Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= D1007_10
(480 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17506331|ref|NP_491399.1| ribosomal Protein, Large subunit (1... 270 6e-72
gi|39589490|emb|CAE74519.1| Hypothetical protein CBG22273 [Caeno... 252 2e-66
gi|24266957|gb|AAN52377.1| ribosomal protein L24 [Branchiostoma ... 143 1e-33
gi|50729688|ref|XP_416616.1| PREDICTED: similar to Rpl24 protein... 134 7e-31
gi|27545227|ref|NP_775342.1| ribosomal protein L24 [Danio rerio]... 134 7e-31
gi|37747968|gb|AAH59530.1| Ribosomal protein L24 [Danio rerio] 134 9e-31
gi|4506619|ref|NP_000977.1| ribosomal protein L24; 60S ribosomal... 134 9e-31
gi|40642996|emb|CAD91424.1| ribosomal protein L24 [Crassostrea g... 134 9e-31
gi|28174943|gb|AAH02110.2| Rpl24 protein [Mus musculus] 134 9e-31
gi|26346504|dbj|BAC36903.1| unnamed protein product [Mus musculus] 133 1e-30
gi|10121631|gb|AAG13295.1| 60S ribosomal protein L24 [Gillichthy... 132 3e-30
gi|37778978|gb|AAP20149.1| 60S ribosomal protein L24 [Pagrus major] 132 4e-30
gi|28189753|dbj|BAC56491.1| similar to ribosomal protein L30 [Bo... 132 4e-30
gi|15293917|gb|AAK95151.1| ribosomal protein L24 [Ictalurus punc... 131 5e-30
gi|47226934|emb|CAG05826.1| unnamed protein product [Tetraodon n... 130 8e-30
gi|28189757|dbj|BAC56493.1| similar to ribosomal protein L30 [Bo... 130 1e-29
gi|28189765|dbj|BAC56497.1| similar to ribosomal protein L30 [Bo... 126 2e-28
gi|19921254|ref|NP_609649.1| CG9282-PA [Drosophila melanogaster]... 125 3e-28
gi|28189314|dbj|BAC56348.1| similar to ribosomal protein L30 [Bo... 124 6e-28
gi|15213772|gb|AAK92161.1| ribosomal protein L24 [Spodoptera fru... 123 2e-27
gi|49532910|dbj|BAD26690.1| Ribosomal protein L24 [Plutella xylo... 122 2e-27
gi|32187005|gb|AAP73465.1| 60S ribosomal protein L24 [Schistosom... 118 4e-26
gi|31236377|ref|XP_319401.1| ENSANGP00000012247 [Anopheles gambi... 116 2e-25
gi|34881303|ref|XP_346333.1| similar to ribosomal protein L24 [R... 115 4e-25
gi|38087569|ref|XP_194389.2| similar to ribosomal protein L24 [M... 109 2e-23
gi|34866334|ref|XP_345504.1| similar to ribosomal protein L24 [R... 105 5e-22
gi|34852797|ref|XP_226610.2| similar to ribosomal protein L24 [R... 104 8e-22
gi|48138915|ref|XP_393430.1| similar to ribosomal protein L24 [A... 97 2e-19
gi|28189879|dbj|BAC56554.1| similar to ribosomal protein L30 [Bo... 96 3e-19
gi|50553810|ref|XP_504316.1| hypothetical protein [Yarrowia lipo... 91 7e-18
gi|50308871|ref|XP_454440.1| RL24_KLULA [Kluyveromyces lactis] >... 89 4e-17
gi|19075214|ref|NP_587714.1| 60s ribosomal protein L24 [Schizosa... 87 1e-16
gi|19115030|ref|NP_594118.1| 60S ribosomal protein L24 [Schizosa... 86 2e-16
gi|45198995|ref|NP_986024.1| AFR477Cp [Eremothecium gossypii] >g... 86 4e-16
gi|50284811|ref|XP_444833.1| unnamed protein product [Candida gl... 85 6e-16
gi|49128278|ref|XP_412841.1| conserved hypothetical protein [Asp... 85 6e-16
gi|50256837|gb|EAL19555.1| hypothetical protein CNBG1840 [Crypto... 84 8e-16
gi|44829119|gb|AAS45465.2| ribosomal protein L24 [Marsupenaeus j... 84 8e-16
gi|26389943|dbj|BAC25816.1| unnamed protein product [Mus musculus] 84 1e-15
gi|12859304|dbj|BAB31605.1| unnamed protein product [Mus musculus] 84 1e-15
gi|46128597|ref|XP_388852.1| conserved hypothetical protein [Gib... 84 1e-15
gi|6321587|ref|NP_011664.1| Ribosomal protein L30 of the large (... 83 2e-15
gi|6321407|ref|NP_011484.1| Ribosomal protein L30 of the large (... 83 2e-15
gi|46438896|gb|EAK98220.1| hypothetical protein CaO19.3789 [Cand... 81 7e-15
gi|50423431|ref|XP_460298.1| unnamed protein product [Debaryomyc... 79 3e-14
gi|46575972|gb|AAT01333.1| putative 60S ribosomal protein L24 [O... 79 3e-14
gi|17946569|gb|AAL49315.1| RH14088p [Drosophila melanogaster] 69 8e-14
gi|32420285|ref|XP_330586.1| hypothetical protein [Neurospora cr... 77 1e-13
gi|1710521|sp|P50888|RL24_HORVU 60S RIBOSOMAL PROTEIN L24 >gnl|B... 76 2e-13
gi|18404176|ref|NP_565851.1| 60S ribosomal protein L24 (RPL24A) ... 73 3e-12
gi|15231730|ref|NP_190870.1| 60S ribosomal protein L24 (RPL24B) ... 72 4e-12
gi|34900364|ref|NP_911528.1| putative 60S ribosomal protein L24 ... 72 6e-12
gi|46226675|gb|EAK87654.1| possible 60S ribosomal protein L24, t... 71 1e-11
gi|25295112|pir||F84782 60S ribosomal protein L24 [imported] - A... 70 2e-11
gi|6094040|sp|O65743|RL24_CICAR 60S ribosomal protein L24 >gnl|B... 70 2e-11
gi|10180025|gb|AAG13986.1| 60S ribosomal protein L24 [Prunus avium] 69 3e-11
gi|50787734|emb|CAH04415.1| ribosomal protein L24 [Euplotes vannus] 69 5e-11
gi|49068536|ref|XP_398557.1| hypothetical protein UM00942.1 [Ust... 66 2e-10
gi|23483728|gb|EAA19304.1| Ribosomal protein L24e, putative [Pla... 65 4e-10
gi|38100327|gb|EAA47468.1| hypothetical protein MG02711.4 [Magna... 65 7e-10
gi|23619029|ref|NP_704991.1| 60S ribosomal protein L24, putative... 64 9e-10
gi|34914662|ref|NP_918678.1| putative ribosomal protein [Oryza s... 61 8e-09
gi|50259610|gb|EAL22283.1| hypothetical protein CNBC4200 [Crypto... 60 2e-08
gi|31242295|ref|XP_321578.1| ENSANGP00000011631 [Anopheles gambi... 60 2e-08
gi|21356545|ref|NP_650073.1| CG6764-PA [Drosophila melanogaster]... 59 3e-08
gi|27817966|dbj|BAC55730.1| putative 60S ribosomal protein L30 [... 59 3e-08
gi|19115751|ref|NP_594839.1| 60s ribosomal protein l24-3 (L30) [... 59 4e-08
gi|27769143|gb|AAH42273.1| MGC53444 protein [Xenopus laevis] 58 8e-08
gi|15225363|ref|NP_182013.1| 60S ribosomal protein L24, putative... 57 2e-07
gi|15669387|ref|NP_248196.1| LSU ribosomal protein L24E [Methano... 57 2e-07
gi|49078614|ref|XP_403043.1| hypothetical protein UM05428.1 [Ust... 56 2e-07
gi|38328486|gb|AAH62237.1| Unknown (protein for MGC:72943) [Ratt... 56 2e-07
gi|28828084|gb|AAO50767.1| similar to Mus musculus (Mouse). Simi... 56 2e-07
gi|23481839|gb|EAA17996.1| Ribosomal protein L24e, putative [Pla... 56 3e-07
gi|50752912|ref|XP_413796.1| PREDICTED: similar to ribosomal pro... 55 4e-07
gi|14250160|gb|AAH08499.1| Ribosomal protein L24-like [Homo sapi... 55 4e-07
gi|16740902|gb|AAH16312.1| Ribosomal protein L24-like [Homo sapi... 55 4e-07
gi|10047102|ref|NP_057388.1| ribosomal protein L24-like; 60S rib... 55 4e-07
gi|34864348|ref|XP_343431.1| similar to ribosomal protein L24-li... 55 4e-07
gi|38083793|ref|XP_357001.1| similar to ribosomal protein L24-li... 55 4e-07
gi|13529146|gb|AAH05344.1| C15orf15 protein [Homo sapiens] 55 4e-07
gi|47085685|ref|NP_998158.1| zgc:56202 [Danio rerio] >gnl|BL_ORD... 55 4e-07
gi|15779001|gb|AAH14576.1| Ribosomal protein L24-like [Homo sapi... 55 5e-07
gi|49258857|pdb|1S1I|S Chain S, Structure Of The Ribosomal 80s-E... 55 5e-07
gi|11498372|ref|NP_069600.1| LSU ribosomal protein L24E (rpl24E)... 54 9e-07
gi|46229841|gb|EAK90659.1| 60S ribosomal protein L24 [Cryptospor... 54 1e-06
gi|49256016|gb|AAH73497.1| Unknown (protein for MGC:81028) [Xeno... 54 1e-06
gi|33772491|gb|AAQ54647.1| 60S ribosomal protein L24 [Oikopleura... 54 2e-06
gi|20381079|gb|AAH28672.1| Ribosomal protein L24-like [Homo sapi... 54 2e-06
gi|29249319|gb|EAA40833.1| GLP_154_26137_25568 [Giardia lamblia ... 53 3e-06
gi|50308743|ref|XP_454376.1| unnamed protein product [Kluyveromy... 53 3e-06
gi|23613084|ref|NP_703406.1| 60S ribosomal subunit protein L24, ... 53 3e-06
gi|29245928|gb|EAA37544.1| GLP_2_13062_12754 [Giardia lamblia AT... 53 3e-06
gi|50290643|ref|XP_447754.1| unnamed protein product [Candida gl... 52 4e-06
gi|45188219|ref|NP_984442.1| ADR346Wp [Eremothecium gossypii] >g... 52 5e-06
gi|47220538|emb|CAG05564.1| unnamed protein product [Tetraodon n... 51 8e-06
gi|3445524|gb|AAC63142.1| ribosomal protein L24 [Trypanosoma bru... 50 1e-05
gi|6323037|ref|NP_013109.1| Ribosomal Like Protein 24; Rlp24p [S... 50 2e-05
gi|19074000|ref|NP_584606.1| 60S RIBOSOMAL PROTEIN L24 [Encephal... 49 3e-05
gi|32408221|ref|XP_324592.1| hypothetical protein [Neurospora cr... 49 5e-05
gi|50546447|ref|XP_500693.1| hypothetical protein [Yarrowia lipo... 48 7e-05
gi|49094472|ref|XP_408697.1| hypothetical protein AN4560.2 [Aspe... 48 9e-05
gi|14520884|ref|NP_126359.1| LSU ribosomal protein L24E [Pyrococ... 48 9e-05
gi|14591750|ref|NP_143358.1| S ribosomal protein L24E [Pyrococcu... 47 1e-04
gi|18977741|ref|NP_579098.1| LSU ribosomal protein L24E [Pyrococ... 47 1e-04
gi|15790235|ref|NP_280059.1| 50S ribosomal protein L24E; Rpl24e ... 47 1e-04
gi|46434048|gb|EAK93470.1| hypothetical protein CaO19.4191 [Cand... 47 2e-04
gi|50427749|ref|XP_462487.1| unnamed protein product [Debaryomyc... 45 4e-04
gi|17505458|ref|NP_492572.1| ribosomal Protein, Large subunit (1... 45 7e-04
gi|45358202|ref|NP_987759.1| LSU ribosomal protein L23E [Methano... 45 7e-04
gi|39595115|emb|CAE60152.1| Hypothetical protein CBG03702 [Caeno... 44 0.001
gi|20094880|ref|NP_614727.1| Ribosomal protein L24E [Methanopyru... 43 0.002
gi|13541282|ref|NP_110970.1| 50S ribosomal protein L24E [Thermop... 43 0.003
gi|18314008|ref|NP_560675.1| ribosomal protein L24 [Pyrobaculum ... 42 0.004
gi|21228567|ref|NP_634489.1| LSU ribosomal protein L24E [Methano... 42 0.006
gi|20090382|ref|NP_616457.1| ribosomal protein L24e [Methanosarc... 42 0.006
gi|48837566|ref|ZP_00294540.1| COG2075: Ribosomal protein L24E [... 41 0.011
gi|15920471|ref|NP_376140.1| 61aa long hypothetical 50S ribosoma... 41 0.011
gi|46124693|ref|XP_386900.1| hypothetical protein FG06724.1 [Gib... 39 0.031
gi|42661976|ref|XP_371140.2| similar to zinc finger protein 433 ... 39 0.041
gi|132773|sp|P14116|R24E_HALMA 50S ribosomal protein L24e (Hl21/... 39 0.041
gi|13812425|ref|NP_113543.1| 60S ribosomal protein L24 [Guillard... 39 0.053
gi|14602029|ref|NP_148574.1| 50S ribosomal protein L24 [Aeropyru... 38 0.091
gi|48852096|ref|ZP_00306287.1| COG2075: Ribosomal protein L24E [... 38 0.091
gi|27485363|ref|XP_210365.1| similar to Ribosomal protein L24-li... 36 0.26
gi|19074515|ref|NP_586021.1| similarity to 60S RIBOSOMAL PROTEIN... 36 0.26
gi|15643482|ref|NP_228528.1| cysteinyl-tRNA synthetase [Thermoto... 35 0.45
gi|29830510|ref|NP_825144.1| putative cysteinyl-tRNA synthetase ... 35 0.45
gi|46142353|ref|ZP_00149024.2| COG2075: Ribosomal protein L24E [... 35 0.45
gi|21222630|ref|NP_628409.1| putative cysteinyl-tRNA synthetase ... 35 0.45
gi|32490992|ref|NP_871246.1| cysS [Wigglesworthia glossinidia en... 35 0.59
gi|46130019|ref|ZP_00164708.2| COG0215: Cysteinyl-tRNA synthetas... 35 0.77
gi|32398684|emb|CAD98644.1| cysteinyl-tRNA-synthetase, possible ... 35 0.77
gi|50747856|ref|XP_421018.1| PREDICTED: similar to CysRS protein... 35 0.77
gi|15896425|ref|NP_349774.1| Cysteinyl-tRNA synthetase [Clostrid... 34 1.0
gi|15228880|ref|NP_191189.1| tRNA synthetase class I (C) family ... 34 1.0
gi|33468377|gb|AAQ19668.1| polymerase [Hepatitis B virus] 34 1.0
gi|34866431|ref|XP_345985.1| similar to microtubule-associated p... 34 1.0
gi|15899047|ref|NP_343652.1| Cysteinyl-tRNA synthetase (cysS) [S... 34 1.3
gi|20808681|ref|NP_623852.1| Cysteinyl-tRNA synthetase [Thermoan... 34 1.3
gi|48837229|ref|ZP_00294224.1| COG0215: Cysteinyl-tRNA synthetas... 34 1.3
gi|18252591|gb|AAL66348.1| P protein [Hepatitis B virus] 34 1.3
gi|30248074|ref|NP_840144.1| Cysteinyl-tRNA synthetase [Nitrosom... 34 1.3
gi|28436794|gb|AAH46746.1| Cars-prov protein [Xenopus laevis] 34 1.3
gi|48859462|ref|ZP_00313396.1| COG0215: Cysteinyl-tRNA synthetas... 34 1.3
gi|22974033|ref|ZP_00020430.1| hypothetical protein [Chloroflexu... 34 1.3
gi|50291223|ref|XP_448044.1| unnamed protein product [Candida gl... 33 1.7
gi|18311409|ref|NP_563343.1| cysteine-tRNA ligase [Clostridium p... 33 1.7
gi|14601506|ref|NP_148045.1| cysteinyl-tRNA synthetase [Aeropyru... 33 1.7
gi|34762389|ref|ZP_00143391.1| Cysteinyl-tRNA synthetase [Fusoba... 33 2.2
gi|19704900|ref|NP_602395.1| Cysteinyl-tRNA synthetase [Fusobact... 33 2.2
gi|27466538|gb|AAO12618.1| polymerase [Hepatitis B virus] 33 2.2
gi|50877817|emb|CAG37657.1| probable cysteinyl-tRNA synthetase [... 33 2.2
gi|15610716|ref|NP_218097.1| cysS [Mycobacterium tuberculosis H3... 33 2.2
gi|15843193|ref|NP_338230.1| cysteinyl-tRNA synthetase [Mycobact... 33 2.2
gi|6063465|dbj|BAA85373.1| DNA polymerase/reverse transcriptase ... 33 2.2
gi|6010061|emb|CAB57237.1| putative ribosomal protein [Entodiniu... 33 2.2
gi|27466525|gb|AAO12672.1| polymerase [Hepatitis B virus] 33 2.2
gi|6959503|gb|AAF33121.1| polymerase protein [orangutan hepadnav... 33 2.2
gi|28856175|gb|AAH48039.1| CARS protein [Danio rerio] 33 2.2
gi|19115476|ref|NP_594564.1| putative cysteinyl-trna synthetase ... 33 2.2
gi|48835513|ref|ZP_00292512.1| COG0215: Cysteinyl-tRNA synthetas... 33 2.9
gi|34497201|ref|NP_901416.1| cysteinyl-tRNA synthetase [Chromoba... 33 2.9
gi|17228587|ref|NP_485135.1| cysteinyl-tRNA synthetase [Nostoc s... 33 2.9
gi|47213255|emb|CAF92916.1| unnamed protein product [Tetraodon n... 33 2.9
gi|46105658|ref|ZP_00199624.1| COG0215: Cysteinyl-tRNA synthetas... 33 2.9
gi|9758060|dbj|BAB08639.1| cysteine-tRNA ligase [Arabidopsis tha... 33 2.9
gi|15241557|ref|NP_198699.1| tRNA synthetase class I (C) family ... 33 2.9
gi|50550761|ref|XP_502853.1| hypothetical protein [Yarrowia lipo... 33 2.9
gi|38014676|gb|AAH60463.1| MGC68641 protein [Xenopus laevis] 33 2.9
gi|49522960|gb|AAH75287.1| Unknown (protein for MGC:88928) [Xeno... 33 2.9
gi|15419833|gb|AAK97182.1| polymerase [Hepatitis B virus] 32 3.8
gi|25029072|ref|NP_739126.1| conserved hypothetical protein [Cor... 32 3.8
gi|34761140|gb|AAQ81928.1| polymerase protein [Hepatitis B virus] 32 3.8
gi|46113168|ref|ZP_00200705.1| COG0215: Cysteinyl-tRNA synthetas... 32 3.8
gi|30316165|sp|Q8FMI8|SYC_COREF Cysteinyl-tRNA synthetase (Cyste... 32 3.8
gi|34876097|ref|XP_344213.1| similar to ribosomal protein L24 [R... 32 3.8
gi|32473247|ref|NP_866241.1| cysteinyl-tRNA synthetase [Pirellul... 32 3.8
gi|59451|emb|CAA48354.1| HBV polymerase [Hepatitis B virus] 32 3.8
gi|46579990|ref|YP_010798.1| cysteinyl-tRNA synthetase [Desulfov... 32 3.8
gi|16751312|gb|AAL25951.1| polymerase protein [Hepatitis B virus] 32 3.8
gi|23474637|ref|ZP_00129930.1| COG0215: Cysteinyl-tRNA synthetas... 32 3.8
gi|28212192|ref|NP_783136.1| cysteinyl-tRNA synthetase [Clostrid... 32 3.8
gi|7407768|gb|AAF62259.1| polymerase [Hepatitis B virus] 32 3.8
gi|7407720|gb|AAF62223.1| polymerase [Hepatitis B virus] 32 3.8
gi|7407716|gb|AAF62220.1| polymerase [Hepatitis B virus] >gnl|BL... 32 3.8
gi|118876|sp|P03156|DPOL_HPBVY P protein [Includes: DNA-directed... 32 3.8
gi|5257489|gb|AAD41360.1| polymerase [Hepatitis B virus] 32 3.8
gi|27466565|gb|AAO12625.1| polymerase [Hepatitis B virus] 32 3.8
gi|34761135|gb|AAQ81924.1| polymerase protein [Hepatitis B virus] 32 3.8
gi|32261169|dbj|BAC78494.1| polymerase [Hepatitis B virus] 32 3.8
gi|93080|pir||S20757 DNA-directed DNA polymerase (EC 2.7.7.7) - ... 32 3.8
gi|475987|gb|AAA18583.1| polymerase [Hepatitis B virus] 32 3.8
gi|59433|emb|CAA46352.1| polymerase ORF [Hepatitis B virus] 32 3.8
gi|6692512|gb|AAF24680.1| polymerase [Hepatitis B virus] 32 3.8
gi|6692492|gb|AAF24660.1| polymerase [Hepatitis B virus] 32 3.8
gi|8925755|gb|AAF81607.1| DNA polymerase/reverse transcriptase [... 32 3.8
gi|27466519|gb|AAO12604.1| polymerase [Hepatitis B virus] >gnl|B... 32 3.8
gi|1514497|emb|CAA68864.1| P [Hepatitis B virus] 32 3.8
gi|32261174|dbj|BAC78498.1| polymerase [Hepatitis B virus] 32 3.8
gi|32330627|gb|AAP79852.1| polymerase [Hepatitis B virus] 32 3.8
gi|67003|pir||JDVLVB DNA-directed DNA polymerase (EC 2.7.7.7) - ... 32 3.8
gi|32330603|gb|AAP79831.1| polymerase [Hepatitis B virus] 32 3.8
gi|32261184|dbj|BAC78506.1| polymerase [Hepatitis B virus] 32 3.8
gi|32330643|gb|AAP79866.1| polymerase [Hepatitis B virus] 32 3.8
gi|6692498|gb|AAF24666.1| polymerase [Hepatitis B virus] 32 3.8
gi|38488603|dbj|BAD02319.1| polymerase [Hepatitis B virus] 32 3.8
gi|93082|pir||S20752 DNA-directed DNA polymerase (EC 2.7.7.7) - ... 32 3.8
gi|6063470|dbj|BAA85377.1| DNA polymerase/reverse transcriptase ... 32 3.8
gi|27466573|gb|AAO12632.1| polymerase [Hepatitis B virus] 32 3.8
gi|32330611|gb|AAP79838.1| polymerase [Hepatitis B virus] 32 3.8
gi|32330619|gb|AAP79845.1| polymerase [Hepatitis B virus] 32 3.8
gi|18621125|emb|CAC87015.1| polymerase [Hepatitis B virus] 32 3.8
gi|32261179|dbj|BAC78502.1| polymerase [Hepatitis B virus] 32 3.8
gi|6692505|gb|AAF24673.1| polymerase [Hepatitis B virus] 32 3.8
gi|32330635|gb|AAP79859.1| polymerase [Hepatitis B virus] 32 3.8
gi|27466557|gb|AAO12692.1| polymerase [Hepatitis B virus] 32 3.8
gi|27466544|gb|AAO12681.1| polymerase [Hepatitis B virus] 32 3.8
gi|27466589|gb|AAO12646.1| polymerase [Hepatitis B virus] 32 3.8
gi|27466581|gb|AAO12639.1| polymerase [Hepatitis B virus] 32 3.8
gi|29247331|gb|EAA38897.1| GLP_180_43395_38410 [Giardia lamblia ... 32 3.8
gi|2723867|dbj|BAA24096.1| membrane protein [Human herpesvirus 5... 32 3.8
gi|2723863|dbj|BAA24094.1| membrane protein [Human herpesvirus 5] 32 3.8
gi|2723865|dbj|BAA24095.1| membrane protein [Human herpesvirus 5] 32 3.8
gi|16331016|ref|NP_441744.1| cysteinyl-tRNA synthetase [Synechoc... 32 3.8
gi|19553839|ref|NP_601841.1| cysteinyl-tRNA synthetase [Coryneba... 32 5.0
gi|28436096|dbj|BAC57441.1| polymerase [Hepatitis B virus] 32 5.0
gi|15922576|ref|NP_378245.1| 471aa long hypothetical cysteinyl-t... 32 5.0
gi|45526441|ref|ZP_00177646.1| COG0215: Cysteinyl-tRNA synthetas... 32 5.0
gi|38198482|emb|CAE54024.1| S protein [Hepatitis B virus] 32 5.0
gi|7407700|gb|AAF62208.1| polymerase [Hepatitis B virus] 32 5.0
gi|29170565|dbj|BAC66167.1| polymerase [Hepatitis B virus] 32 5.0
gi|7407692|gb|AAF62202.1| polymerase [Hepatitis B virus] 32 5.0
gi|452628|emb|CAA53354.1| polymerase [Hepatitis B virus] 32 5.0
gi|7407784|gb|AAF62271.1| polymerase [Hepatitis B virus] 32 5.0
gi|28812222|dbj|BAC65108.1| polymerase protein [Hepatitis B virus] 32 5.0
gi|7407696|gb|AAF62205.1| polymerase [Hepatitis B virus] 32 5.0
gi|7407672|gb|AAF62187.1| polymerase [Hepatitis B virus] >gnl|BL... 32 5.0
gi|7407708|gb|AAF62214.1| polymerase [Hepatitis B virus] >gnl|BL... 32 5.0
gi|6691495|dbj|BAA89322.1| polymerase protein [Hepatitis B virus] 32 5.0
gi|4377612|emb|CAA53339.1| polymerase [Hepatitis B virus] 32 5.0
gi|28812217|dbj|BAC65104.1| polymerase protein [Hepatitis B virus] 32 5.0
gi|8926931|dbj|BAA98025.1| pol protein [Hepatitis B virus] 32 5.0
gi|8926928|dbj|BAA98023.1| pol protein [Hepatitis B virus] 32 5.0
gi|50304753|ref|XP_452332.1| unnamed protein product [Kluyveromy... 32 5.0
gi|48845055|ref|ZP_00299345.1| COG0215: Cysteinyl-tRNA synthetas... 32 5.0
gi|8926925|dbj|BAA98021.1| pol protein [Hepatitis B virus] 32 5.0
gi|1185115|emb|CAA51254.1| DNA polymerase [Hepatitis B virus] 32 5.0
gi|23479772|gb|EAA16509.1| cysteinyl-tRNA synthetase [Plasmodium... 32 5.0
gi|2117935|pir||S71785 DNA-directed DNA polymerase (EC 2.7.7.7) ... 32 5.0
gi|2829156|gb|AAC40810.1| polymerase [Hepatitis B virus] 32 5.0
gi|28436091|dbj|BAC57437.1| polymerase [Hepatitis B virus] 32 5.0
gi|22135695|gb|AAM09037.1| polymerase [Hepatitis B virus] 32 5.0
gi|1359679|emb|CAA66424.1| polymerase [Hepatitis B virus] 32 5.0
gi|1185116|emb|CAA51255.1| HBsAg [Hepatitis B virus] 32 5.0
gi|16751328|gb|AAL25818.1| spike glycoprotein precursor [Zaire E... 32 6.5
gi|118877|sp|P03155|DPOL_HPBVZ P protein [Includes: DNA-directed... 32 6.5
gi|5019981|gb|AAD37958.1| P protein [Hepatitis B virus] 32 6.5
gi|15641850|ref|NP_231482.1| cysteinyl-tRNA synthetase [Vibrio c... 32 6.5
gi|38234535|ref|NP_940302.1| Putative cysteinyl-tRNA synthetase ... 32 6.5
gi|13476470|ref|NP_108040.1| cysteine-tRNA ligase [Mesorhizobium... 32 6.5
gi|40538825|ref|NP_081432.2| RIKEN cDNA 2310061O04 [Mus musculus... 32 6.5
gi|8926934|dbj|BAA98027.1| pol protein [Hepatitis B virus] 32 6.5
gi|2182121|gb|AAB59972.1| DNA polymerase [Hepatitis B virus] 32 6.5
gi|28436101|dbj|BAC57445.1| polymerase [Hepatitis B virus] 32 6.5
gi|4140295|emb|CAA10539.1| polymerase [Hepatitis B virus] 32 6.5
gi|45521230|ref|ZP_00172751.1| COG0215: Cysteinyl-tRNA synthetas... 32 6.5
gi|47229553|emb|CAG06749.1| unnamed protein product [Tetraodon n... 32 6.5
gi|48477156|ref|YP_022862.1| cysteinyl-tRNA synthetase [Picrophi... 31 8.5
gi|23630486|gb|AAN37507.1| surface glycoprotein GP [Zaire Ebola ... 31 8.5
gi|10313995|ref|NP_066246.1| virion spike glycoprotein precursor... 31 8.5
gi|33860544|gb|AAQ55048.1| virion spike glycoprotein precursor [... 31 8.5
gi|20988543|gb|AAH30473.1| Cars protein [Mus musculus] 31 8.5
gi|8479503|sp|P87666|VGP_EBOZ5 Structural glycoprotein precursor... 31 8.5
gi|8479505|sp|P87671|VGP_EBOEC Structural glycoprotein precursor... 31 8.5
gi|21702651|gb|AAM76034.1| surface glycoprotein GP precursor [Za... 31 8.5
gi|8479501|sp|O11457|VGP_EBOG4 Structural glycoprotein precursor... 31 8.5
gi|26989624|ref|NP_745049.1| cysteinyl-tRNA synthetase [Pseudomo... 31 8.5
gi|48729809|ref|ZP_00263558.1| COG0215: Cysteinyl-tRNA synthetas... 31 8.5
gi|23469177|ref|ZP_00124512.1| COG0215: Cysteinyl-tRNA synthetas... 31 8.5
gi|32041867|ref|ZP_00139450.1| COG0215: Cysteinyl-tRNA synthetas... 31 8.5
gi|28897924|ref|NP_797529.1| cysteinyl-tRNA synthetase [Vibrio p... 31 8.5
gi|28870897|ref|NP_793516.1| cysteinyl-tRNA synthetase [Pseudomo... 31 8.5
gi|30316151|sp|Q8D8R1|SYC_VIBVU Cysteinyl-tRNA synthetase (Cyste... 31 8.5
gi|15596992|ref|NP_250486.1| cysteinyl-tRNA synthetase [Pseudomo... 31 8.5
gi|46912719|emb|CAG19509.1| putative cysteinyl-tRNA synthetase [... 31 8.5
gi|48852264|ref|ZP_00306453.1| COG0215: Cysteinyl-tRNA synthetas... 31 8.5
gi|24373357|ref|NP_717400.1| cysteinyl-tRNA synthetase [Shewanel... 31 8.5
gi|50084652|ref|YP_046162.1| cysteinyl-tRNA synthetase [Acinetob... 31 8.5
gi|30583997|gb|AAP36247.1| Homo sapiens cysteinyl-tRNA synthetas... 31 8.5
gi|3242657|dbj|BAA29032.1| cysteinyl-tRNA synthetase [Mus musculus] 31 8.5
gi|18376146|emb|CAD21221.1| hypothetical protein [Neurospora cra... 31 8.5
gi|46143889|ref|ZP_00133878.2| COG0215: Cysteinyl-tRNA synthetas... 31 8.5
gi|34861284|ref|XP_215134.2| similar to cysteine-tRNA ligase iso... 31 8.5
gi|37679546|ref|NP_934155.1| cysteinyl-tRNA synthetase [Vibrio v... 31 8.5
gi|10835051|ref|NP_001742.1| cysteine-tRNA ligase isoform b; cys... 31 8.5
gi|26332072|dbj|BAC29766.1| unnamed protein product [Mus musculus] 31 8.5
gi|27366186|ref|NP_761714.1| Cysteinyl-tRNA synthetase [Vibrio v... 31 8.5
gi|50259636|gb|EAL22306.1| hypothetical protein CNBB4810 [Crypto... 31 8.5
gi|927229|gb|AAA73901.1| cysteinyl-tRNA synthetase 31 8.5
gi|14590527|ref|NP_142595.1| cysteinyl-tRNA synthetase [Pyrococc... 31 8.5
gi|38089291|ref|XP_357887.1| similar to ribosomal protein L24 [M... 31 8.5
gi|631984|pir||S47406 DNA-directed DNA polymerase (EC 2.7.7.7) -... 31 8.5
gi|23103560|ref|ZP_00090040.1| COG0215: Cysteinyl-tRNA synthetas... 31 8.5
gi|21269877|ref|NP_644802.1| cysteine-tRNA ligase isoform a; cys... 31 8.5
gi|26346422|dbj|BAC36862.1| unnamed protein product [Mus musculus] 31 8.5
gi|37527666|ref|NP_931010.1| cysteinyl-tRNA synthetase (cysteine... 31 8.5
gi|32414989|ref|XP_327974.1| predicted protein [Neurospora crass... 31 8.5
gi|47117033|sp|Q9ER72|SYC_MOUSE Cysteinyl-tRNA synthetase (Cyste... 31 8.5
gi|49071878|ref|XP_400228.1| hypothetical protein UM02613.1 [Ust... 31 8.5
gi|11191800|emb|CAC16398.1| Cysteinyl-tRNA-synthetase [Mus muscu... 31 8.5
gi|31980754|ref|NP_038770.2| cysteinyl-tRNA synthetase [Mus musc... 31 8.5
gi|39998454|ref|NP_954405.1| cysteinyl-tRNA synthetase [Geobacte... 31 8.5
gi|23507953|ref|NP_700623.1| cysteine -- tRNA ligase, putative [... 31 8.5
>gi|17506331|ref|NP_491399.1| ribosomal Protein, Large subunit (17.8
kD) (rpl-24.1) [Caenorhabditis elegans]
gi|7498065|pir||T30926 hypothetical protein D1007.12 -
Caenorhabditis elegans
gi|13324926|gb|AAK18907.1| Ribosomal protein, large subunit protein
24.1 [Caenorhabditis elegans]
Length = 159
Score = 270 bits (691), Expect = 6e-72
Identities = 138/159 (86%), Positives = 138/159 (86%)
Frame = +1
Query: 1 MKVETCVYSGYKIHPGHGKRLVRTDGKVQIFLSGKALKGAKLRRNPRDIRWTVLYRIKNK 180
MKVETCVYSGYKIHPGHGKRLVRTDGKVQIFLSGKALKGAKLRRNPRDIRWTVLYRIKNK
Sbjct: 1 MKVETCVYSGYKIHPGHGKRLVRTDGKVQIFLSGKALKGAKLRRNPRDIRWTVLYRIKNK 60
Query: 181 KGTHGQEQVTRKKTKKSVQVVNRAVAGLSLDAILAKRNQTEDFRRQQREQAAKIXXXXXX 360
KGTHGQEQVTRKKTKKSVQVVNRAVAGLSLDAILAKRNQTEDFRRQQREQAAKI
Sbjct: 61 KGTHGQEQVTRKKTKKSVQVVNRAVAGLSLDAILAKRNQTEDFRRQQREQAAKIAKDANK 120
Query: 361 XXXXXXXXXXXXXXXSQPKTQQKTAKNVKTAAPRVGGKR 477
SQPKTQQKTAKNVKTAAPRVGGKR
Sbjct: 121 AVRAAKAAANKEKKASQPKTQQKTAKNVKTAAPRVGGKR 159