAKEISIADRAIFGEQSRALFSENLDCLEFLAE
Sbjct: 121 CDELKGFKFKMITMNVKNLKMFDLYYRDAKEISIADRAIFGEQSRALFSENLDCLEFLAE 180

Query: 363 CVIGLDDIIASNAIKTNIARPFSFSNLNLFLRHFINGSNPSLKEMNIAMEEGTFENYEKV 184
           CVIGLDDIIASNAIKTNIARPFSFSNLNLFLRHFINGSNPSLKEMNIAMEEGTFENYEKV
Sbjct: 181 CVIGLDDIIASNAIKTNIARPFSFSNLNLFLRHFINGSNPSLKEMNIAMEEGTFENYEKV 240

Query: 183 LLNGINYRTSNFSRIYADGSSSNGLEFQQNDRTNVIVFVDPIRRWFYLTTYSFSHHCSCT 4
           LLNGINYRTSNFSRIYADGSSSNGLEFQQNDRTNVIVFVDPIRRWFYLTTYSFSHHCSCT
Sbjct: 241 LLNGINYRTSNFSRIYADGSSSNGLEFQQNDRTNVIVFVDPIRRWFYLTTYSFSHHCSCT 300




[DB home][top]