Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C54C6_2
(276 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17554756|ref|NP_497727.1| ribosomal Protein, Large subunit (1... 172 1e-42
gi|17536655|ref|NP_497072.1| GLP 680 33251 33520 like (10.5 kD) ... 166 2e-40
gi|39583062|emb|CAE60602.1| Hypothetical protein CBG04239 [Caeno... 162 1e-39
gi|15214258|sp|Q9C0T1|RL37_EMENI 60S ribosomal protein L37 >gnl|... 110 6e-24
gi|24642107|ref|NP_573005.1| CG9091-PA [Drosophila melanogaster]... 107 6e-23
gi|38047707|gb|AAR09756.1| similar to Drosophila melanogaster CG... 107 6e-23
gi|37779096|gb|AAP20208.1| ribosomal protein L37 [Pagrus major] 106 1e-22
gi|19852052|gb|AAL99981.1| 60S ribosomal protein L37 [Aplysia ca... 105 2e-22
gi|31088846|sp|P59289|R37A_SCHPO 60S ribosomal protein L37-A (L3... 105 3e-22
gi|15218208|ref|NP_175640.1| 60S ribosomal protein L37 (RPL37B) ... 104 4e-22
gi|19075850|ref|NP_588350.1| 60s ribosomal protein L37 [Schizosa... 104 4e-22
gi|50761594|ref|XP_424773.1| PREDICTED: similar to ribosomal pro... 104 5e-22
gi|6094071|sp|O44125|RL37_SCHMA 60S RIBOSOMAL PROTEIN L37 >gnl|B... 104 5e-22
gi|18401007|ref|NP_566535.1| 60S ribosomal protein L37 (RPL37C) ... 102 2e-21
gi|50551883|ref|XP_503416.1| hypothetical protein [Yarrowia lipo... 102 2e-21
gi|50285187|ref|XP_445022.1| unnamed protein product [Candida gl... 102 2e-21
gi|6323214|ref|NP_013286.1| Protein component of the large (60S)... 102 2e-21
gi|50344792|ref|NP_001002069.1| zgc:86733 [Danio rerio] >gnl|BL_... 102 3e-21
gi|21071034|gb|AAB47039.2| ribosomal protein L37 [Homo sapiens] 102 3e-21
gi|47210130|emb|CAF95579.1| unnamed protein product [Tetraodon n... 102 3e-21
gi|20139580|sp|Q962S7|RL37_SPOFR 60S ribosomal protein L37 >gnl|... 102 3e-21
gi|49532862|dbj|BAD26666.1| Ribosomal protein L37 [Plutella xylo... 102 3e-21
gi|4506641|ref|NP_000988.1| ribosomal protein L37; 60S ribosomal... 101 3e-21
gi|49258864|pdb|1S1I|Y Chain Y, Structure Of The Ribosomal 80s-E... 101 5e-21
gi|27948818|gb|AAO25606.1| ribosomal protein L37A [Kluyveromyces... 100 1e-20
gi|50258937|gb|EAL21618.1| hypothetical protein CNBC6540 [Crypto... 100 1e-20
gi|50304647|ref|XP_452279.1| unnamed protein product [Kluyveromy... 99 2e-20
gi|45199207|ref|NP_986236.1| AFR688Cp [Eremothecium gossypii] >g... 99 2e-20
gi|12842823|dbj|BAB25746.1| unnamed protein product [Mus musculus] 99 2e-20
gi|50422675|ref|XP_459914.1| unnamed protein product [Debaryomyc... 99 2e-20
gi|6320708|ref|NP_010788.1| Protein component of the large (60S)... 99 2e-20
gi|49256539|gb|AAH73638.1| Unknown (protein for MGC:82973) [Xeno... 99 3e-20
gi|2829674|sp|P79244|RL37_BOVIN 60S RIBOSOMAL PROTEIN L37 >gnl|B... 98 4e-20
gi|45934571|gb|AAS79345.1| 60S ribosomal protein L37 [Aedes aegy... 98 5e-20
gi|23490537|gb|EAA22289.1| Ribosomal protein L37e, putative [Pla... 96 1e-19
gi|15218094|ref|NP_172977.1| 60S ribosomal protein L37 (RPL37A) ... 96 1e-19
gi|32417356|ref|XP_329156.1| hypothetical protein [Neurospora cr... 95 3e-19
gi|24659091|ref|NP_611757.1| CG9873-PA [Drosophila melanogaster]... 94 6e-19
gi|46227990|gb|EAK88910.1| 60S ribosomal protein L37 [Cryptospor... 94 7e-19
gi|44662866|gb|AAS47512.1| ribosomal protein L37 [Glycine max] 93 1e-18
gi|34878567|ref|XP_212752.2| similar to ribosomal protein L37 [R... 92 2e-18
gi|41052935|dbj|BAD07846.1| putative 60S ribosomal protein L37 [... 92 4e-18
gi|47847878|dbj|BAD21671.1| putative ribosomal protein L37 [Oryz... 91 6e-18
gi|20139809|sp|Q9P836|RL37_CANAL 60S ribosomal protein L37 >gnl|... 91 6e-18
gi|29249003|gb|EAA40524.1| GLP_680_33251_33520 [Giardia lamblia ... 88 4e-17
gi|2275274|gb|AAB63862.1| 60S ribosomal protein homolog [Schizos... 87 7e-17
gi|14754627|ref|XP_030893.1| similar to ribosomal protein L37 [H... 86 2e-16
gi|45709618|gb|AAH67790.1| Unknown (protein for IMAGE:5310673) [... 86 3e-16
gi|29735832|ref|XP_294473.1| similar to ribosomal protein L37 [H... 86 3e-16
gi|730561|sp|P39094|RL37_LEIIN 60S RIBOSOMAL PROTEIN L37 >gnl|BL... 85 3e-16
gi|49094926|ref|XP_408924.1| RL37_EMENI 60S ribosomal protein L3... 83 1e-15
gi|27680290|ref|XP_223076.1| similar to ribosomal protein L37 [R... 81 5e-15
gi|38567088|emb|CAE76385.1| probable ribosomal protein L37.e.A, ... 79 3e-14
gi|38084918|ref|XP_357054.1| similar to ribosomal protein L37 [M... 73 1e-12
gi|20984795|ref|XP_141962.1| similar to ribosomal protein L37 [M... 71 5e-12
gi|49077078|ref|XP_402444.1| hypothetical protein UM04829.1 [Ust... 70 1e-11
gi|46128585|ref|XP_388846.1| hypothetical protein FG08670.1 [Gib... 70 1e-11
gi|34861826|ref|XP_219512.2| similar to ribosomal protein L37 [R... 66 2e-10
gi|15668269|ref|NP_247062.1| LSU ribosomal protein L37E [Methano... 63 2e-09
gi|15678675|ref|NP_275790.1| ribosomal protein L37 [Methanotherm... 62 3e-09
gi|20455457|sp|P32410|RL37_HALMA 50S ribosomal protein L37e (L35... 62 3e-09
gi|421711|pir||S33789 ribosomal protein L37.eR [validated] - Hal... 62 3e-09
gi|20092010|ref|NP_618085.1| ribosomal protein L37 [Methanosarci... 61 5e-09
gi|15790490|ref|NP_280314.1| 50S ribosomal protein L37E; Rpl37e ... 61 7e-09
gi|19074568|ref|NP_586074.1| 60S RIBOSOMAL PROTEIN L37 [Encephal... 60 2e-08
gi|21226442|ref|NP_632364.1| LSU ribosomal protein L37E [Methano... 59 3e-08
gi|20093661|ref|NP_613508.1| Ribosomal protein L37E [Methanopyru... 58 6e-08
gi|15920546|ref|NP_376215.1| 61aa long hypothetical 50S ribosoma... 57 1e-07
gi|38100215|gb|EAA47377.1| hypothetical protein MG02620.4 [Magna... 56 2e-07
gi|11498480|ref|NP_069708.1| LSU ribosomal protein L37E (rpl37E)... 55 4e-07
gi|45358710|ref|NP_988267.1| Ribosomal protein L37e [Methanococc... 54 8e-07
gi|34866580|ref|XP_345843.1| similar to ribosomal protein L37 [R... 53 1e-06
gi|15897657|ref|NP_342262.1| LSU ribosomal protein L37E (rpl37E)... 53 2e-06
gi|13541186|ref|NP_110874.1| 50S ribosomal protein L37E [Thermop... 50 9e-06
gi|16082246|ref|NP_394697.1| probable ribosomal protein L37 [The... 50 1e-05
gi|22001910|sp|Q8U0P5|RL37_PYRFU 50S ribosomal protein L37e >gnl... 50 2e-05
gi|14600780|ref|NP_147301.1| 50S ribosomal protein L37 [Aeropyru... 50 2e-05
gi|33359566|ref|NP_579270.2| LSU ribosomal protein L37E [Pyrococ... 50 2e-05
gi|14520858|ref|NP_126333.1| LSU ribosomal protein L37E [Pyrococ... 50 2e-05
gi|1350736|sp|P49212|RL37_LYCES 60S RIBOSOMAL PROTEIN L37 >gnl|B... 47 1e-04
gi|82824|pir||S10052 ribosomal protein L37.e - fission yeast (Sc... 40 0.010
gi|11498713|ref|NP_069942.1| SSU ribosomal protein S27AE (rps27A... 35 0.40
gi|16082116|ref|NP_394552.1| probable 30S ribosomal protein S27A... 34 0.68
gi|13541313|ref|NP_111001.1| 30S ribosomal protein S27AE [Thermo... 34 0.89
gi|12311798|emb|CAC22616.1| hypothetical protein L4830.12 [Leish... 33 2.0
gi|34935328|ref|XP_234368.2| similar to metalloprotease-disinteg... 32 2.6
gi|37532978|ref|NP_920791.1| hypothetical protein similar to put... 32 2.6
gi|24647776|ref|NP_650654.1| CG14318-PA [Drosophila melanogaster... 32 3.4
gi|42521656|ref|NP_967036.1| hypothetical protein predicted by G... 32 4.4
gi|48374960|gb|AAT42158.1| hypothetical protein SB20O07.12 [Sorg... 31 5.8
gi|46110385|ref|XP_382250.1| predicted protein [Gibberella zeae ... 31 5.8
gi|15668569|ref|NP_247367.1| SSU ribosomal protein S27AE [Methan... 31 5.8
gi|10954862|ref|NP_053282.1| Hypothetical gene [Agrobacterium tu... 31 5.8
gi|15225947|ref|NP_182148.1| myosin heavy chain-related [Arabido... 31 7.5
>gi|17554756|ref|NP_497727.1| ribosomal Protein, Large subunit (10.4
kD) (rpl-37) [Caenorhabditis elegans]
gi|2507319|sp|P49622|RL37_CAEEL 60S ribosomal protein L37
gi|7497890|pir||T20195 ribosomal protein L37 C54C6.1 [similarity] -
Caenorhabditis elegans
gi|3875183|emb|CAB00854.1| Hypothetical protein C54C6.1
[Caenorhabditis elegans]
Length = 91
Score = 172 bits (437), Expect = 1e-42
Identities = 80/91 (87%), Positives = 80/91 (87%)
Frame = +1
Query: 1 MTKGTQAFGKKHVKSHTLCKRCGKSSFHIQKKRCASCGYQDAKKRTYNWGAKSIXXXXXX 180
MTKGTQAFGKKHVKSHTLCKRCGKSSFHIQKKRCASCGYQDAKKRTYNWGAKSI
Sbjct: 1 MTKGTQAFGKKHVKSHTLCKRCGKSSFHIQKKRCASCGYQDAKKRTYNWGAKSIRRRTTG 60
Query: 181 XXXXXHLRDVNARFRNGFRGTTPKPRAQPTN 273
HLRDVNARFRNGFRGTTPKPRAQPTN
Sbjct: 61 TGRTRHLRDVNARFRNGFRGTTPKPRAQPTN 91