Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C56C10_6
(486 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532573|ref|NP_495336.1| transcription factor btf3 (17.5 kD)... 319 1e-86
gi|39583127|emb|CAE60667.1| Hypothetical protein CBG04320 [Caeno... 318 3e-86
gi|37654886|gb|AAP33157.1| beta-NAC-like protein [Reticulitermes... 201 4e-51
gi|41152344|ref|NP_956988.1| hypothetical protein MGC73053 [Dani... 197 5e-50
gi|41107484|ref|XP_372779.1| similar to RIKEN cDNA 5730434I03 ge... 196 1e-49
gi|50751600|ref|XP_422472.1| PREDICTED: similar to RIKEN cDNA 46... 196 1e-49
gi|29789195|ref|NP_081729.1| RIKEN cDNA 4632412E09 [Mus musculus... 196 1e-49
gi|28174932|gb|AAH24612.2| RIKEN cDNA 5730434I03 gene [Mus muscu... 196 1e-49
gi|34870312|ref|XP_345562.1| similar to RIKEN cDNA 5730434I03 ge... 196 1e-49
gi|34876809|ref|XP_223330.2| similar to RIKEN cDNA 5730434I03 ge... 194 5e-49
gi|47213889|emb|CAF95831.1| unnamed protein product [Tetraodon n... 191 4e-48
gi|37779006|gb|AAP20163.1| BTF3a [Pagrus major] 191 5e-48
gi|17136698|ref|NP_476853.1| CG3644-PA [Drosophila melanogaster]... 190 9e-48
gi|107909|pir||JC1235 transcription factor BTF3a - human 190 1e-47
gi|115143|sp|P20290|BTF3_HUMAN Transcription factor BTF3 (RNA po... 190 1e-47
gi|39795650|gb|AAH64010.1| Unknown (protein for MGC:70076) [Mus ... 190 1e-47
gi|2851417|sp|Q64152|BTF3_MOUSE Transcription factor BTF3 (RNA p... 190 1e-47
gi|30585147|gb|AAP36846.1| Homo sapiens basic transcription fact... 190 1e-47
gi|20070130|ref|NP_001198.2| basic transcription factor 3; nasce... 190 1e-47
gi|5679035|gb|AAD46830.1| BcDNA.GM05329 [Drosophila melanogaster] 190 1e-47
gi|47228379|emb|CAG05199.1| unnamed protein product [Tetraodon n... 189 3e-47
gi|34881037|ref|XP_222967.2| similar to Transcription factor BTF... 187 1e-46
gi|38048339|gb|AAR10072.1| similar to Drosophila melanogaster bi... 185 3e-46
gi|34867805|ref|XP_235543.2| similar to Transcription factor BTF... 181 5e-45
gi|24580667|ref|NP_608532.1| CG11835-PA [Drosophila melanogaster... 181 7e-45
gi|46255705|gb|AAH21004.1| MGC23908 protein [Homo sapiens] 179 3e-44
gi|31218306|ref|XP_316643.1| ENSANGP00000011509 [Anopheles gambi... 177 1e-43
gi|28189635|dbj|BAC56432.1| similar to basic transcription facto... 174 5e-43
gi|50795963|ref|XP_423823.1| PREDICTED: similar to Transcription... 172 2e-42
gi|34862114|ref|XP_345008.1| similar to Transcription factor BTF... 171 4e-42
gi|38086768|ref|XP_147004.2| similar to Transcription factor BTF... 168 4e-41
gi|34871534|ref|XP_220529.2| similar to Transcription factor BTF... 168 5e-41
gi|33348814|gb|AAQ16107.1| RNA polymerase B transcription factor... 165 3e-40
gi|34868217|ref|XP_235669.2| similar to Transcription factor BTF... 162 3e-39
gi|2493360|sp|Q13892|BT33_HUMAN Transcription factor BTF3 homolo... 161 4e-39
gi|37539783|ref|XP_067904.6| similar to Transcription factor BTF... 161 4e-39
gi|37551195|ref|XP_293984.2| similar to Transcription factor BTF... 158 4e-38
gi|38100329|gb|EAA47470.1| hypothetical protein MG02713.4 [Magna... 152 2e-36
gi|38088053|ref|XP_357814.1| similar to Transcription factor BTF... 152 2e-36
gi|32420281|ref|XP_330584.1| hypothetical protein [Neurospora cr... 151 6e-36
gi|50800251|ref|XP_428462.1| PREDICTED: similar to basic transcr... 149 2e-35
gi|49128986|ref|XP_412883.1| hypothetical protein AN8746.2 [Aspe... 148 4e-35
gi|34851270|ref|XP_226217.2| similar to Transcription factor BTF... 147 6e-35
gi|24431603|gb|AAN61483.1| Putative transcription factor [Oryza ... 142 3e-33
gi|29367567|gb|AAO72645.1| putative transcription factor BTF3 [O... 142 3e-33
gi|15220876|ref|NP_173230.1| nascent polypeptide-associated comp... 142 4e-33
gi|37535464|ref|NP_922034.1| putative transcription factor [Oryz... 142 4e-33
gi|49616929|gb|AAT67244.1| BTF3b-like transcription factor [Musa... 141 5e-33
gi|16323127|gb|AAL15298.1| At1g17880/F2H15_10 [Arabidopsis thali... 141 6e-33
gi|49072811|ref|XP_400689.1| hypothetical protein UM03074.1 [Ust... 141 6e-33
gi|27573340|gb|AAO20058.1| putative transcription factor [Oryza ... 141 6e-33
gi|46128595|ref|XP_388851.1| conserved hypothetical protein [Gib... 139 2e-32
gi|33945882|emb|CAE45592.1| transcription factor homolog BTF3-li... 139 2e-32
gi|50255097|gb|EAL17836.1| hypothetical protein CNBL0980 [Crypto... 139 2e-32
gi|15219413|ref|NP_177466.1| nascent polypeptide-associated comp... 137 7e-32
gi|21537065|gb|AAM61406.1| putative transcription factor BTF3 (R... 137 7e-32
gi|19115669|ref|NP_594757.1| transcription factor btf3 homolog [... 136 1e-31
gi|7441987|pir||S71926 transcription factor BTF3 homolog - fissi... 134 1e-30
gi|38085069|ref|XP_357661.1| similar to Transcription factor BTF... 128 4e-29
gi|34876263|ref|XP_223191.2| similar to Transcription factor BTF... 121 5e-27
gi|50787719|emb|CAH04413.1| transcription factor BTF3 [Euplotes ... 121 7e-27
gi|29367579|gb|AAO72651.1| putative transcription factor BTF3 [O... 120 1e-26
gi|25956272|dbj|BAC41326.1| unnamed protein product [Lotus corni... 118 6e-26
gi|38074680|ref|XP_357189.1| similar to Transcription factor BTF... 117 9e-26
gi|38049505|ref|XP_136621.2| similar to Transcription factor BTF... 116 2e-25
gi|41133997|ref|XP_371577.1| similar to RNA polymerase B transcr... 115 3e-25
gi|2982299|gb|AAC32135.1| transcription factor BTF3 homolog [Pic... 115 3e-25
gi|7441988|pir||T16984 transcription factor homolog BTF3 - curle... 115 5e-25
gi|47182319|emb|CAG14893.1| unnamed protein product [Tetraodon n... 114 1e-24
gi|50555502|ref|XP_505159.1| hypothetical protein [Yarrowia lipo... 113 2e-24
gi|4502467|ref|NP_001199.1| basic transcription factor 3, like 1... 112 4e-24
gi|457436|gb|AAA58398.1| basic transcription factor 3a 101 7e-21
gi|34881795|ref|XP_346365.1| similar to Transcription factor BTF... 95 7e-19
gi|34881775|ref|XP_346361.1| similar to Transcription factor BTF... 95 7e-19
gi|6325220|ref|NP_015288.1| Subunit beta1 of the nascent polypep... 94 9e-19
gi|50424465|ref|XP_460820.1| unnamed protein product [Debaryomyc... 94 1e-18
gi|50293803|ref|XP_449313.1| unnamed protein product [Candida gl... 92 4e-18
gi|32398823|emb|CAD98533.1| conserved NAC domain protein [Crypto... 89 3e-17
gi|37548552|ref|XP_291533.2| similar to basic transcription fact... 89 3e-17
gi|38541684|gb|AAH62736.1| Unknown (protein for MGC:72084) [Homo... 89 3e-17
gi|50307229|ref|XP_453593.1| unnamed protein product [Kluyveromy... 89 4e-17
gi|34853617|ref|XP_344809.1| similar to Transcription factor BTF... 86 3e-16
gi|45200852|ref|NP_986422.1| AGL245Cp [Eremothecium gossypii] >g... 86 3e-16
gi|46434487|gb|EAK93895.1| hypothetical protein CaO19.1154 [Cand... 85 7e-16
gi|30387828|gb|AAP32026.1| transcription factor [Mus sp.] 84 1e-15
gi|23480612|gb|EAA17125.1| basic transcription factor 3, putativ... 71 1e-11
gi|23509463|ref|NP_702130.1| basic transcription factor 3b, puta... 69 4e-11
gi|6320458|ref|NP_010538.1| beta subunit of the nascent-polypept... 67 2e-10
gi|24641982|ref|NP_572960.1| CG18313-PA [Drosophila melanogaster... 59 3e-08
gi|28317307|gb|AAO39650.1| AT11810p [Drosophila melanogaster] 59 3e-08
gi|45549389|ref|NP_572938.2| CG13402-PA [Drosophila melanogaster... 58 7e-08
gi|604498|gb|AAA57518.1| transcription factor >gnl|BL_ORD_ID|520... 56 3e-07
gi|38090351|ref|XP_357992.1| similar to Transcription factor BTF... 56 3e-07
gi|171444|gb|AAB63973.1| GAL4 DNA-binding enhancer protein [Sacc... 56 3e-07
gi|2493359|sp|Q13891|BT32_HUMAN Transcription factor BTF3 homolo... 56 3e-07
gi|24641980|ref|NP_727779.1| CG32601-PA [Drosophila melanogaster... 55 4e-07
gi|24641978|ref|NP_727778.1| CG32598-PA [Drosophila melanogaster... 55 4e-07
gi|24641976|ref|NP_727777.1| CG18157-PA [Drosophila melanogaster... 54 1e-06
gi|19527975|gb|AAL90102.1| AT18706p [Drosophila melanogaster] 53 2e-06
gi|32408669|ref|XP_324815.1| predicted protein [Neurospora crass... 47 2e-04
gi|24639647|ref|NP_726915.1| CG32774-PA [Drosophila melanogaster... 42 0.005
gi|6324372|ref|NP_014442.1| Anchorage subunit of a-agglutinin of... 41 0.009
gi|46128365|ref|XP_388736.1| hypothetical protein FG08560.1 [Gib... 41 0.009
gi|21392094|gb|AAM48401.1| RE16762p [Drosophila melanogaster] 41 0.011
gi|17137194|ref|NP_477159.1| CG3373-PA [Drosophila melanogaster]... 41 0.011
gi|38260630|gb|AAR15447.1| pollen coat oleosin-glycine rich prot... 41 0.011
gi|28829317|gb|AAO51859.1| similar to Homo sapiens (Human). Muci... 40 0.019
gi|44917423|tpg|DAA02048.1| TPA: GRP21 [Arabidopsis thaliana] 40 0.025
gi|25408663|pir||H84824 En/Spm-like transposon protein [imported... 39 0.033
gi|42569785|ref|NP_181536.3| expressed protein [Arabidopsis thal... 39 0.033
gi|6912512|ref|NP_036462.1| MYST histone acetyltransferase (mono... 39 0.043
gi|50548263|ref|XP_501601.1| hypothetical protein [Yarrowia lipo... 39 0.056
gi|23271157|gb|AAH35206.1| Trp53bp1 protein [Mus musculus] 39 0.056
gi|15226430|ref|NP_179692.1| expressed protein [Arabidopsis thal... 38 0.073
gi|871782|gb|AAC37472.1| pEARLI 4 gene product 38 0.073
gi|50254943|gb|EAL17683.1| hypothetical protein CNBL1980 [Crypto... 38 0.073
gi|1280434|gb|AAC47118.1| hemomucin 38 0.073
gi|13095628|ref|NP_076543.1| glycoprotein gp80 [Bovine herpesvir... 38 0.095
gi|11346533|pir||T44657 protein GP80 [imported] - bovine herpesv... 38 0.095
gi|2136504|pir||I47141 gastric mucin (clone PGM-2A) - pig (fragm... 38 0.095
gi|46444936|gb|EAL04207.1| hypothetical protein CaO19.13280 [Can... 38 0.095
gi|50420489|ref|XP_458781.1| unnamed protein product [Debaryomyc... 37 0.12
gi|33326818|gb|AAQ08827.1| 17kDa proline rich protein [Grapevine... 37 0.12
gi|50294496|ref|XP_449659.1| unnamed protein product [Candida gl... 37 0.16
gi|48125535|ref|XP_396578.1| similar to ENSANGP00000022377 [Apis... 37 0.16
gi|18032212|gb|AAL56647.1| histone acetyltransferase MOZ2 [Homo ... 37 0.16
gi|50548703|ref|XP_501821.1| hypothetical protein [Yarrowia lipo... 37 0.21
gi|38260684|gb|AAR15498.1| pollen coat oleosin-glycine rich prot... 37 0.21
gi|134817|sp|P22698|SPG7_DICDI Spore germination protein 270-11 ... 37 0.21
gi|102060|pir||B41710 promastigote surface antigen P2 (clone 6.4... 37 0.21
gi|6322209|ref|NP_012284.1| GPI-anchored cell surface glycoprote... 36 0.28
gi|34852027|ref|NP_038763.2| transformation related protein 53 b... 36 0.28
gi|46124407|ref|XP_386757.1| hypothetical protein FG06581.1 [Gib... 36 0.28
gi|24418850|sp|Q63099|KCB2_RAT Potassium voltage-gated channel s... 36 0.28
gi|23508275|ref|NP_700944.1| hypothetical protein [Plasmodium fa... 36 0.28
gi|6322611|ref|NP_012685.1| Delayed Anaerobic Gene; Dan4p [Sacch... 36 0.28
gi|34334435|gb|AAQ64704.1| Hmu [Drosophila simulans] >gnl|BL_ORD... 36 0.36
gi|34334445|gb|AAQ64709.1| Hmu [Drosophila simulans] 36 0.36
gi|46124081|ref|XP_386594.1| hypothetical protein FG06418.1 [Gib... 36 0.36
gi|41529174|dbj|BAD08434.1| NFBD1 [Sus scrofa] 36 0.36
gi|34871209|ref|XP_233524.2| similar to claspin [Rattus norvegicus] 36 0.36
gi|10834955|ref|NP_066916.1| ICP4 protein [Gallid herpesvirus 3]... 36 0.36
gi|10834942|ref|NP_066903.1| ICP4 protein [Gallid herpesvirus 3]... 36 0.36
gi|34334441|gb|AAQ64707.1| Hmu [Drosophila simulans] 35 0.47
gi|32411841|ref|XP_326401.1| hypothetical protein [Neurospora cr... 35 0.47
gi|31231947|ref|XP_318620.1| ENSANGP00000020885 [Anopheles gambi... 35 0.61
gi|45515875|ref|ZP_00167429.1| COG3210: Large exoproteins involv... 35 0.61
gi|50259580|gb|EAL22253.1| hypothetical protein CNBC3910 [Crypto... 35 0.61
gi|35396780|gb|AAQ84896.1| protein kinase C 1 [Cryptococcus neof... 35 0.61
gi|39590271|emb|CAE66009.1| Hypothetical protein CBG11201 [Caeno... 35 0.61
gi|22788859|ref|NP_690573.1| hypothetical protein HZV_154 [Helio... 35 0.61
gi|17976864|emb|CAD19801.1| microtubule-associated protein EB1 [... 35 0.61
gi|50754045|ref|XP_414230.1| PREDICTED: similar to Alpha-fetopro... 35 0.61
gi|50748872|ref|XP_421438.1| PREDICTED: similar to RIKEN cDNA 36... 35 0.61
gi|40788244|dbj|BAA23701.2| KIAA0405 [Homo sapiens] 35 0.80
gi|34484404|gb|AAQ72824.1| CD45 [Ictalurus punctatus] 35 0.80
gi|7511463|pir||T15822 kinesin-like protein unc-104 - Caenorhabd... 35 0.80
gi|7019381|ref|NP_037363.1| fibronectin leucine rich transmembra... 35 0.80
gi|50750704|ref|XP_422104.1| PREDICTED: similar to KIAA1237 prot... 35 0.80
gi|38100265|gb|EAA47417.1| hypothetical protein MG02660.4 [Magna... 35 0.80
gi|17506453|ref|NP_491301.1| putative nuclear protein, with 2 co... 34 1.0
gi|50548805|ref|XP_501872.1| hypothetical protein [Yarrowia lipo... 34 1.0
gi|1709526|sp|P54674|P3K2_DICDI Phosphatidylinositol 3-kinase 2 ... 34 1.0
gi|38110218|gb|EAA55973.1| hypothetical protein MG01624.4 [Magna... 34 1.0
gi|38103378|gb|EAA50078.1| hypothetical protein MG03837.4 [Magna... 34 1.0
gi|28278650|gb|AAH44194.1| Wu:fi38g05 protein [Danio rerio] 34 1.0
gi|24762383|ref|NP_611824.1| CG12491-PA [Drosophila melanogaster... 34 1.0
gi|20128875|ref|NP_569927.1| CG14796-PA [Drosophila melanogaster... 34 1.0
gi|28828351|gb|AAL93018.2| similar to Staphylococcus epidermidis... 34 1.0
gi|49099452|ref|XP_410767.1| hypothetical protein AN6630.2 [Aspe... 34 1.0
gi|31200063|ref|XP_308979.1| ENSANGP00000020323 [Anopheles gambi... 34 1.0
gi|19115358|ref|NP_594446.1| hypothetical protein; extensin-like... 34 1.0
gi|7209719|dbj|BAA92310.1| This gene is isolated by means of dif... 34 1.0
gi|111978|pir||S24169 mucin - rat 34 1.0
gi|1632784|emb|CAA70166.1| Nascent polypeptide associated comple... 34 1.4
gi|19112069|ref|NP_595277.1| hypothetical protein; sequence orph... 34 1.4
gi|50545139|ref|XP_500107.1| hypothetical protein [Yarrowia lipo... 34 1.4
gi|38111359|gb|EAA56951.1| hypothetical protein MG07306.4 [Magna... 34 1.4
gi|50556110|ref|XP_505463.1| hypothetical protein [Yarrowia lipo... 34 1.4
gi|34809533|gb|AAQ82687.1| Epa5p [Candida glabrata] 34 1.4
gi|13365945|dbj|BAB39347.1| hypothetical protein [Macaca fascicu... 34 1.4
gi|49080710|ref|XP_403843.1| hypothetical protein UM06228.1 [Ust... 34 1.4
gi|543415|pir||PC2022 mucin like protein Muc2 precursor - rat (f... 34 1.4
gi|29374744|ref|NP_813896.1| cell wall surface anchor family pro... 34 1.4
gi|50418235|gb|AAH77301.1| Unknown (protein for MGC:80195) [Xeno... 34 1.4
gi|17507165|ref|NP_492992.1| putative protein family member (1M3... 33 1.8
gi|17137300|ref|NP_477216.1| CG8759-PB [Drosophila melanogaster]... 33 1.8
gi|12841566|dbj|BAB25259.1| unnamed protein product [Mus musculus] 33 1.8
gi|9629497|ref|NP_044727.1| polyprotein [Ryegrass mosaic virus] ... 33 1.8
gi|39584760|emb|CAE67655.1| Hypothetical protein CBG13218 [Caeno... 33 1.8
gi|47215388|emb|CAG02204.1| unnamed protein product [Tetraodon n... 33 1.8
gi|28211463|ref|NP_782407.1| ABC transporter ATP-binding protein... 33 1.8
gi|6273572|emb|CAB60143.1| spastin protein orthologue [Mus muscu... 33 1.8
gi|50257565|gb|EAL20270.1| hypothetical protein CNBF0820 [Crypto... 33 1.8
gi|27713427|gb|AAM98044.2| Uncoordinated protein 104, isoform b ... 33 1.8
gi|50550739|ref|XP_502842.1| hypothetical protein [Yarrowia lipo... 33 1.8
gi|39930369|ref|NP_058658.1| spastic paraplegia 4 homolog; spast... 33 1.8
gi|134469|sp|P13728|SGS3_DROYA Salivary glue protein SGS-3 precu... 33 1.8
gi|29249142|gb|EAA40660.1| GLP_456_56904_50284 [Giardia lamblia ... 33 1.8
gi|25154069|ref|NP_741019.1| kinesin-like protein, monomeric syn... 33 1.8
gi|22532964|gb|AAM98043.1| Uncoordinated protein 104, isoform a ... 33 1.8
gi|50403804|sp|Q9QYY8|SPAS_MOUSE Spastin >gnl|BL_ORD_ID|814654 g... 33 1.8
gi|549143|sp|P23678|U104_CAEEL Kinesin-like protein unc-104 (Unc... 33 1.8
gi|15618930|ref|NP_225216.1| CT863 hypothetical protein [Chlamyd... 33 1.8
gi|27468810|ref|NP_765447.1| transport protein [Staphylococcus e... 33 1.8
gi|39582857|emb|CAE71633.1| Hypothetical protein CBG18600 [Caeno... 33 1.8
gi|38048317|gb|AAR10061.1| similar to Drosophila melanogaster Na... 33 1.8
gi|24647644|ref|NP_650611.1| CG4090-PA [Drosophila melanogaster]... 33 2.3
gi|23128868|ref|ZP_00110706.1| COG0489: ATPases involved in chro... 33 2.3
gi|21240668|gb|AAM44379.1| hypothetical protein [Dictyostelium d... 33 2.3
gi|50553722|ref|XP_504272.1| hypothetical protein [Yarrowia lipo... 33 2.3
gi|45550830|ref|NP_651361.2| CG11856-PA [Drosophila melanogaster... 33 2.3
gi|31232507|ref|XP_318717.1| ENSANGP00000004655 [Anopheles gambi... 33 2.3
gi|50404489|gb|AAT76906.1| low molecular weight protein [Aegilop... 33 2.3
gi|49091078|ref|XP_407000.1| hypothetical protein AN2863.2 [Aspe... 33 2.3
gi|17561512|ref|NP_506158.1| predicted CDS, putative protein fam... 33 2.3
gi|16797906|gb|AAL29211.1| RUX [Drosophila orena] 33 2.3
gi|16799481|ref|NP_469749.1| similar to B. subtilis IolD protein... 33 2.3
gi|11875211|ref|NP_055761.2| spastin isoform 1 [Homo sapiens] >g... 33 2.3
gi|9967353|dbj|BAA22614.2| LMM glutenin 2 [Triticum aestivum] 33 2.3
gi|20152047|gb|AAM11383.1| LD43045p [Drosophila melanogaster] 33 2.3
gi|1857654|gb|AAB48476.1| low-molecular-weight glutenin storage ... 33 2.3
gi|34809534|gb|AAQ82688.1| Epa4p [Candida glabrata] 33 2.3
gi|121457|sp|P10386|GLTB_WHEAT Glutenin, low molecular weight su... 33 2.3
gi|40806170|ref|NP_955468.1| spastin isoform 2 [Homo sapiens] >g... 33 2.3
gi|38049342|ref|XP_136482.3| RIKEN cDNA 9630047L19 [Mus musculus] 33 2.3
gi|47717674|gb|AAT37863.1| low molecular weight glutenin subunit... 33 2.3
gi|23510008|ref|NP_702674.1| hypothetical protein [Plasmodium fa... 33 2.3
gi|15836553|ref|NP_301077.1| CT863 hypothetical protein [Chlamyd... 33 2.3
gi|1857658|gb|AAB48478.1| low-molecular-weight glutenin storage ... 33 2.3
gi|46139411|ref|XP_391396.1| hypothetical protein FG11220.1 [Gib... 33 3.0
gi|49094252|ref|XP_408587.1| hypothetical protein AN4450.2 [Aspe... 33 3.0
gi|31235957|ref|XP_319327.1| ENSANGP00000012379 [Anopheles gambi... 33 3.0
gi|32565102|ref|NP_492365.2| putative protein (1J317) [Caenorhab... 33 3.0
gi|50553840|ref|XP_504331.1| hypothetical protein [Yarrowia lipo... 33 3.0
gi|41146548|ref|XP_087386.5| HEG homolog [Homo sapiens] 33 3.0
gi|34501467|gb|AAK74120.3| mucin 16 [Homo sapiens] 33 3.0
gi|29347871|ref|NP_811374.1| putative outer membrane protein, pr... 33 3.0
gi|50550625|ref|XP_502785.1| hypothetical protein [Yarrowia lipo... 33 3.0
gi|32698795|ref|NP_872293.1| olfactomedin-like 2A [Homo sapiens]... 33 3.0
gi|15920886|ref|NP_376555.1| 461aa long conserved hypothetical p... 33 3.0
gi|50555151|ref|XP_504984.1| YlTSR1 [Yarrowia lipolytica] >gnl|B... 33 3.0
gi|7497110|pir||T19779 hypothetical protein C36B1.8 - Caenorhabd... 33 3.0
gi|17541474|ref|NP_502253.1| no mechanoreceptor potential A like... 33 3.0
gi|3309543|gb|AAC41377.1| MLL [Takifugu rubripes] 33 3.0
gi|37181482|gb|AAQ88552.1| olfactomedin-like [Homo sapiens] 33 3.0
gi|684940|gb|AAB54078.1| unknown 33 3.0
gi|41462393|ref|NP_958926.1| fibronectin leucine rich transmembr... 33 3.0
gi|34327974|dbj|BAA86551.2| KIAA1237 protein [Homo sapiens] 33 3.0
gi|21842106|gb|AAM77707.1| endoglucanase [Bionectria ochroleuca] 33 3.0
gi|24419041|gb|AAL65133.2| ovarian cancer related tumor marker C... 33 3.0
gi|2081630|gb|AAB54079.1| unknown [Dictyostelium discoideum] 33 3.0
gi|46125955|ref|XP_387531.1| hypothetical protein FG07355.1 [Gib... 33 3.0
gi|23491068|gb|EAA22696.1| CCAAT-box DNA binding protein subunit... 33 3.0
gi|32565104|ref|NP_871882.1| putative protein (1J317) [Caenorhab... 33 3.0
gi|38110219|gb|EAA55974.1| hypothetical protein MG01625.4 [Magna... 33 3.0
gi|50510475|dbj|BAD32223.1| mKIAA0405 protein [Mus musculus] 33 3.0
gi|34484388|gb|AAQ72816.1| CD45 [Ictalurus punctatus] 33 3.0
gi|50257986|gb|EAL20680.1| hypothetical protein CNBE0450 [Crypto... 33 3.0
gi|39583863|emb|CAE63953.1| Hypothetical protein CBG08535 [Caeno... 32 4.0
gi|49109753|ref|XP_411694.1| hypothetical protein AN7557.2 [Aspe... 32 4.0
gi|50512294|ref|NP_694514.2| myosin, heavy polypeptide 2, fast m... 32 4.0
gi|31238311|ref|XP_319745.1| ENSANGP00000006359 [Anopheles gambi... 32 4.0
gi|3395648|dbj|BAA32068.1| penicillin binding protein 1A [Strept... 32 4.0
gi|23953889|gb|AAN38984.1| LvsF [Dictyostelium discoideum] 32 4.0
gi|3395658|dbj|BAA32073.1| penicillin binding protein 1A [Strept... 32 4.0
gi|3395662|dbj|BAA32075.1| penicillin binding protein 1A [Strept... 32 4.0
gi|3395642|dbj|BAA32065.1| penicillin binding protein 1A [Strept... 32 4.0
gi|3395660|dbj|BAA32074.1| penicillin binding protein 1A [Strept... 32 4.0
gi|3395644|dbj|BAA32066.1| penicillin binding protein 1A [Strept... 32 4.0
gi|3395640|dbj|BAA32064.1| penicillin binding protein 1A [Strept... 32 4.0
gi|3395650|dbj|BAA32069.1| penicillin binding protein 1A [Strept... 32 4.0
gi|50303563|ref|XP_451723.1| unnamed protein product [Kluyveromy... 32 4.0
gi|46126681|ref|XP_387894.1| predicted protein [Gibberella zeae ... 32 4.0
gi|16758912|ref|NP_446452.1| potassium voltage gated channel, Sh... 32 4.0
gi|126169|sp|P14594|LEGB_PEA Legumin B [Contains: Legumin B alph... 32 4.0
gi|32264364|gb|AAP78680.1| MBCTL1 [Monosiga brevicollis] 32 4.0
gi|37360578|dbj|BAC98267.1| mKIAA1853 protein [Mus musculus] 32 4.0
gi|1888540|gb|AAC51340.1| CREB-binding protein [Homo sapiens] 32 4.0
gi|49087260|ref|XP_405586.1| hypothetical protein AN1449.2 [Aspe... 32 4.0
gi|4321116|gb|AAC51331.2| CREB-binding protein [Homo sapiens] 32 4.0
gi|4758056|ref|NP_004371.1| CREB binding protein [Homo sapiens] ... 32 4.0
gi|26185816|emb|CAD58619.1| low molecular weight glutenin subuni... 32 4.0
gi|28377069|ref|NP_783961.1| amino acid transport protein [Lacto... 32 4.0
gi|38141947|dbj|BAD00776.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|15900292|ref|NP_344896.1| penicillin-binding protein 1A [Stre... 32 4.0
gi|38141899|dbj|BAD00752.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|38141913|dbj|BAD00759.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|38141879|dbj|BAD00742.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|38141901|dbj|BAD00753.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|6563341|gb|AAF17257.1| penicillin-binding protein 1A [Strepto... 32 4.0
gi|46111035|ref|XP_382575.1| hypothetical protein FG02399.1 [Gib... 32 4.0
gi|282331|pir||S28037 penicillin-binding protein 1a - Streptococ... 32 4.0
gi|38141885|dbj|BAD00745.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|282329|pir||S28038 penicillin-binding protein 1a - Streptococ... 32 4.0
gi|38141889|dbj|BAD00747.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|38141881|dbj|BAD00743.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|15902373|ref|NP_357923.1| Penicillin-binding protein 1A [Stre... 32 4.0
gi|6563349|gb|AAF17261.1| penicillin-binding protein 1A [Strepto... 32 4.0
gi|38141903|dbj|BAD00754.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|5410465|gb|AAD43070.1| penicillin-binding protein 1a [Strepto... 32 4.0
gi|38141887|dbj|BAD00746.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|38141905|dbj|BAD00755.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|6563339|gb|AAF17256.1| penicillin-binding protein 1A [Strepto... 32 4.0
gi|38141955|dbj|BAD00780.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|38141877|dbj|BAD00741.1| penicillin-binding protein 1A [Strep... 32 4.0
gi|5410459|gb|AAD43067.1| penicillin-binding protein 1a [Strepto... 32 4.0
gi|6563351|gb|AAF17262.1| penicillin-binding protein 1A [Strepto... 32 4.0
gi|984229|emb|CAA88917.1| penicillin-binding protein 1a [Strepto... 32 4.0
gi|47216040|emb|CAG11371.1| unnamed protein product [Tetraodon n... 32 4.0
gi|49069688|ref|XP_399133.1| hypothetical protein UM01518.1 [Ust... 32 4.0
gi|7522104|pir||T31353 polyprotein - Arabidopsis arenosa Evelkni... 32 4.0
gi|50750387|ref|XP_421982.1| PREDICTED: similar to Oxysterol bin... 32 4.0
gi|3168627|gb|AAC17736.1| CBP [Homo sapiens] 32 4.0
gi|34856763|ref|XP_215530.2| similar to misshapen/NIK-related ki... 32 4.0
gi|30794434|ref|NP_081162.1| RIKEN cDNA 1500001A10 [Mus musculus... 32 4.0
gi|48101569|ref|XP_395162.1| similar to potassium channel modula... 32 4.0
gi|11385642|gb|AAG34902.1| CTCL tumor antigen se1-1 [Homo sapiens] 32 4.0
gi|46432987|gb|EAK92446.1| hypothetical protein CaO19.8926 [Cand... 32 4.0
gi|49073522|ref|XP_400973.1| hypothetical protein UM03358.1 [Ust... 32 5.2
gi|50510549|dbj|BAD32260.1| mKIAA0618 protein [Mus musculus] 32 5.2
gi|50548313|ref|XP_501626.1| hypothetical protein [Yarrowia lipo... 32 5.2
gi|25149875|ref|NP_493047.2| kinase suppressor of ras, Kinase Su... 32 5.2
gi|14285799|sp|P93119|TOP1_DAUCA DNA topoisomerase I >gnl|BL_ORD... 32 5.2
gi|39590335|emb|CAE66074.1| Hypothetical protein CBG11288 [Caeno... 32 5.2
gi|49093198|ref|XP_408060.1| hypothetical protein AN3923.2 [Aspe... 32 5.2
gi|46102694|ref|XP_380227.1| hypothetical protein FG00051.1 [Gib... 32 5.2
gi|49086652|ref|XP_405356.1| hypothetical protein AN1219.2 [Aspe... 32 5.2
gi|3395652|dbj|BAA32070.1| penicillin binding protein 1A [Strept... 32 5.2
gi|3395646|dbj|BAA32067.1| penicillin binding protein 1A [Strept... 32 5.2
gi|19571560|emb|CAD27470.1| SPAPB18E9.04c [Schizosaccharomyces p... 32 5.2
gi|25149878|ref|NP_493048.2| kinase suppressor of ras, Kinase Su... 32 5.2
gi|1129058|gb|AAB38549.1| surface antigen 2 32 5.2
gi|22507337|ref|NP_683734.1| nuclear pore membrane protein 121 [... 32 5.2
gi|17543310|ref|NP_500098.1| predicted CDS, putative nuclear pro... 32 5.2
gi|48871075|ref|ZP_00323791.1| COG1113: Gamma-aminobutyrate perm... 32 5.2
gi|38141895|dbj|BAD00750.1| penicillin-binding protein 1A [Strep... 32 5.2
gi|6563345|gb|AAF17259.1| penicillin-binding protein 1A [Strepto... 32 5.2
gi|282333|pir||S28032 penicillin-binding protein 1a - Streptococ... 32 5.2
gi|282332|pir||S28033 penicillin-binding protein 1a - Streptococ... 32 5.2
gi|38141939|dbj|BAD00772.1| penicillin-binding protein 1A [Strep... 32 5.2
gi|282327|pir||S28035 penicillin-binding protein 1A - Streptococ... 32 5.2
gi|47209808|emb|CAG12313.1| unnamed protein product [Tetraodon n... 32 5.2
gi|38303929|gb|AAH61959.1| Asxl1 protein [Danio rerio] 32 5.2
gi|17231318|ref|NP_487866.1| unknown protein [Nostoc sp. PCC 712... 32 5.2
gi|7512244|pir||S71754 cellular hepatitis A receptor HAVcr-1 pre... 32 5.2
gi|39580035|emb|CAE71561.1| Hypothetical protein CBG18510 [Caeno... 32 5.2
gi|21233458|ref|NP_639375.1| cation efflux system protein [Xanth... 32 5.2
gi|24651944|ref|NP_610437.1| CG8181-PA [Drosophila melanogaster]... 32 5.2
gi|23612734|ref|NP_704273.1| hypothetical protein [Plasmodium fa... 32 5.2
gi|41151658|ref|XP_291344.3| hypothetical protein FLJ12649 [Homo... 32 5.2
gi|42408245|dbj|BAD09402.1| unknown protein [Oryza sativa (japon... 32 5.2
gi|15673590|ref|NP_267764.1| gamma-glutamyl phosphate reductase ... 32 5.2
gi|28829783|gb|AAO52285.1| similar to Leishmania major. Ppg3 [Di... 32 5.2
gi|31418614|gb|AAH53101.1| Nuclear pore membrane protein 121 [Mu... 32 5.2
gi|50752592|ref|XP_422847.1| PREDICTED: similar to transcription... 32 5.2
gi|49069590|ref|XP_399084.1| hypothetical protein UM01469.1 [Ust... 32 5.2
gi|46441537|gb|EAL00833.1| hypothetical protein CaO19.14018 [Can... 32 5.2
gi|39595771|emb|CAE67274.1| Hypothetical protein CBG12722 [Caeno... 32 5.2
gi|16800212|ref|NP_470480.1| similar to acetaldehyde dehydrogena... 32 5.2
gi|102054|pir||A41710 promastigote surface antigen-2 precursor -... 32 5.2
gi|50308653|ref|XP_454329.1| unnamed protein product [Kluyveromy... 32 5.2
gi|45361653|ref|NP_989404.1| hypothetical protein MGC76086 [Xeno... 32 5.2
gi|47225332|emb|CAG09832.1| unnamed protein product [Tetraodon n... 32 6.8
gi|17567549|ref|NP_510546.1| prion-like Q/N-rich domain protein ... 32 6.8
gi|39590304|emb|CAE66043.1| Hypothetical protein CBG11242 [Caeno... 32 6.8
gi|48095179|ref|XP_392252.1| similar to ENSANGP00000002662 [Apis... 32 6.8
gi|973233|gb|AAB04147.1| coat/nuclear inclusion protein 32 6.8
gi|23613427|ref|NP_703271.1| hypothetical protein [Plasmodium fa... 32 6.8
gi|50255529|gb|EAL18264.1| hypothetical protein CNBK2820 [Crypto... 32 6.8
gi|50255758|gb|EAL18490.1| hypothetical protein CNBJ1320 [Crypto... 32 6.8
gi|6002055|emb|CAB56692.1| lipoxygenase [Arabidopsis thaliana] 32 6.8
gi|28564837|dbj|BAC57802.1| hypothetical protein [Oryza sativa (... 32 6.8
gi|48104064|ref|XP_395706.1| similar to ENSANGP00000011635 [Apis... 32 6.8
gi|17567553|ref|NP_510545.1| prion-like Q/N-rich domain protein ... 32 6.8
gi|45361361|ref|NP_989258.1| hypothetical protein MGC76113 [Xeno... 32 6.8
gi|34904264|ref|NP_913479.1| P0452F10.20 [Oryza sativa (japonica... 32 6.8
gi|18848286|gb|AAH24130.1| 1500001A10Rik protein [Mus musculus] 32 6.8
gi|47227876|emb|CAG09039.1| unnamed protein product [Tetraodon n... 32 6.8
gi|45725021|emb|CAG23924.1| eukaryotic initiation factor 4G [Sph... 32 6.8
gi|17221116|gb|AAK61485.1| glycoprotein gp2 [Equine herpesvirus 1] 32 6.8
gi|7512173|pir||T30336 nuclear/mitotic apparatus protein - Afric... 32 6.8
gi|7511432|pir||T21460 hypothetical protein ZK945.10 - Caenorhab... 32 6.8
gi|11278206|pir||T45463 membrane glycoprotein [imported] - equin... 32 6.8
gi|46433431|gb|EAK92871.1| hypothetical protein CaO19.8681 [Cand... 32 6.8
gi|46108322|ref|XP_381219.1| hypothetical protein FG01043.1 [Gib... 32 6.8
gi|24663552|ref|NP_648610.1| CG14120-PA [Drosophila melanogaster... 32 6.8
gi|17221100|gb|AAK61477.1| glycoprotein gp2 [Equine herpesvirus 1] 32 6.8
gi|16759929|ref|NP_455546.1| putative bacteriophage protein [Sal... 32 6.8
gi|49522237|gb|AAH75200.1| Unknown (protein for MGC:83433) [Xeno... 32 6.8
gi|17221112|gb|AAK61483.1| glycoprotein gp2 [Equine herpesvirus 1] 32 6.8
gi|42733990|gb|AAO52597.2| similar to Dictyostelium discoideum (... 32 6.8
gi|17221098|gb|AAK61476.1| glycoprotein gp2 [Equine herpesvirus 1] 32 6.8
gi|17535137|ref|NP_496184.1| location Of Vulva defective LOV-1, ... 32 6.8
gi|11278205|pir||T45462 membrane glycoprotein [imported] - equin... 32 6.8
gi|24286732|gb|AAN46886.1| nucleotide exchange factor RasGEF R [... 32 6.8
gi|39594745|emb|CAE70613.1| Hypothetical protein CBG17296 [Caeno... 32 6.8
gi|34334665|gb|AAQ64819.1| ref(2)P [Drosophila simulans] 32 6.8
gi|42795202|gb|AAS45959.1| envelope glycoprotein [Equine herpesv... 32 6.8
gi|46445626|gb|EAL04894.1| hypothetical protein CaO19.4906 [Cand... 32 6.8
gi|9802525|gb|AAF99727.1| F17L21.7 [Arabidopsis thaliana] 32 6.8
gi|24582451|ref|NP_609101.1| CG4496-PA [Drosophila melanogaster]... 32 6.8
gi|17567551|ref|NP_510547.1| prion-like Q/N-rich domain protein ... 32 6.8
gi|34880489|ref|XP_341133.1| similar to chromosome 1 open readin... 32 6.8
gi|17221102|gb|AAK61478.1| glycoprotein gp2 [Equine herpesvirus 1] 32 6.8
gi|19113482|ref|NP_596690.1| hypothetical serine-rich secreted p... 32 6.8
gi|32410025|ref|XP_325493.1| hypothetical protein [Neurospora cr... 32 6.8
gi|172043|gb|AAC15849.1| Egd2p [Saccharomyces cerevisiae] 32 6.8
gi|34861766|ref|XP_215127.2| similar to secreted gel-forming muc... 32 6.8
gi|32404922|ref|XP_323074.1| hypothetical protein [Neurospora cr... 32 6.8
gi|49073690|ref|XP_401041.1| hypothetical protein UM03426.1 [Ust... 32 6.8
gi|46445432|gb|EAL04701.1| hypothetical protein CaO19.12372 [Can... 32 6.8
gi|17221110|gb|AAK61482.1| glycoprotein gp2 [Equine herpesvirus 1] 32 6.8
gi|17221104|gb|AAK61479.1| glycoprotein gp2 [Equine herpesvirus 1] 32 6.8
gi|17221108|gb|AAK61481.1| glycoprotein gp2 [Equine herpesvirus 1] 32 6.8
gi|2134574|pir||I51920 mucin - rhesus macaque (fragment) >gnl|BL... 32 6.8
gi|48772790|gb|AAT46573.1| glycoprotein [Human metapneumovirus] 32 6.8
gi|6321987|ref|NP_012063.1| GAL4 enhancer protein, homolog of hu... 32 6.8
gi|25513574|pir||D89723 protein F39D8.1b [imported] - Caenorhabd... 32 6.8
gi|46124977|ref|XP_387042.1| hypothetical protein FG06866.1 [Gib... 32 6.8
gi|46204512|ref|ZP_00209445.1| COG1766: Flagellar biosynthesis/t... 32 6.8
gi|9629749|ref|NP_045241.1| 24 [Equine herpesvirus 4] >gnl|BL_OR... 32 6.8
gi|17221114|gb|AAK61484.1| glycoprotein gp2 [Equine herpesvirus 1] 32 6.8
gi|50313312|ref|YP_053115.1| membrane glycoprotein [Equine herpe... 32 6.8
gi|17221106|gb|AAK61480.1| glycoprotein gp2 [Equine herpesvirus 1] 32 6.8
gi|49121256|ref|XP_412404.1| hypothetical protein AN8267.2 [Aspe... 32 6.8
gi|33114033|gb|AAP94630.1| mucin-like protein [Schistosoma japon... 31 8.9
gi|41016075|dbj|BAD07398.1| KIAA0023 splice variant 1 [Homo sapi... 31 8.9
gi|465861|sp|P34735|YLU2_PICAN Hypothetical protein in LEU2 3're... 31 8.9
gi|47227634|emb|CAG09631.1| unnamed protein product [Tetraodon n... 31 8.9
gi|32452982|gb|AAP82644.1| Hypothetical protein R144.4a [Caenorh... 31 8.9
gi|25405837|pir||H96597 hypothetical protein T5A14.5 [imported] ... 31 8.9
gi|15644917|ref|NP_207087.1| toxin-like outer membrane protein [... 31 8.9
gi|47900682|gb|AAT39281.1| putative late blight resistance prote... 31 8.9
gi|32403604|ref|XP_322415.1| predicted protein [Neurospora crass... 31 8.9
gi|32699604|sp|Q9BQY9|CT35_HUMAN Protein C20orf35 (HSMNP1) 31 8.9
gi|42476066|ref|NP_963863.1| SMG-7 homolog isoform 4; ever short... 31 8.9
gi|50748358|ref|XP_421210.1| PREDICTED: similar to ras activator... 31 8.9
gi|45708765|gb|AAH36381.1| C1orf16 protein [Homo sapiens] 31 8.9
gi|39597165|emb|CAE59392.1| Hypothetical protein CBG02750 [Caeno... 31 8.9
gi|24580911|ref|NP_608614.1| CG17657-PA [Drosophila melanogaster... 31 8.9
gi|50259132|gb|EAL21809.1| hypothetical protein CNBC5110 [Crypto... 31 8.9
gi|2495725|sp|Q92540|Y250_HUMAN Hypothetical protein KIAA0250 31 8.9
gi|38607488|gb|AAR25620.1| breast cancer-associated antigen SGA-... 31 8.9
gi|50755982|ref|XP_414964.1| PREDICTED: similar to CREB-binding ... 31 8.9
gi|24643407|ref|NP_728307.1| CG11940-PB [Drosophila melanogaster... 31 8.9
gi|32765793|gb|AAP87371.1| low molecular weight glutenin subunit... 31 8.9
gi|27372209|dbj|BAC53622.1| SMG-7 transcript variant 2 [Homo sap... 31 8.9
gi|42476074|ref|NP_055652.3| SMG-7 homolog isoform 3; ever short... 31 8.9
gi|17425212|dbj|BAB78761.1| low-molecular-weight glutenin subuni... 31 8.9
gi|16117372|gb|AAL14422.1| ICP4 [Macropodid herpesvirus 1] 31 8.9
gi|50759712|ref|XP_417746.1| PREDICTED: similar to l(3)mbt-like ... 31 8.9
gi|28828802|gb|AAO51397.1| similar to Delayed Anaerobic Gene; Da... 31 8.9
gi|28828585|gb|AAO51188.1| similar to Dictyostelium discoideum (... 31 8.9
gi|7506732|pir||T16755 hypothetical protein R144.4 - Caenorhabdi... 31 8.9
gi|48096580|ref|XP_392487.1| similar to CG16879-PA [Apis mellifera] 31 8.9
gi|12313900|emb|CAC19685.1| dJ127C7.1 (KIAA0250 protein) [Homo s... 31 8.9
gi|24643405|ref|NP_608363.1| CG11940-PA [Drosophila melanogaster... 31 8.9
gi|28372531|ref|NP_777567.1| protein phosphatase 4, regulatory s... 31 8.9
gi|12654543|gb|AAH01105.1| C20orf35 protein [Homo sapiens] >gnl|... 31 8.9
gi|285957|dbj|BAA03515.1| KIAA0023 [Homo sapiens] 31 8.9
gi|7020690|dbj|BAA91235.1| unnamed protein product [Homo sapiens] 31 8.9
gi|42556325|gb|AAS19751.1| myosin heavy chain [Gasterosteus acul... 31 8.9
gi|42475558|ref|NP_775179.1| SMG-7 homolog isoform 1; ever short... 31 8.9
gi|17384256|emb|CAC83675.1| mucin 5 [Homo sapiens] 31 8.9
gi|27372208|dbj|BAC53621.1| SMG-7 [Homo sapiens] 31 8.9
gi|33946327|ref|NP_005076.3| nucleoporin 214kDa; nuclear pore co... 31 8.9
gi|548384|sp|P35658|N214_HUMAN Nuclear pore complex protein Nup2... 31 8.9
gi|33598950|ref|NP_005388.2| podocalyxin-like precursor [Homo sa... 31 8.9
gi|17557394|ref|NP_505253.1| predicted CDS, putative protein fam... 31 8.9
gi|25148488|ref|NP_741123.1| actin-binding WH2 (3G109) [Caenorha... 31 8.9
gi|542454|pir||S42787 serine/threonine-rich protein - fluke (Sch... 31 8.9
gi|31197645|ref|XP_307770.1| ENSANGP00000004103 [Anopheles gambi... 31 8.9
gi|32414523|ref|XP_327741.1| predicted protein [Neurospora crass... 31 8.9
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 31 8.9
gi|32421911|ref|XP_331399.1| predicted protein [Neurospora crass... 31 8.9
gi|49087870|ref|XP_405822.1| PHYB_EMENI 3-phytase B precursor (M... 31 8.9
gi|20521860|dbj|BAA13381.2| KIAA0250 [Homo sapiens] 31 8.9
gi|31874060|emb|CAD97946.1| hypothetical protein [Homo sapiens] 31 8.9
gi|50255317|gb|EAL18052.1| hypothetical protein CNBK0730 [Crypto... 31 8.9
gi|3914342|sp|O00093|PHYB_EMENI 3-phytase B precursor (Myo-inosi... 31 8.9
gi|28374141|gb|AAH45620.1| Similar to nucleoporin 214kDa [Homo s... 31 8.9
gi|30962840|gb|AAH52565.1| C1orf16 protein [Homo sapiens] 31 8.9
gi|42476070|ref|NP_963862.1| SMG-7 homolog isoform 2; ever short... 31 8.9
gi|23482935|gb|EAA18770.1| Kinesin motor domain, putative [Plasm... 31 8.9
>gi|17532573|ref|NP_495336.1| transcription factor btf3 (17.5 kD)
(2G878) [Caenorhabditis elegans]
gi|2493356|sp|Q18885|BTF3_CAEEL Transcription factor BTF3 homolog
gi|7441989|pir||T15847 hypothetical protein C56C10.8 -
Caenorhabditis elegans
gi|868246|gb|AAA68776.1| Hypothetical protein C56C10.8
[Caenorhabditis elegans]
Length = 161
Score = 319 bits (818), Expect = 1e-86
Identities = 161/161 (100%), Positives = 161/161 (100%)
Frame = -1
Query: 486 MDSKAIAERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPG 307
MDSKAIAERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPG
Sbjct: 1 MDSKAIAERIKKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPG 60
Query: 306 IEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHL 127
IEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHL
Sbjct: 61 IEEVNMIKDDGTVIHFNNPKVQTSVPANTFSVTGSADNKQITEMLPGILNQLGPESLTHL 120
Query: 126 KKLANNVTKLGPDGKGEDEDVPELVGDFDAASKNETKADEQ 4
KKLANNVTKLGPDGKGEDEDVPELVGDFDAASKNETKADEQ
Sbjct: 121 KKLANNVTKLGPDGKGEDEDVPELVGDFDAASKNETKADEQ 161