Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C55C2_3
         (330 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17508751|ref|NP_491000.1| Sperm-Specific family, class P SSP-...   172   1e-42
gi|17542088|ref|NP_501767.1| MSP-domain protein like family memb...   168   2e-41
gi|17542086|ref|NP_500697.1| Sperm-Specific family, class P SSP-...   167   5e-41
gi|17508749|ref|NP_491762.1| Sperm-Specific family, class P SSP-...   165   2e-40
gi|39596794|emb|CAE59021.1| Hypothetical protein CBG02298 [Caeno...   162   2e-39
gi|17540424|ref|NP_501808.1| MSP-domain protein like family memb...   161   3e-39
gi|39591169|emb|CAE73222.1| Hypothetical protein CBG20628 [Caeno...   160   8e-39
gi|39582951|emb|CAE73016.1| Hypothetical protein CBG20377 [Caeno...   160   8e-39
gi|39591164|emb|CAE73217.1| Hypothetical protein CBG20623 [Caeno...   159   1e-38
gi|39594026|emb|CAE70136.1| Hypothetical protein CBG16598 [Caeno...   157   5e-38
gi|39592311|emb|CAE63388.1| Hypothetical protein CBG07809 [Caeno...   117   7e-26
gi|39595357|emb|CAE60394.1| Hypothetical protein CBG03996 [Caeno...   109   1e-23
gi|50511753|gb|AAT77426.1| MSP-domain protein 1 variant [Ascaris...    98   5e-20
gi|50511751|gb|AAT77425.1| MSP-domain protein 1 variant [Ascaris...    98   5e-20
gi|50511755|gb|AAT77427.1| MSP-domain protein 1 variant [Ascaris...    98   5e-20
gi|50511745|gb|AAT77422.1| MSP-domain protein 1 variant [Ascaris...    98   5e-20
gi|49121580|gb|AAN08879.2| MSP-domain protein 1 [Ascaris suum]         98   5e-20
gi|50511749|gb|AAT77424.1| MSP-domain protein 1 variant [Ascaris...    97   6e-20
gi|33114622|gb|AAP94884.1| MFP1-alpha [Ascaris suum]                   96   1e-19
gi|33114624|gb|AAP94885.1| MFP1-beta [Ascaris suum]                    96   2e-19
gi|17560900|ref|NP_506264.1| predicted CDS, MSP-domain protein 1...    89   4e-19
gi|39591509|emb|CAE73563.1| Hypothetical protein CBG21033 [Caeno...    91   7e-18
gi|17562962|ref|NP_506630.1| MSP-domain protein like family memb...    86   1e-16
gi|17509493|ref|NP_493185.1| MSP-domain protein 1 like precursor...    82   3e-15
gi|17508753|ref|NP_493318.1| Sperm-Specific family, class P SSP-...    81   5e-15
gi|17561434|ref|NP_506076.1| major sperm protein, member of a la...    81   5e-15
gi|17544490|ref|NP_501989.1| MSP-domain protein like family memb...    79   2e-14
gi|34810947|pdb|1M1S|A Chain A, Structure Of Wr4, A C.Elegans Ms...    79   2e-14
gi|39592211|emb|CAE75432.1| Hypothetical protein CBG23425 [Caeno...    77   7e-14
gi|17542418|ref|NP_501739.1| MSP-domain protein like family memb...    77   1e-13
gi|17542092|ref|NP_501782.1| Sperm-Specific family, class P SSP-...    75   3e-13
gi|17539024|ref|NP_501124.1| major sperm protein with N myristoy...    73   1e-12
gi|39581884|emb|CAE60778.1| Hypothetical protein CBG04467 [Caeno...    72   2e-12
gi|39589662|emb|CAE66897.1| Hypothetical protein CBG12279 [Caeno...    71   6e-12
gi|39593130|emb|CAE64599.1| Hypothetical protein CBG09354 [Caeno...    69   3e-11
gi|17542720|ref|NP_501825.1| putative protein family member (4K8...    68   5e-11
gi|17538125|ref|NP_496079.1| predicted CDS, MSP-domain protein l...    67   7e-11
gi|17538127|ref|NP_496078.1| predicted CDS, MSP-domain protein l...    67   1e-10
gi|17562648|ref|NP_504485.1| MSP-domain protein like family memb...    64   6e-10
gi|23169000|gb|AAN08881.1| MSP-domain protein 3 [Ascaris suum] >...    61   5e-09
gi|39594899|emb|CAE70767.1| Hypothetical protein CBG17518 [Caeno...    58   4e-08
gi|39586995|emb|CAE62930.1| Hypothetical protein CBG07136 [Caeno...    58   5e-08
gi|39595447|emb|CAE60485.1| Hypothetical protein CBG04099 [Caeno...    56   2e-07
gi|39591787|emb|CAE71365.1| Hypothetical protein CBG18269 [Caeno...    55   3e-07
gi|17568285|ref|NP_509840.1| predicted CDS, MSP-domain protein l...    55   3e-07
gi|17505881|ref|NP_492824.1| vamp-associated protein like family...    53   2e-06
gi|17560600|ref|NP_507182.1| MSP-domain protein like family memb...    52   2e-06
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb...    52   3e-06
gi|17554100|ref|NP_499837.1| predicted CDS, major sperm protein ...    52   4e-06
gi|17560040|ref|NP_507098.1| MSP-domain protein like family memb...    51   7e-06
gi|17558194|ref|NP_506702.1| MSP-domain protein like family memb...    50   1e-05
gi|17558208|ref|NP_506700.1| MSP-domain protein like family memb...    50   1e-05
gi|17563008|ref|NP_506815.1| predicted CDS, major sperm protein ...    49   2e-05
gi|17507523|ref|NP_492407.1| MSP-domain protein like family memb...    49   3e-05
gi|39589763|emb|CAE66998.1| Hypothetical protein CBG12397 [Caeno...    49   3e-05
gi|39586114|emb|CAE69190.1| Hypothetical protein CBG15225 [Caeno...    49   3e-05
gi|23169006|gb|AAN08882.1| MSP-domain protein 4 [Ascaris suum] >...    47   7e-05
gi|39594090|emb|CAE70200.1| Hypothetical protein CBG16675 [Caeno...    47   7e-05
gi|7496307|pir||T15562 hypothetical protein C18F10.2 - Caenorhab...    47   9e-05
gi|25152845|ref|NP_741183.1| predicted CDS, major sperm protein ...    47   9e-05
gi|17552806|ref|NP_498780.1| MSP-domain protein like family memb...    47   9e-05
gi|17509511|ref|NP_491051.1| MSP-domain protein like family memb...    47   1e-04
gi|17557470|ref|NP_506723.1| MSP-domain protein like family memb...    45   5e-04
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno...    43   0.001
gi|17558192|ref|NP_506701.1| MSP-domain protein like family memb...    43   0.002
gi|17540380|ref|NP_501472.1| MSP-domain protein like family memb...    42   0.002
gi|39589204|emb|CAE57937.1| Hypothetical protein CBG00991 [Caeno...    42   0.004
gi|17559594|ref|NP_507136.1| MSP-domain protein like (32.2 kD) (...    41   0.005
gi|23169009|gb|AAN08883.1| MSP-domain protein 5 [Ascaris suum] >...    41   0.007
gi|7503488|pir||T22235 hypothetical protein F45G2.3 - Caenorhabd...    40   0.012
gi|39579370|emb|CAE56171.1| Hypothetical protein CBG23791 [Caeno...    40   0.012
gi|38083597|ref|XP_128948.2| RIKEN cDNA 2010013H21 [Mus musculus]      39   0.034
gi|12842294|dbj|BAB25547.1| unnamed protein product [Mus musculus]     39   0.034
gi|26345712|dbj|BAC36507.1| unnamed protein product [Mus musculus]     39   0.034
gi|39593527|emb|CAE61819.1| Hypothetical protein CBG05789 [Caeno...    38   0.058
gi|17541248|ref|NP_501765.1| predicted CDS, MSP-domain protein l...    37   0.075
gi|33239571|ref|NP_874513.1| Aspartate oxidase [Prochlorococcus ...    36   0.17
gi|11288307|pir||JC7234 27k vesicle-associated membrane protein-...    36   0.17
gi|15224067|ref|NP_179963.1| vesicle-associated membrane protein...    34   0.64
gi|39582088|emb|CAE63731.1| Hypothetical protein CBG08258 [Caeno...    34   0.64
gi|23168994|gb|AAN08880.1| MSP-domain protein 2 [Ascaris suum] >...    34   0.64
gi|37805852|dbj|BAC99503.1| putative vesicle-associated membrane...    34   0.83
gi|39583643|emb|CAE65747.1| Hypothetical protein CBG10833 [Caeno...    34   0.83
gi|47226997|emb|CAG05889.1| unnamed protein product [Tetraodon n...    33   1.1
gi|32471829|ref|NP_864823.1| conserved hypothetical protein [Pir...    33   1.1
gi|39583249|emb|CAE60041.1| Hypothetical protein CBG03552 [Caeno...    33   1.1
gi|27674169|ref|XP_228394.1| similar to vessicle-associated memb...    33   1.1
gi|17542484|ref|NP_502216.1| MSP-domain protein 2 like family me...    33   1.4
gi|10957459|ref|NP_051603.1| extracellular nuclease, putative [D...    33   1.4
gi|23483569|gb|EAA19198.1| hypothetical protein [Plasmodium yoel...    33   1.9
gi|17505564|ref|NP_491434.1| MSP-domain protein like (19.5 kD) (...    33   1.9
gi|31209289|ref|XP_313611.1| ENSANGP00000003574 [Anopheles gambi...    33   1.9
gi|34907216|ref|NP_914955.1| P0504E02.2 [Oryza sativa (japonica ...    32   3.2
gi|33860660|ref|NP_892221.1| L-aspartate oxidase [Prochlorococcu...    32   3.2
gi|17544558|ref|NP_500774.1| MSP-domain protein 2 like family me...    32   4.1
gi|47223045|emb|CAG07132.1| unnamed protein product [Tetraodon n...    32   4.1
gi|37535894|ref|NP_922249.1| putative vesicle-associated membran...    32   4.1
gi|1373355|gb|AAB02249.1| major sperm protein                          32   4.1
gi|39591543|emb|CAE71119.1| Hypothetical protein CBG17972 [Caeno...    32   4.1
gi|23509599|ref|NP_702266.1| vesicle-associated membrane protein...    32   4.1
gi|37588848|ref|NP_003565.3| vesicle-associated membrane protein...    31   5.4
gi|23105402|ref|ZP_00091858.1| COG0845: Membrane-fusion protein ...    31   5.4
gi|50540158|ref|NP_001002546.1| zgc:92788 [Danio rerio] >gnl|BL_...    31   5.4
gi|81710|pir||PS0427 napin AH1 precursor - radish (fragment) >gn...    31   5.4
gi|29841172|gb|AAP06185.1| similar to GenBank Accession Number U...    31   5.4
gi|8099350|gb|AAF72105.1| 33 kDa Vamp-associated protein [Homo s...    31   5.4
gi|3320446|gb|AAC26508.1| VAMP-associated protein of 33 kDa [Hom...    31   5.4
gi|37588850|ref|NP_919415.1| vesicle-associated membrane protein...    31   5.4
gi|47228471|emb|CAG05291.1| unnamed protein product [Tetraodon n...    31   7.0
gi|1373359|gb|AAB02251.1| major sperm protein                          31   7.0
gi|29375966|ref|NP_815120.1| molybdenum ABC transporter, ATP-bin...    31   7.0
gi|7305623|ref|NP_038961.1| vesicle-associated membrane protein,...    31   7.0
gi|6671046|gb|AAF23076.1| VAMP-associated protein 33a [Mus muscu...    31   7.0
gi|1373357|gb|AAB02250.1| major sperm protein                          31   7.0
gi|33300172|emb|CAE17819.1| Hypothetical protein F52F12.8 [Caeno...    31   7.0
gi|16944521|emb|CAB97476.2| conserved hypothetical protein [Neur...    30   9.2
gi|39595110|emb|CAE60147.1| Hypothetical protein CBG03696 [Caeno...    30   9.2
gi|11359537|pir||T51023 hypothetical protein B7F21.40 [imported]...    30   9.2
gi|13928870|ref|NP_113819.1| vesicle-associated membrane protein...    30   9.2
gi|38197359|gb|AAH61875.1| Unknown (protein for MGC:72396) [Ratt...    30   9.2
gi|39595208|emb|CAE60245.1| Hypothetical protein CBG03818 [Caeno...    30   9.2


>gi|17508751|ref|NP_491000.1| Sperm-Specific family, class P SSP-19,
           MSP-domain protein like family member (11.0 kD) (ssp-19)
           [Caenorhabditis elegans]
 gi|7497991|pir||T15224 hypothetical protein C55C2.2 -
           Caenorhabditis elegans
 gi|40889683|pdb|1ROW|A Chain A, Structure Of Ssp-19, An Msp-Domain
           Protein Like Family Member In Caenorhabditis Elegans
 gi|40889684|pdb|1ROW|B Chain B, Structure Of Ssp-19, An Msp-Domain
           Protein Like Family Member In Caenorhabditis Elegans
 gi|2088756|gb|AAB54194.1| Sperm-specific family, class p protein 19
           [Caenorhabditis elegans]
          Length = 109

 Score =  172 bits (436), Expect = 1e-42
 Identities = 88/109 (80%), Positives = 88/109 (80%)
 Frame = +1

Query: 1   MSLTADPPACTVPAAGVSSTHKLVNGGAEKIVFKIKSSNNNEYRIAPVFGFVDPSGSKDV 180
           MSLTADPPACTVPAAGVSSTHKLVNGGAEKIVFKIKSSNNNEYRIAPVFGFVDPSGSKDV
Sbjct: 1   MSLTADPPACTVPAAGVSSTHKLVNGGAEKIVFKIKSSNNNEYRIAPVFGFVDPSGSKDV 60

Query: 181 VITRTAGAPKEDKLVVHXXXXXXXXXXXXXXXXXXXXXGTVTIPMSATA 327
           VITRTAGAPKEDKLVVH                     GTVTIPMSATA
Sbjct: 61  VITRTAGAPKEDKLVVHFASAPADATDAQAAFVAVAPAGTVTIPMSATA 109




[DB home][top]