Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C55C2_3
(330 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508751|ref|NP_491000.1| Sperm-Specific family, class P SSP-... 172 1e-42
gi|17542088|ref|NP_501767.1| MSP-domain protein like family memb... 168 2e-41
gi|17542086|ref|NP_500697.1| Sperm-Specific family, class P SSP-... 167 5e-41
gi|17508749|ref|NP_491762.1| Sperm-Specific family, class P SSP-... 165 2e-40
gi|39596794|emb|CAE59021.1| Hypothetical protein CBG02298 [Caeno... 162 2e-39
gi|17540424|ref|NP_501808.1| MSP-domain protein like family memb... 161 3e-39
gi|39591169|emb|CAE73222.1| Hypothetical protein CBG20628 [Caeno... 160 8e-39
gi|39582951|emb|CAE73016.1| Hypothetical protein CBG20377 [Caeno... 160 8e-39
gi|39591164|emb|CAE73217.1| Hypothetical protein CBG20623 [Caeno... 159 1e-38
gi|39594026|emb|CAE70136.1| Hypothetical protein CBG16598 [Caeno... 157 5e-38
gi|39592311|emb|CAE63388.1| Hypothetical protein CBG07809 [Caeno... 117 7e-26
gi|39595357|emb|CAE60394.1| Hypothetical protein CBG03996 [Caeno... 109 1e-23
gi|50511753|gb|AAT77426.1| MSP-domain protein 1 variant [Ascaris... 98 5e-20
gi|50511751|gb|AAT77425.1| MSP-domain protein 1 variant [Ascaris... 98 5e-20
gi|50511755|gb|AAT77427.1| MSP-domain protein 1 variant [Ascaris... 98 5e-20
gi|50511745|gb|AAT77422.1| MSP-domain protein 1 variant [Ascaris... 98 5e-20
gi|49121580|gb|AAN08879.2| MSP-domain protein 1 [Ascaris suum] 98 5e-20
gi|50511749|gb|AAT77424.1| MSP-domain protein 1 variant [Ascaris... 97 6e-20
gi|33114622|gb|AAP94884.1| MFP1-alpha [Ascaris suum] 96 1e-19
gi|33114624|gb|AAP94885.1| MFP1-beta [Ascaris suum] 96 2e-19
gi|17560900|ref|NP_506264.1| predicted CDS, MSP-domain protein 1... 89 4e-19
gi|39591509|emb|CAE73563.1| Hypothetical protein CBG21033 [Caeno... 91 7e-18
gi|17562962|ref|NP_506630.1| MSP-domain protein like family memb... 86 1e-16
gi|17509493|ref|NP_493185.1| MSP-domain protein 1 like precursor... 82 3e-15
gi|17508753|ref|NP_493318.1| Sperm-Specific family, class P SSP-... 81 5e-15
gi|17561434|ref|NP_506076.1| major sperm protein, member of a la... 81 5e-15
gi|17544490|ref|NP_501989.1| MSP-domain protein like family memb... 79 2e-14
gi|34810947|pdb|1M1S|A Chain A, Structure Of Wr4, A C.Elegans Ms... 79 2e-14
gi|39592211|emb|CAE75432.1| Hypothetical protein CBG23425 [Caeno... 77 7e-14
gi|17542418|ref|NP_501739.1| MSP-domain protein like family memb... 77 1e-13
gi|17542092|ref|NP_501782.1| Sperm-Specific family, class P SSP-... 75 3e-13
gi|17539024|ref|NP_501124.1| major sperm protein with N myristoy... 73 1e-12
gi|39581884|emb|CAE60778.1| Hypothetical protein CBG04467 [Caeno... 72 2e-12
gi|39589662|emb|CAE66897.1| Hypothetical protein CBG12279 [Caeno... 71 6e-12
gi|39593130|emb|CAE64599.1| Hypothetical protein CBG09354 [Caeno... 69 3e-11
gi|17542720|ref|NP_501825.1| putative protein family member (4K8... 68 5e-11
gi|17538125|ref|NP_496079.1| predicted CDS, MSP-domain protein l... 67 7e-11
gi|17538127|ref|NP_496078.1| predicted CDS, MSP-domain protein l... 67 1e-10
gi|17562648|ref|NP_504485.1| MSP-domain protein like family memb... 64 6e-10
gi|23169000|gb|AAN08881.1| MSP-domain protein 3 [Ascaris suum] >... 61 5e-09
gi|39594899|emb|CAE70767.1| Hypothetical protein CBG17518 [Caeno... 58 4e-08
gi|39586995|emb|CAE62930.1| Hypothetical protein CBG07136 [Caeno... 58 5e-08
gi|39595447|emb|CAE60485.1| Hypothetical protein CBG04099 [Caeno... 56 2e-07
gi|39591787|emb|CAE71365.1| Hypothetical protein CBG18269 [Caeno... 55 3e-07
gi|17568285|ref|NP_509840.1| predicted CDS, MSP-domain protein l... 55 3e-07
gi|17505881|ref|NP_492824.1| vamp-associated protein like family... 53 2e-06
gi|17560600|ref|NP_507182.1| MSP-domain protein like family memb... 52 2e-06
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 52 3e-06
gi|17554100|ref|NP_499837.1| predicted CDS, major sperm protein ... 52 4e-06
gi|17560040|ref|NP_507098.1| MSP-domain protein like family memb... 51 7e-06
gi|17558194|ref|NP_506702.1| MSP-domain protein like family memb... 50 1e-05
gi|17558208|ref|NP_506700.1| MSP-domain protein like family memb... 50 1e-05
gi|17563008|ref|NP_506815.1| predicted CDS, major sperm protein ... 49 2e-05
gi|17507523|ref|NP_492407.1| MSP-domain protein like family memb... 49 3e-05
gi|39589763|emb|CAE66998.1| Hypothetical protein CBG12397 [Caeno... 49 3e-05
gi|39586114|emb|CAE69190.1| Hypothetical protein CBG15225 [Caeno... 49 3e-05
gi|23169006|gb|AAN08882.1| MSP-domain protein 4 [Ascaris suum] >... 47 7e-05
gi|39594090|emb|CAE70200.1| Hypothetical protein CBG16675 [Caeno... 47 7e-05
gi|7496307|pir||T15562 hypothetical protein C18F10.2 - Caenorhab... 47 9e-05
gi|25152845|ref|NP_741183.1| predicted CDS, major sperm protein ... 47 9e-05
gi|17552806|ref|NP_498780.1| MSP-domain protein like family memb... 47 9e-05
gi|17509511|ref|NP_491051.1| MSP-domain protein like family memb... 47 1e-04
gi|17557470|ref|NP_506723.1| MSP-domain protein like family memb... 45 5e-04
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno... 43 0.001
gi|17558192|ref|NP_506701.1| MSP-domain protein like family memb... 43 0.002
gi|17540380|ref|NP_501472.1| MSP-domain protein like family memb... 42 0.002
gi|39589204|emb|CAE57937.1| Hypothetical protein CBG00991 [Caeno... 42 0.004
gi|17559594|ref|NP_507136.1| MSP-domain protein like (32.2 kD) (... 41 0.005
gi|23169009|gb|AAN08883.1| MSP-domain protein 5 [Ascaris suum] >... 41 0.007
gi|7503488|pir||T22235 hypothetical protein F45G2.3 - Caenorhabd... 40 0.012
gi|39579370|emb|CAE56171.1| Hypothetical protein CBG23791 [Caeno... 40 0.012
gi|38083597|ref|XP_128948.2| RIKEN cDNA 2010013H21 [Mus musculus] 39 0.034
gi|12842294|dbj|BAB25547.1| unnamed protein product [Mus musculus] 39 0.034
gi|26345712|dbj|BAC36507.1| unnamed protein product [Mus musculus] 39 0.034
gi|39593527|emb|CAE61819.1| Hypothetical protein CBG05789 [Caeno... 38 0.058
gi|17541248|ref|NP_501765.1| predicted CDS, MSP-domain protein l... 37 0.075
gi|33239571|ref|NP_874513.1| Aspartate oxidase [Prochlorococcus ... 36 0.17
gi|11288307|pir||JC7234 27k vesicle-associated membrane protein-... 36 0.17
gi|15224067|ref|NP_179963.1| vesicle-associated membrane protein... 34 0.64
gi|39582088|emb|CAE63731.1| Hypothetical protein CBG08258 [Caeno... 34 0.64
gi|23168994|gb|AAN08880.1| MSP-domain protein 2 [Ascaris suum] >... 34 0.64
gi|37805852|dbj|BAC99503.1| putative vesicle-associated membrane... 34 0.83
gi|39583643|emb|CAE65747.1| Hypothetical protein CBG10833 [Caeno... 34 0.83
gi|47226997|emb|CAG05889.1| unnamed protein product [Tetraodon n... 33 1.1
gi|32471829|ref|NP_864823.1| conserved hypothetical protein [Pir... 33 1.1
gi|39583249|emb|CAE60041.1| Hypothetical protein CBG03552 [Caeno... 33 1.1
gi|27674169|ref|XP_228394.1| similar to vessicle-associated memb... 33 1.1
gi|17542484|ref|NP_502216.1| MSP-domain protein 2 like family me... 33 1.4
gi|10957459|ref|NP_051603.1| extracellular nuclease, putative [D... 33 1.4
gi|23483569|gb|EAA19198.1| hypothetical protein [Plasmodium yoel... 33 1.9
gi|17505564|ref|NP_491434.1| MSP-domain protein like (19.5 kD) (... 33 1.9
gi|31209289|ref|XP_313611.1| ENSANGP00000003574 [Anopheles gambi... 33 1.9
gi|34907216|ref|NP_914955.1| P0504E02.2 [Oryza sativa (japonica ... 32 3.2
gi|33860660|ref|NP_892221.1| L-aspartate oxidase [Prochlorococcu... 32 3.2
gi|17544558|ref|NP_500774.1| MSP-domain protein 2 like family me... 32 4.1
gi|47223045|emb|CAG07132.1| unnamed protein product [Tetraodon n... 32 4.1
gi|37535894|ref|NP_922249.1| putative vesicle-associated membran... 32 4.1
gi|1373355|gb|AAB02249.1| major sperm protein 32 4.1
gi|39591543|emb|CAE71119.1| Hypothetical protein CBG17972 [Caeno... 32 4.1
gi|23509599|ref|NP_702266.1| vesicle-associated membrane protein... 32 4.1
gi|37588848|ref|NP_003565.3| vesicle-associated membrane protein... 31 5.4
gi|23105402|ref|ZP_00091858.1| COG0845: Membrane-fusion protein ... 31 5.4
gi|50540158|ref|NP_001002546.1| zgc:92788 [Danio rerio] >gnl|BL_... 31 5.4
gi|81710|pir||PS0427 napin AH1 precursor - radish (fragment) >gn... 31 5.4
gi|29841172|gb|AAP06185.1| similar to GenBank Accession Number U... 31 5.4
gi|8099350|gb|AAF72105.1| 33 kDa Vamp-associated protein [Homo s... 31 5.4
gi|3320446|gb|AAC26508.1| VAMP-associated protein of 33 kDa [Hom... 31 5.4
gi|37588850|ref|NP_919415.1| vesicle-associated membrane protein... 31 5.4
gi|47228471|emb|CAG05291.1| unnamed protein product [Tetraodon n... 31 7.0
gi|1373359|gb|AAB02251.1| major sperm protein 31 7.0
gi|29375966|ref|NP_815120.1| molybdenum ABC transporter, ATP-bin... 31 7.0
gi|7305623|ref|NP_038961.1| vesicle-associated membrane protein,... 31 7.0
gi|6671046|gb|AAF23076.1| VAMP-associated protein 33a [Mus muscu... 31 7.0
gi|1373357|gb|AAB02250.1| major sperm protein 31 7.0
gi|33300172|emb|CAE17819.1| Hypothetical protein F52F12.8 [Caeno... 31 7.0
gi|16944521|emb|CAB97476.2| conserved hypothetical protein [Neur... 30 9.2
gi|39595110|emb|CAE60147.1| Hypothetical protein CBG03696 [Caeno... 30 9.2
gi|11359537|pir||T51023 hypothetical protein B7F21.40 [imported]... 30 9.2
gi|13928870|ref|NP_113819.1| vesicle-associated membrane protein... 30 9.2
gi|38197359|gb|AAH61875.1| Unknown (protein for MGC:72396) [Ratt... 30 9.2
gi|39595208|emb|CAE60245.1| Hypothetical protein CBG03818 [Caeno... 30 9.2
>gi|17508751|ref|NP_491000.1| Sperm-Specific family, class P SSP-19,
MSP-domain protein like family member (11.0 kD) (ssp-19)
[Caenorhabditis elegans]
gi|7497991|pir||T15224 hypothetical protein C55C2.2 -
Caenorhabditis elegans
gi|40889683|pdb|1ROW|A Chain A, Structure Of Ssp-19, An Msp-Domain
Protein Like Family Member In Caenorhabditis Elegans
gi|40889684|pdb|1ROW|B Chain B, Structure Of Ssp-19, An Msp-Domain
Protein Like Family Member In Caenorhabditis Elegans
gi|2088756|gb|AAB54194.1| Sperm-specific family, class p protein 19
[Caenorhabditis elegans]
Length = 109
Score = 172 bits (436), Expect = 1e-42
Identities = 88/109 (80%), Positives = 88/109 (80%)
Frame = +1
Query: 1 MSLTADPPACTVPAAGVSSTHKLVNGGAEKIVFKIKSSNNNEYRIAPVFGFVDPSGSKDV 180
MSLTADPPACTVPAAGVSSTHKLVNGGAEKIVFKIKSSNNNEYRIAPVFGFVDPSGSKDV
Sbjct: 1 MSLTADPPACTVPAAGVSSTHKLVNGGAEKIVFKIKSSNNNEYRIAPVFGFVDPSGSKDV 60
Query: 181 VITRTAGAPKEDKLVVHXXXXXXXXXXXXXXXXXXXXXGTVTIPMSATA 327
VITRTAGAPKEDKLVVH GTVTIPMSATA
Sbjct: 61 VITRTAGAPKEDKLVVHFASAPADATDAQAAFVAVAPAGTVTIPMSATA 109