Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= D1009_4
(675 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17551288|ref|NP_509508.1| Neuropeptide-Like Protein (23.7 kD)... 281 1e-74
gi|39588090|emb|CAE57322.1| Hypothetical protein CBG00246 [Caeno... 253 2e-66
gi|38258253|sp|Q9NL82|ORKB_PROCL Orcokinin peptides type B precu... 108 1e-22
gi|38258254|sp|Q9NL83|ORKA_PROCL Orcokinin peptides type A precu... 99 6e-20
gi|38422313|emb|CAE54928.1| Hypothetical protein CC4.2 [Caenorha... 70 3e-11
gi|17506265|ref|NP_493278.1| Neuropeptide-Like Protein (nlp-15) ... 70 3e-11
gi|39592383|emb|CAE63460.1| Hypothetical protein CBG07924 [Caeno... 68 2e-10
gi|50556390|ref|XP_505603.1| hypothetical protein [Yarrowia lipo... 50 3e-05
gi|1076211|pir||S50755 hypothetical protein VSP-3 - Chlamydomona... 50 5e-05
gi|33865132|ref|NP_896691.1| possible N-terminal part of IF-2 [S... 50 5e-05
gi|34863324|ref|XP_238540.2| similar to RIKEN cDNA D030060M11 [R... 49 9e-05
gi|50288747|ref|XP_446803.1| unnamed protein product [Candida gl... 48 2e-04
gi|50257986|gb|EAL20680.1| hypothetical protein CNBE0450 [Crypto... 47 3e-04
gi|41400381|gb|AAS07042.1| minus agglutinin [Chlamydomonas reinh... 47 3e-04
gi|41281612|ref|NP_115812.1| chromosome 13 open reading frame 8 ... 47 3e-04
gi|22830951|dbj|BAC15815.1| unknown protein [Oryza sativa (japon... 47 3e-04
gi|14017821|dbj|BAB47431.1| KIAA1802 protein [Homo sapiens] 47 3e-04
gi|6691467|dbj|BAA89307.1| AHM1 [Triticum aestivum] 47 4e-04
gi|41387633|gb|AAS01677.1| large tegument protein [Gallid herpes... 47 4e-04
gi|9635070|ref|NP_057795.1| major tegument protein [Gallid herpe... 47 4e-04
gi|49484258|ref|YP_041482.1| membrane anchored protein [Staphylo... 47 4e-04
gi|10180741|gb|AAG14229.1| UL36 large tegument protein-like prot... 47 4e-04
gi|41400384|gb|AAS07044.1| plus agglutinin [Chlamydomonas reinha... 46 6e-04
gi|6469855|gb|AAF13460.1| unknown [Streptococcus pneumoniae] 46 6e-04
gi|28493118|ref|NP_787279.1| unknown [Tropheryma whipplei str. T... 46 8e-04
gi|21283685|ref|NP_646773.1| ORFID:MW1956~hypothetical protein, ... 46 8e-04
gi|7800642|gb|AAF70092.1| PspA [Streptococcus pneumoniae] 45 0.001
gi|42525075|ref|NP_970455.1| hypothetical protein Bd3745 [Bdello... 45 0.001
gi|23015685|ref|ZP_00055454.1| COG1426: Uncharacterized protein ... 45 0.001
gi|50511334|ref|NP_001002290.1| keratinocytes proline-rich prote... 45 0.001
gi|50285581|ref|XP_445219.1| unnamed protein product [Candida gl... 45 0.001
gi|3236370|gb|AAC23667.1| type VI collagen alpha 3 subunit [Mus ... 45 0.001
gi|7800638|gb|AAF70090.1| PspA [Streptococcus pneumoniae] 45 0.001
gi|283442|pir||A40215 TcD antigen - Trypanosoma cruzi 45 0.001
gi|6752379|gb|AAF27700.1| PspA [Streptococcus pneumoniae] 45 0.002
gi|22122459|ref|NP_666112.1| RIKEN cDNA D030060M11 [Mus musculus... 44 0.002
gi|13529551|gb|AAH05491.1| Col6a3 protein [Mus musculus] 44 0.002
gi|29436413|gb|AAH49881.1| Col6a3 protein [Mus musculus] 44 0.002
gi|15241186|ref|NP_200444.1| carbonic anhydrase family protein [... 44 0.002
gi|26331972|dbj|BAC29716.1| unnamed protein product [Mus musculus] 44 0.002
gi|34785567|gb|AAH57903.1| Col6a3 protein [Mus musculus] 44 0.002
gi|12018149|gb|AAG45421.1| gamete-specific hydroxyproline-rich g... 44 0.002
gi|50549811|ref|XP_502377.1| hypothetical protein [Yarrowia lipo... 44 0.002
gi|23129915|ref|ZP_00111736.1| COG3409: Putative peptidoglycan-b... 44 0.002
gi|414525|gb|AAA21525.1| meiotin-1 44 0.003
gi|15925022|ref|NP_372556.1| hypothetical protein SAV2032 [Staph... 44 0.003
gi|34854256|ref|XP_226804.2| similar to caspase recruitment doma... 44 0.003
gi|31242709|ref|XP_321785.1| ENSANGP00000017517 [Anopheles gambi... 42 0.003
gi|6322209|ref|NP_012284.1| GPI-anchored cell surface glycoprote... 44 0.004
gi|46362706|ref|ZP_00225555.1| COG0532: Translation initiation f... 44 0.004
gi|50511379|gb|AAT77302.1| putative repetitive proline rich prot... 44 0.004
gi|18478606|gb|AAL73214.1| repetitive proline rich protein [Oryz... 44 0.004
gi|7800644|gb|AAF70093.1| PspA [Streptococcus pneumoniae] 44 0.004
gi|100798|pir||S14959 proline-rich protein - wheat >gnl|BL_ORD_I... 44 0.004
gi|7800648|gb|AAF70095.1| PspA [Streptococcus pneumoniae] 44 0.004
gi|6942229|gb|AAF32367.1| proline-rich protein RiP-15 [Oryza sat... 44 0.004
gi|6752391|gb|AAF27706.1| PspA [Streptococcus pneumoniae] 44 0.004
gi|23506315|gb|AAN37735.1| PspA [Streptococcus pneumoniae] 43 0.005
gi|22209012|gb|AAC98688.2| surface antigen PHGST#5 [Trypanosoma ... 43 0.005
gi|27696285|gb|AAH43807.1| Bag3-A protein [Xenopus laevis] 43 0.005
gi|22830955|dbj|BAC15819.1| unknown protein [Oryza sativa (japon... 43 0.005
gi|23015568|ref|ZP_00055340.1| hypothetical protein Magn0210002 ... 43 0.006
gi|172526|gb|AAA35015.1| S1 protein 43 0.006
gi|22760635|dbj|BAC11273.1| unnamed protein product [Homo sapiens] 43 0.006
gi|17555582|ref|NP_497450.1| predicted CDS, tyrosine specific pr... 43 0.006
gi|6752389|gb|AAF27705.1| PspA [Streptococcus pneumoniae] 43 0.006
gi|46126341|ref|XP_387724.1| hypothetical protein FG07548.1 [Gib... 43 0.006
gi|6958206|gb|AAF32493.1| kexin-like protease KEX1 [Pneumocystis... 43 0.006
gi|38455898|gb|AAR20918.1| PspA [Streptococcus pneumoniae] 43 0.006
gi|537916|gb|AAB59301.1| meiotin-1 43 0.006
gi|47125144|gb|AAH70605.1| LOC431817 protein [Xenopus laevis] 42 0.008
gi|15828909|ref|NP_326269.1| conserved hypothetical protein [Myc... 42 0.008
gi|484638|pir||JQ2220 hydroxyproline-rich glycoprotein precursor... 42 0.008
gi|39596044|emb|CAE69680.1| Hypothetical protein CBG15933 [Caeno... 42 0.008
gi|21219450|ref|NP_625229.1| putative secreted proline-rich prot... 42 0.008
gi|15600724|ref|NP_254218.1| TonB protein [Pseudomonas aeruginos... 42 0.008
gi|1666536|gb|AAB18654.1| TonB [Pseudomonas aeruginosa] 42 0.008
gi|20138131|sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1... 42 0.008
gi|102987|pir||S10121 Balbiani ring protein 1-beta (clone 18-2) ... 42 0.011
gi|37181955|gb|AAQ88781.1| KMQK697 [Homo sapiens] 42 0.011
gi|9631814|ref|NP_048594.1| Pro-rich, PAPK (20X); similar to Ara... 42 0.011
gi|50549423|ref|XP_502182.1| hypothetical protein [Yarrowia lipo... 42 0.011
gi|122109|sp|P22845|H5B_XENLA Histone H5B (XLH5B) (H1E) (H1-SB) 42 0.011
gi|1403583|emb|CAA96129.1| histone H1(0)-1 [Xenopus laevis] >gnl... 42 0.011
gi|7800640|gb|AAF70091.1| PspA [Streptococcus pneumoniae] 42 0.011
gi|24583485|ref|NP_609429.1| CG17097-PB [Drosophila melanogaster... 42 0.011
gi|32484301|gb|AAH54149.1| LOC398662 protein [Xenopus laevis] 42 0.011
gi|330915|gb|AAA46091.1| IR4 protein >gnl|BL_ORD_ID|181174 gi|33... 42 0.014
gi|24661336|ref|NP_729446.1| CG32031-PA [Drosophila melanogaster... 42 0.014
gi|46140907|ref|ZP_00152608.2| hypothetical protein Daro020833 [... 41 0.019
gi|42569297|ref|NP_180077.3| formin homology 2 domain-containing... 41 0.019
gi|9280326|dbj|BAB01705.1| unnamed protein product [Arabidopsis ... 41 0.019
gi|32141270|ref|NP_733671.1| probable translational initiation f... 41 0.019
gi|7800650|gb|AAF70096.1| PspA [Streptococcus pneumoniae] 41 0.019
gi|37535948|ref|NP_922276.1| hypothetical protein [Oryza sativa ... 41 0.019
gi|15230275|ref|NP_188537.1| cell wall protein-related [Arabidop... 41 0.019
gi|16332325|ref|NP_443053.1| eukaryotic protein kinase [Synechoc... 41 0.019
gi|25412275|pir||F84643 hypothetical protein At2g25050 [imported... 41 0.019
gi|32421981|ref|XP_331434.1| hypothetical protein [Neurospora cr... 41 0.025
gi|41529174|dbj|BAD08434.1| NFBD1 [Sus scrofa] 41 0.025
gi|16306780|gb|AAH01584.1| LOC124245 protein [Homo sapiens] 41 0.025
gi|423935|pir||A46194 neurofilament protein NF-220, high-molecul... 41 0.025
gi|16552089|dbj|BAB71237.1| unnamed protein product [Homo sapiens] 41 0.025
gi|46109930|ref|XP_382023.1| hypothetical protein FG01847.1 [Gib... 41 0.025
gi|31377595|ref|NP_653205.2| hypothetical protein BC001584 [Homo... 41 0.025
gi|26341694|dbj|BAC34509.1| unnamed protein product [Mus musculus] 40 0.032
gi|7800652|gb|AAF70097.1| PspA [Streptococcus pneumoniae] 40 0.032
gi|46229608|gb|EAK90426.1| sgnal peptide, large secreted protein... 40 0.032
gi|100687|pir||S20500 hydroxyproline-rich glycoprotein - rice >g... 40 0.032
gi|28481366|ref|XP_139295.2| similar to caspase recruitment doma... 40 0.032
gi|15828864|ref|NP_326224.1| conserved hypothetical protein [Myc... 40 0.032
gi|42407859|dbj|BAD09001.1| putative AT hook-containing MAR bind... 40 0.032
gi|9631714|ref|NP_048493.1| Pro-rich protein; PAPK (24X); simila... 40 0.032
gi|7800646|gb|AAF70094.1| PspA [Streptococcus pneumoniae] 40 0.032
gi|26342987|dbj|BAC35150.1| unnamed protein product [Mus musculus] 40 0.032
gi|6752377|gb|AAF27699.1| PspA [Streptococcus pneumoniae] 40 0.032
gi|50293285|ref|XP_449054.1| unnamed protein product [Candida gl... 40 0.042
gi|34912294|ref|NP_917494.1| putative extensin-like protein [Ory... 40 0.042
gi|41407141|ref|NP_959977.1| SecD [Mycobacterium avium subsp. pa... 40 0.042
gi|23469539|ref|ZP_00124873.1| COG0810: Periplasmic protein TonB... 40 0.042
gi|6523547|emb|CAB62280.1| hydroxyproline-rich glycoprotein DZ-H... 40 0.042
gi|38345019|emb|CAD41511.2| OSJNBa0029H02.3 [Oryza sativa (japon... 40 0.042
gi|48851146|ref|ZP_00305388.1| hypothetical protein Saro02001182... 40 0.042
gi|49074320|ref|XP_401302.1| hypothetical protein UM03687.1 [Ust... 40 0.042
gi|49522807|gb|AAH74646.1| Unknown (protein for MGC:69349) [Xeno... 40 0.042
gi|49092614|ref|XP_407768.1| hypothetical protein AN3631.2 [Aspe... 40 0.042
gi|50553346|ref|XP_504084.1| hypothetical protein [Yarrowia lipo... 40 0.042
gi|47226842|emb|CAG06684.1| unnamed protein product [Tetraodon n... 40 0.055
gi|21220053|ref|NP_625832.1| putative nicotinate-nucleotide-dime... 40 0.055
gi|1076802|pir||S49915 extensin-like protein - maize >gnl|BL_ORD... 40 0.055
gi|27372319|dbj|BAC53724.1| Piccolo [Mus musculus] 40 0.055
gi|21956190|gb|AAM83255.1| ARC105 [Xenopus laevis] 40 0.055
gi|26329615|dbj|BAC28546.1| unnamed protein product [Mus musculus] 40 0.055
gi|28194653|gb|AAO33588.1| putative extensin/nodulin protein [Ar... 40 0.055
gi|38084437|ref|XP_129030.2| synaptopodin [Mus musculus] 40 0.055
gi|25143299|ref|NP_492875.2| pre-mRNA splicing SR protein relate... 40 0.055
gi|27372317|dbj|BAC53723.1| Piccolo [Mus musculus] 40 0.055
gi|47123917|gb|AAH70536.1| ARC105 protein [Xenopus laevis] 40 0.055
gi|28572767|ref|NP_789547.1| proline/alanine-rich repetetive mem... 40 0.055
gi|9629749|ref|NP_045241.1| 24 [Equine herpesvirus 4] >gnl|BL_OR... 40 0.055
gi|29150357|gb|AAO72366.1| hypothetical protein [Oryza sativa (j... 40 0.055
gi|4033606|dbj|BAA35135.1| Extensin [Adiantum capillus-veneris] 40 0.055
gi|18266041|gb|AAL67433.1| anther-specific proline-rich protein ... 39 0.072
gi|21312134|ref|NP_056973.2| positive cofactor 2, glutamine/Q-ri... 39 0.072
gi|50553702|ref|XP_504262.1| hypothetical protein [Yarrowia lipo... 39 0.072
gi|49486827|ref|YP_044048.1| membrane anchored protein [Staphylo... 39 0.072
gi|38605837|emb|CAE02917.3| OSJNBb0108J11.9 [Oryza sativa (japon... 39 0.072
gi|47678605|emb|CAG30423.1| PCQAP [Homo sapiens] 39 0.072
gi|14043091|gb|AAH07529.1| Unknown (protein for IMAGE:3350171) [... 39 0.072
gi|26247582|ref|NP_753622.1| TonB protein [Escherichia coli CFT0... 39 0.072
gi|45708378|gb|AAH03078.1| Unknown (protein for IMAGE:3504608) [... 39 0.072
gi|11277479|pir||T45505 membrane protein [imported] - Escherichi... 39 0.072
gi|3037135|gb|AAC12944.1| TPA inducible protein [Homo sapiens] 39 0.072
gi|902464|gb|AAB60141.1| membrane protein 39 0.072
gi|27817931|dbj|BAC55695.1| putative diaphanous homologue [Oryza... 39 0.072
gi|38099663|gb|EAA46978.1| predicted protein [Magnaporthe grisea... 39 0.072
gi|99861|pir||S20790 extensin - almond >gnl|BL_ORD_ID|432680 gi|... 39 0.072
gi|2565065|gb|AAB91443.1| CTG7a [Homo sapiens] 39 0.072
gi|49094744|ref|XP_408833.1| hypothetical protein AN4696.2 [Aspe... 39 0.072
gi|14276857|gb|AAK58423.1| PC2-glutamine-rich-associated protein... 39 0.072
gi|28374176|gb|AAH46263.1| LOC398566 protein [Xenopus laevis] 39 0.072
gi|48763011|ref|ZP_00267568.1| COG1426: Uncharacterized protein ... 39 0.072
gi|21748618|dbj|BAC03446.1| FLJ00386 protein [Homo sapiens] 39 0.072
gi|27734440|sp|Q96RN5|PCAP_HUMAN Positive cofactor 2 glutamine/Q... 39 0.072
gi|23270751|gb|AAH17110.1| PCQAP protein [Homo sapiens] 39 0.072
gi|15807282|ref|NP_296012.1| cell wall glycyl-glycine endopeptid... 39 0.094
gi|50546172|ref|XP_500613.1| hypothetical protein [Yarrowia lipo... 39 0.094
gi|6469849|gb|AAF13457.1| unknown [Streptococcus pneumoniae] 39 0.094
gi|32410433|ref|XP_325697.1| predicted protein [Neurospora crass... 39 0.094
gi|6119851|gb|AAF04257.1| subtilisin-like serine protease [Neosp... 39 0.094
gi|6752393|gb|AAF27707.1| PspA [Streptococcus pneumoniae] 39 0.094
gi|34912306|ref|NP_917500.1| P0451D05.16 [Oryza sativa (japonica... 39 0.094
gi|32405704|ref|XP_323465.1| related to TGF beta receptor associ... 39 0.094
gi|15235668|ref|NP_193070.1| leucine-rich repeat family protein ... 39 0.094
gi|15021840|dbj|BAB62199.1| hypothetical protein [Macaca fascicu... 39 0.094
gi|17939907|emb|CAD19511.1| UL36 protein [Suid herpesvirus 1 str... 39 0.094
gi|49095848|ref|XP_409385.1| predicted protein [Aspergillus nidu... 39 0.12
gi|48765098|ref|ZP_00269649.1| hypothetical protein Rrub02001848... 39 0.12
gi|30575592|gb|AAP33082.1| M-like protein [Streptococcus equi su... 39 0.12
gi|47087423|ref|NP_998607.1| zgc:63802 [Danio rerio] >gnl|BL_ORD... 39 0.12
gi|46318605|ref|ZP_00219047.1| COG0810: Periplasmic protein TonB... 39 0.12
gi|10048483|ref|NP_064483.1| multidomain presynaptic cytomatrix ... 39 0.12
gi|1749842|emb|CAB02634.1| cell wall protein [Yarrowia lipolytica] 39 0.12
gi|21355745|ref|NP_647902.1| CG15021-PA [Drosophila melanogaster... 39 0.12
gi|50756601|ref|XP_415235.1| PREDICTED: hypothetical protein XP_... 39 0.12
gi|49139656|ref|XP_413567.1| predicted protein [Aspergillus nidu... 39 0.12
gi|7949115|ref|NP_058079.1| Ser/Arg-related nuclear matrix prote... 39 0.12
gi|39594556|emb|CAE72134.1| Hypothetical protein CBG19232 [Caeno... 39 0.12
gi|29831038|ref|NP_825672.1| hypothetical protein SAV4495 [Strep... 39 0.12
gi|15241187|ref|NP_197482.1| proline-rich extensin-like family p... 39 0.12
gi|7493836|gb|AAF07822.2| multidomain presynaptic cytomatrix pro... 39 0.12
gi|38107960|gb|EAA54062.1| hypothetical protein MG02047.4 [Magna... 38 0.16
gi|50257409|gb|EAL20118.1| hypothetical protein CNBF4440 [Crypto... 38 0.16
gi|728868|sp|P40603|APG_BRANA ANTER-SPECIFIC PROLINE-RICH PROTEI... 38 0.16
gi|5668598|gb|AAD45972.1| Wiskott-Aldrich syndrome protein inter... 38 0.16
gi|13124642|sp|O43516|WAIP_HUMAN Wiskott-Aldrich syndrome protei... 38 0.16
gi|38373695|ref|NP_003378.3| WASP-interacting protein [Homo sapi... 38 0.16
gi|20803875|emb|CAD31453.1| PROBABLE VIRB10 TYPE IV SECRETION PR... 38 0.16
gi|39933290|ref|NP_945566.1| possible OmpA family member [Rhodop... 38 0.16
gi|41386747|ref|NP_958819.1| conserved nuclear protein Nhn1 [Rat... 38 0.16
gi|34872074|ref|XP_233556.2| similar to Ser/Arg-related nuclear ... 38 0.16
gi|15805485|ref|NP_294181.1| hypothetical protein [Deinococcus r... 38 0.16
gi|34365161|emb|CAE45928.1| hypothetical protein [Homo sapiens] 38 0.16
gi|2760483|emb|CAA60014.1| SH3-domain interacting protein [Homo ... 38 0.16
gi|5031925|ref|NP_005798.1| proteoglycan 4; megakaryocyte stimul... 38 0.16
gi|13559026|emb|CAC36090.1| bG174L6.2 (MSF: megakaryocyte stimul... 38 0.16
gi|7939576|dbj|BAA95777.1| unnamed protein product [Arabidopsis ... 38 0.16
gi|27764305|emb|CAD60585.1| unnamed protein product [Podospora a... 38 0.16
gi|9631636|ref|NP_048415.1| contains Pro-rich Px motif EPSPEPxP ... 38 0.16
gi|22331124|ref|NP_188306.2| WD-40 repeat family protein [Arabid... 38 0.16
gi|1085374|pir||S52796 prpL2 protein - human (fragment) 38 0.16
gi|7715587|gb|AAF68105.1| PspA [Streptococcus pneumoniae] 38 0.16
gi|40807643|gb|AAR92227.1| Nhn1A [Rattus norvegicus] 38 0.16
gi|34393260|dbj|BAC83130.1| hypothetical protein [Oryza sativa (... 38 0.21
gi|15222149|ref|NP_175372.1| leucine-rich repeat family protein ... 38 0.21
gi|47214568|emb|CAG13290.1| unnamed protein product [Tetraodon n... 38 0.21
gi|47214717|emb|CAG01070.1| unnamed protein product [Tetraodon n... 38 0.21
gi|49250498|gb|AAH74706.1| Unknown (protein for MGC:69441) [Xeno... 38 0.21
gi|49074872|ref|XP_401539.1| hypothetical protein UM03924.1 [Ust... 38 0.21
gi|47208817|emb|CAF89840.1| unnamed protein product [Tetraodon n... 38 0.21
gi|24654374|ref|NP_725663.1| CG30458-PA [Drosophila melanogaster... 38 0.21
gi|15965541|ref|NP_385894.1| HYPOTHETICAL PROTEIN SMc00484 [Sino... 38 0.21
gi|20259488|gb|AAM13864.1| unknown protein [Arabidopsis thaliana] 38 0.21
gi|50255340|gb|EAL18075.1| hypothetical protein CNBK0960 [Crypto... 38 0.21
gi|14582310|gb|AAK69446.1| proline-rich protein-2 [Gossypium hir... 38 0.21
gi|39593575|emb|CAE61867.1| Hypothetical protein CBG05845 [Caeno... 38 0.21
gi|23274133|gb|AAH36187.1| Serine/arginine repetitive matrix 1 [... 38 0.21
gi|42542379|ref|NP_005830.2| serine/arginine repetitive matrix 1... 38 0.21
gi|47847534|dbj|BAD21439.1| mFLJ00419 protein [Mus musculus] 38 0.21
gi|46442517|gb|EAL01806.1| hypothetical protein CaO19.4334 [Cand... 38 0.21
gi|30685162|ref|NP_188532.2| leucine-rich repeat family protein ... 38 0.21
gi|46188056|ref|ZP_00125993.2| COG0810: Periplasmic protein TonB... 38 0.21
gi|29826652|ref|NP_821286.1| hypothetical protein SAV112 [Strept... 38 0.21
gi|25404764|pir||D96711 hypothetical protein F24J5.8 [imported] ... 38 0.21
gi|3005587|gb|AAC09321.1| Ser/Arg-related nuclear matrix protein... 38 0.21
gi|22788859|ref|NP_690573.1| hypothetical protein HZV_154 [Helio... 38 0.21
gi|25056007|gb|AAD55980.2| extensin-like protein [Zea mays] 37 0.27
gi|17570087|ref|NP_508337.1| predicted CDS, putative nuclear pro... 37 0.27
gi|15223790|ref|NP_173441.1| family II extracellular lipase, put... 37 0.27
gi|21619874|gb|AAH33132.1| Unknown (protein for IMAGE:3615066) [... 37 0.27
gi|46108736|ref|XP_381426.1| hypothetical protein FG01250.1 [Gib... 37 0.27
gi|31418179|gb|AAH52955.1| Unknown (protein for MGC:48327) [Homo... 37 0.27
gi|8163689|gb|AAF73803.1| surface protein PspC [Streptococcus pn... 37 0.27
gi|33944943|ref|XP_340619.1| hypothetical protein Tb927.2.5200 [... 37 0.27
gi|6752403|gb|AAF27712.1| PspA [Streptococcus pneumoniae] 37 0.27
gi|46314246|ref|ZP_00214833.1| COG3070: Regulator of competence-... 37 0.27
gi|26329129|dbj|BAC28303.1| unnamed protein product [Mus musculus] 37 0.27
gi|6752401|gb|AAF27711.1| PspA [Streptococcus pneumoniae] 37 0.27
gi|38100429|gb|EAA47559.1| hypothetical protein MG02802.4 [Magna... 37 0.27
gi|39579858|emb|CAE56438.1| Hypothetical protein CBG24139 [Caeno... 37 0.27
gi|21431729|sp|P40602|APG_ARATH Anter-specific proline-rich prot... 37 0.27
gi|23506121|gb|AAN28957.1| Wal1 protein [Eremothecium gossypii] 37 0.27
gi|6651071|gb|AAF22162.1| disintegrin and metalloproteinase doma... 37 0.27
gi|15900059|ref|NP_344663.1| pneumococcal surface protein A [Str... 37 0.27
gi|46981287|gb|AAT07605.1| hypothetical protein [Oryza sativa (j... 37 0.27
gi|20137476|sp|Q9H013|AD19_HUMAN ADAM 19 precursor (A disintegri... 37 0.27
gi|15451842|ref|NP_075525.2| a disintegrin and metalloproteinase... 37 0.27
gi|48847750|ref|ZP_00301999.1| hypothetical protein Saro02003633... 37 0.27
gi|31232507|ref|XP_318717.1| ENSANGP00000004655 [Anopheles gambi... 37 0.27
gi|33946269|ref|NP_003932.2| Wiskott-Aldrich syndrome gene-like ... 37 0.27
gi|15451844|ref|NP_150377.1| a disintegrin and metalloproteinase... 37 0.27
gi|25511649|pir||A86335 T20H2.9 protein - Arabidopsis thaliana >... 37 0.27
gi|12053591|emb|CAC20585.1| meltrin-beta/ADAM 19 homologue [Homo... 37 0.27
gi|8163699|gb|AAF73809.1| surface protein PspC [Streptococcus pn... 37 0.27
gi|4097980|gb|AAD00184.1| surface protein C [Streptococcus pneum... 37 0.27
gi|26331226|dbj|BAC29343.1| unnamed protein product [Mus musculus] 37 0.36
gi|50545139|ref|XP_500107.1| hypothetical protein [Yarrowia lipo... 37 0.36
gi|15219860|ref|NP_176303.1| proline-rich family protein [Arabid... 37 0.36
gi|4757118|emb|CAB42096.1| TashAT2 protein [Theileria annulata] 37 0.36
gi|24641923|ref|NP_572941.1| CG11584-PB [Drosophila melanogaster... 37 0.36
gi|31207243|ref|XP_312588.1| ENSANGP00000014942 [Anopheles gambi... 37 0.36
gi|7242949|dbj|BAA92535.1| KIAA1297 protein [Homo sapiens] 37 0.36
gi|7509716|pir||T26767 hypothetical protein Y39G8B.b - Caenorhab... 37 0.36
gi|46125311|ref|XP_387209.1| hypothetical protein FG07033.1 [Gib... 37 0.36
gi|1184100|gb|AAA87047.1| pistil extensin-like protein 37 0.36
gi|50660400|gb|AAT80901.1| striated muscle preferentially expres... 37 0.36
gi|28972415|dbj|BAC65661.1| mKIAA0820 protein [Mus musculus] 37 0.36
gi|8163684|gb|AAF73800.1| surface protein PspC [Streptococcus pn... 37 0.36
gi|27380359|ref|NP_771888.1| bll5248 [Bradyrhizobium japonicum U... 37 0.36
gi|38346101|emb|CAE01962.2| OSJNBa0085H03.3 [Oryza sativa (japon... 37 0.36
gi|27369922|ref|NP_766234.1| RIKEN cDNA 9630020E24 [Mus musculus... 37 0.36
gi|46226510|gb|EAK87504.1| large low complexity protein with rep... 37 0.36
gi|902428|gb|AAB60109.1| membrane protein >gnl|BL_ORD_ID|1838235... 37 0.36
gi|19924077|ref|NP_612547.1| dynamin 3; testicular dynamin [Ratt... 37 0.36
gi|33595893|ref|NP_883536.1| DNA polymerase III subunit Tau [Bor... 37 0.36
gi|21224064|ref|NP_629843.1| conserved hypothetical protein SC3C... 37 0.36
gi|13431960|sp|O00401|WASL_HUMAN Neural Wiskott-Aldrich syndrome... 37 0.47
gi|19353648|gb|AAH24584.1| 9630020E24Rik protein [Mus musculus] 37 0.47
gi|38373932|gb|AAR19207.1| MAP kinase kinase 1 [Podospora anserina] 37 0.47
gi|16760144|ref|NP_455761.1| TonB protein [Salmonella enterica s... 37 0.47
gi|48731168|ref|ZP_00264914.1| COG0810: Periplasmic protein TonB... 37 0.47
gi|6752397|gb|AAF27709.1| PspA [Streptococcus pneumoniae] 37 0.47
gi|22093906|gb|AAM91820.1| choriogenin H [Oryzias latipes] 37 0.47
gi|49080772|ref|XP_403867.1| predicted protein [Ustilago maydis ... 37 0.47
gi|15145803|gb|AAK83527.1| hydroxyproline-rich glycoprotein VSP4... 37 0.47
gi|32410255|ref|XP_325608.1| hypothetical protein [Neurospora cr... 37 0.47
gi|13676582|gb|AAK38176.1| TonB [Salmonella typhi] 37 0.47
gi|85789|pir||A30484 histone H5B - African clawed frog 37 0.47
gi|25028434|ref|NP_738488.1| putative translation initiation fac... 37 0.47
gi|102984|pir||S10120 Balbiani ring protein 1-beta (clone 18-1) ... 37 0.47
gi|102985|pir||S10119 Balbiani ring protein 1-beta (clone 16-5) ... 37 0.47
gi|2104549|gb|AAB57798.1| AGAA.3 [Arabidopsis thaliana] 37 0.47
gi|23893325|emb|CAC79956.1| TonB protein [Pantoea agglomerans] 37 0.47
gi|40787890|ref|NP_954911.1| UL36 very large tegument protein [B... 37 0.47
gi|11095327|gb|AAG29834.1| unknown [Paracoccus pantotrophus] 37 0.47
gi|26000243|gb|AAN75564.1| adhesin FhaB [Bordetella avium] 37 0.47
gi|21222202|ref|NP_627981.1| hypothetical protein SCH63.38 [Stre... 37 0.47
gi|47212433|emb|CAF94183.1| unnamed protein product [Tetraodon n... 37 0.47
gi|38455896|gb|AAR20917.1| A12 protein [Pneumocystis carinii f. ... 37 0.47
gi|39584398|emb|CAE72536.1| Hypothetical protein CBG19716 [Caeno... 37 0.47
gi|45645179|sp|Q01443|SSP2_PLAYO Sporozoite surface protein 2 pr... 37 0.47
gi|21326031|gb|AAM47576.1| choriogenin H [Oryzias latipes] 37 0.47
gi|31197331|ref|XP_307613.1| ENSANGP00000002211 [Anopheles gambi... 37 0.47
gi|15235223|ref|NP_192116.1| DNA mismatch repair protein MSH6-1 ... 37 0.47
gi|25029487|ref|NP_739541.1| putative membrane protein [Coryneba... 37 0.47
gi|25453525|pir||T52340 cell wall-plasma membrane linker protein... 37 0.47
gi|32698750|ref|NP_067051.1| serine arginine-rich pre-mRNA splic... 36 0.61
gi|22299765|ref|NP_683012.1| serine/threonine protein kinase [Th... 36 0.61
gi|9438033|gb|AAF87552.1| ser/arg-rich pre-mRNA splicing factor ... 36 0.61
gi|16765081|ref|NP_460696.1| periplasmic protein [Salmonella typ... 36 0.61
gi|1076556|pir||S54156 extensin-like protein - cowpea (fragment)... 36 0.61
gi|38081315|ref|XP_359129.1| similar to G protein-coupled recept... 36 0.61
gi|12225134|gb|AAG47878.1| TonB [Klebsiella pneumoniae] 36 0.61
gi|20891927|ref|XP_147188.1| positive cofactor 2, multiprotein c... 36 0.61
gi|7488885|pir||T11671 extensin-like protein 127 - cowpea (fragm... 36 0.61
gi|46108228|ref|XP_381172.1| hypothetical protein FG00996.1 [Gib... 36 0.61
gi|34869806|ref|XP_341016.1| similar to Pcqap protein [Rattus no... 36 0.61
gi|9631626|ref|NP_048405.1| contains Pro-rich Px motifs: SPKPP (... 36 0.61
gi|50257445|gb|EAL20152.1| hypothetical protein CNBF2290 [Crypto... 36 0.61
gi|37531440|ref|NP_920022.1| putative hydroxyproline-rich glycop... 36 0.61
gi|20177999|sp|Q924H2|PCAP_MOUSE Positive cofactor 2 glutamine/Q... 36 0.61
gi|13357602|ref|NP_077876.1| unique hypothetical [Ureaplasma par... 36 0.61
gi|9630030|ref|NP_046248.1| unknown [Orgyia pseudotsugata multic... 36 0.61
gi|29612457|gb|AAH49891.1| Pcqap protein [Mus musculus] 36 0.61
gi|29832687|ref|NP_827321.1| hypothetical protein SAV6145 [Strep... 36 0.61
gi|50759930|ref|XP_425775.1| PREDICTED: similar to Ser/Arg-relat... 36 0.61
gi|84852|pir||A05231 Balbiani ring b chain - midge (Chironomus t... 36 0.61
gi|32488400|emb|CAE02825.1| OSJNBa0043A12.30 [Oryza sativa (japo... 36 0.61
gi|21222971|ref|NP_628750.1| hypothetical protein SCD20.06 [Stre... 36 0.61
gi|7715573|gb|AAF68098.1| PspA [Streptococcus pneumoniae] 36 0.61
gi|228937|prf||1814452B Hyp-rich glycoprotein 36 0.61
gi|11279167|pir||T50744 spheroidene monooxygenase [imported] - R... 36 0.61
gi|48844267|ref|ZP_00298589.1| hypothetical protein Gmet02003255... 36 0.61
gi|37530618|ref|NP_919611.1| unknown protein [Oryza sativa (japo... 36 0.61
gi|15809028|ref|NP_291087.1| positive cofactor 2, glutamine/Q-ri... 36 0.61
gi|7715571|gb|AAF68097.1| PspA [Streptococcus pneumoniae] 36 0.61
gi|10440402|dbj|BAB15734.1| FLJ00034 protein [Homo sapiens] 36 0.61
gi|8163634|gb|AAF73774.1| surface protein PspC [Streptococcus pn... 36 0.61
gi|32451779|gb|AAH54779.1| Pcqap protein [Mus musculus] 36 0.61
gi|34904188|ref|NP_913441.1| putative polyprotein [Oryza sativa ... 36 0.61
gi|902419|gb|AAB60101.1| membrane protein 36 0.61
gi|47847528|dbj|BAD21436.1| mFLJ00386 protein [Mus musculus] 36 0.61
gi|96862|pir||S13257 tonB protein - Salmonella typhimurium 36 0.61
gi|15235186|ref|NP_195123.1| leucine-rich repeat family protein ... 36 0.61
gi|50555714|ref|XP_505265.1| hypothetical protein [Yarrowia lipo... 36 0.61
gi|13592175|gb|AAK31375.1| ppg3 [Leishmania major] 36 0.61
gi|39581822|emb|CAE60715.1| Hypothetical protein CBG04386 [Caeno... 36 0.61
gi|19881600|gb|AAM01001.1| Hypothetical protein [Oryza sativa] 36 0.61
gi|37523969|ref|NP_927346.1| similar to rod shape-determining pr... 36 0.61
gi|38100391|gb|EAA47526.1| hypothetical protein MG02769.4 [Magna... 36 0.61
gi|42522518|ref|NP_967898.1| hypothetical protein predicted by G... 36 0.61
gi|50547899|ref|XP_501419.1| hypothetical protein [Yarrowia lipo... 35 0.74
gi|32404378|ref|XP_322802.1| predicted protein [Neurospora crass... 36 0.79
gi|34880471|ref|XP_213903.2| similar to This gene is isolated by... 36 0.79
gi|81286|pir||S22697 extensin - Volvox carteri (fragment) >gnl|B... 36 0.79
gi|5739425|gb|AAD50466.1| TonB [Klebsiella pneumoniae] >gnl|BL_O... 36 0.79
gi|5739435|gb|AAD50476.1| TonB [Klebsiella pneumoniae] 36 0.79
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ... 36 0.79
gi|15889177|ref|NP_354858.1| AGR_C_3445p [Agrobacterium tumefaci... 36 0.79
gi|902446|gb|AAB60125.1| membrane protein 36 0.79
gi|34915050|ref|NP_918872.1| extensin-like protein [Oryza sativa... 36 0.79
gi|24645909|ref|NP_650064.1| CG5214-PA [Drosophila melanogaster]... 36 0.79
gi|47211422|emb|CAF92698.1| unnamed protein product [Tetraodon n... 36 0.79
gi|122108|sp|P22844|H5A_XENLA Histone H5A (XLH5A) (H1D) (H1-SA) ... 36 0.79
gi|49075076|ref|XP_401628.1| hypothetical protein UM04013.1 [Ust... 36 0.79
gi|47498062|ref|NP_998836.1| hypothetical protein MGC69214 [Xeno... 36 0.79
gi|33326195|gb|AAQ08507.1| Szp protein [Streptococcus equi subsp... 36 0.79
gi|38103281|gb|EAA49996.1| hypothetical protein MG03755.4 [Magna... 36 0.79
gi|47221182|emb|CAG05503.1| unnamed protein product [Tetraodon n... 36 0.79
gi|9629838|ref|NP_045322.1| very large virion protein (tegument)... 36 0.79
gi|21686698|ref|NP_663198.1| occlusion derived virus envelope pr... 36 0.79
gi|12854146|dbj|BAB29941.1| unnamed protein product [Mus musculus] 36 0.79
gi|347457|gb|AAA33972.1| hydroxyproline-rich glycoprotein 36 0.79
gi|45508028|ref|ZP_00160369.1| hypothetical protein Avar297201 [... 36 0.79
gi|33326163|gb|AAQ08491.1| Szp protein [Streptococcus equi subsp... 36 0.79
gi|15217339|gb|AAK92677.1| putative heat shock protein [Oryza sa... 36 0.79
gi|99694|pir||S21961 proline-rich protein APG - Arabidopsis thal... 36 0.79
gi|27673011|ref|XP_220573.1| similar to platelet glycoprotein Ib... 36 0.79
gi|47211975|emb|CAF95297.1| unnamed protein product [Tetraodon n... 36 0.79
gi|37953323|gb|AAP44493.1| aggrecan [Bos taurus] 36 0.79
gi|50121243|ref|YP_050410.1| TonB protein [Erwinia carotovora su... 36 0.79
gi|12275264|emb|CAC22282.1| WASP interacting protein [Rattus nor... 36 0.79
gi|48675858|ref|NP_476540.2| Wiskott-Aldrich syndrome protein in... 36 0.79
gi|23473316|ref|ZP_00128612.1| COG3064: Membrane protein involve... 36 0.79
gi|50732371|ref|XP_418604.1| PREDICTED: hypothetical protein XP_... 36 0.79
gi|46128709|ref|XP_388908.1| hypothetical protein FG08732.1 [Gib... 36 0.79
gi|16553793|dbj|BAB71593.1| unnamed protein product [Homo sapiens] 36 0.79
gi|1076205|pir||S50754 hypothetical protein WP6 - Chlamydomonas ... 36 0.79
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 36 0.79
gi|15801478|ref|NP_287495.1| energy transducer; uptake of iron, ... 36 0.79
gi|15831006|ref|NP_309779.1| TonB; energy transducer [Escherichi... 36 0.79
gi|17537803|ref|NP_495202.1| putative protein (2G313) [Caenorhab... 36 0.79
gi|15222464|ref|NP_174461.1| formin homology 2 domain-containing... 36 0.79
gi|33863795|ref|NP_895355.1| Translation initiation factor IF-2 ... 36 0.79
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro... 36 0.79
gi|42658934|ref|XP_379601.1| hypothetical protein XP_379601 [Hom... 36 0.79
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo... 36 0.79
gi|9802525|gb|AAF99727.1| F17L21.7 [Arabidopsis thaliana] 32 0.94
gi|8163662|gb|AAF73789.1| surface protein PspC [Streptococcus pn... 35 1.0
gi|48475204|gb|AAT44273.1| hypothetical protein [Oryza sativa (j... 35 1.0
gi|42544243|ref|NP_056384.2| dynamin 3; dynamin family member [H... 35 1.0
gi|15320736|ref|NP_203248.1| unknown [Epiphyas postvittana nucle... 35 1.0
gi|30062775|ref|NP_836946.1| membrane protein, energy transducer... 35 1.0
gi|15220780|ref|NP_176434.1| leucine-rich repeat family protein ... 35 1.0
gi|13357600|ref|NP_077874.1| unique hypothetical [Ureaplasma par... 35 1.0
gi|37541569|ref|XP_040592.4| zinc finger protein 469 [Homo sapiens] 35 1.0
gi|46203833|ref|ZP_00050914.2| COG0457: FOG: TPR repeat [Magneto... 35 1.0
gi|5739440|gb|AAD50481.1| TonB [Klebsiella pneumoniae] 35 1.0
gi|39936159|ref|NP_948435.1| conserved unknown protein [Rhodopse... 35 1.0
gi|12225150|gb|AAG47886.1| TonB [Klebsiella pneumoniae] 35 1.0
gi|5739424|gb|AAD50465.1| TonB [Klebsiella pneumoniae] >gnl|BL_O... 35 1.0
gi|5739437|gb|AAD50478.1| TonB [Klebsiella pneumoniae] 35 1.0
gi|12225138|gb|AAG47880.1| TonB [Klebsiella pneumoniae] 35 1.0
gi|5739431|gb|AAD50472.1| TonB [Klebsiella pneumoniae] >gnl|BL_O... 35 1.0
gi|5739426|gb|AAD50467.1| TonB [Klebsiella pneumoniae] >gnl|BL_O... 35 1.0
gi|5739428|gb|AAD50469.1| TonB [Klebsiella pneumoniae] >gnl|BL_O... 35 1.0
gi|23468469|ref|ZP_00123804.1| COG3468: Type V secretory pathway... 35 1.0
gi|49067228|ref|XP_397904.1| hypothetical protein UM00289.1 [Ust... 35 1.0
gi|33326161|gb|AAQ08490.1| Szp protein [Streptococcus equi subsp... 35 1.0
gi|46108470|ref|XP_381293.1| hypothetical protein FG01117.1 [Gib... 35 1.0
gi|6752966|ref|NP_033746.1| a disintegrin and metalloprotease do... 35 1.0
gi|9629583|ref|NP_044888.1| glycoprotein 150 [murid herpesvirus ... 35 1.0
gi|38606520|emb|CAE05997.2| OSJNBa0016O02.7 [Oryza sativa (japon... 35 1.0
gi|34903678|ref|NP_913186.1| B1015E06.24 [Oryza sativa (japonica... 35 1.0
gi|34393221|dbj|BAC82935.1| hypothetical protein [Oryza sativa (... 35 1.0
gi|48860301|ref|ZP_00314226.1| COG1716: FOG: FHA domain [Clostri... 35 1.0
gi|9719456|gb|AAF97810.1| transposase [Cryphonectria parasitica] 35 1.0
gi|15226398|ref|NP_180411.1| proline-rich family protein [Arabid... 35 1.0
gi|14290535|gb|AAH09036.1| Unknown (protein for IMAGE:4155841) [... 35 1.0
gi|50552530|ref|XP_503675.1| hypothetical protein [Yarrowia lipo... 35 1.0
gi|38102962|gb|EAA49733.1| predicted protein [Magnaporthe grisea... 35 1.0
gi|3914142|sp|P93329|NO20_MEDTR EARLY NODULIN 20 PRECURSOR (N-20... 35 1.0
gi|28493125|ref|NP_787286.1| unknown [Tropheryma whipplei str. T... 35 1.0
gi|33600424|ref|NP_887984.1| DNA polymerase III subunit Tau [Bor... 35 1.0
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [... 35 1.0
gi|27805466|sp|Q9UQ16|DYN3_HUMAN Dynamin 3 (Dynamin, testicular)... 35 1.0
gi|34393619|dbj|BAC83295.1| hypothetical protein [Oryza sativa (... 35 1.0
gi|1075556|pir||S49619 crtA protein - Rhodobacter sphaeroides >g... 35 1.0
gi|34877775|ref|XP_346074.1| similar to alpha 3 type VI collagen... 35 1.0
gi|7484956|pir||T01456 extensin homolog F24O1.18 - Arabidopsis t... 35 1.0
gi|24112651|ref|NP_707161.1| membrane protein [Shigella flexneri... 35 1.0
gi|38105982|gb|EAA52344.1| hypothetical protein MG05036.4 [Magna... 35 1.0
gi|7486500|pir||T04739 hypothetical protein F6G17.100 - Arabidop... 35 1.0
gi|32407898|ref|XP_324443.1| predicted protein [Neurospora crass... 35 1.0
gi|26987981|ref|NP_743406.1| conserved domain protein [Pseudomon... 35 1.0
gi|45433535|ref|NP_957353.2| Wiskott-Aldrich syndrome-like [Dani... 35 1.0
gi|33326177|gb|AAQ08498.1| Szp protein [Streptococcus equi subsp... 35 1.0
gi|48835163|ref|ZP_00292164.1| COG0455: ATPases involved in chro... 35 1.0
gi|28279905|gb|AAH44180.1| Wiskott-Aldrich syndrome-like [Danio ... 35 1.0
gi|148023|gb|AAB59066.1| membrane protein (tonB) >gnl|BL_ORD_ID|... 35 1.0
gi|902437|gb|AAB60117.1| membrane protein 35 1.0
gi|902401|gb|AAB60085.1| membrane protein 35 1.0
gi|902410|gb|AAB60093.1| membrane protein 35 1.0
gi|15805326|ref|NP_294018.1| phosphoprotein phosphatase [Deinoco... 35 1.0
gi|46124235|ref|XP_386671.1| hypothetical protein FG06495.1 [Gib... 35 1.0
gi|50553410|ref|XP_504116.1| hypothetical protein [Yarrowia lipo... 35 1.0
gi|2133786|pir||I51116 NF-180 - sea lamprey >gnl|BL_ORD_ID|32563... 35 1.0
gi|20521666|dbj|BAA74843.2| KIAA0820 protein [Homo sapiens] 35 1.0
gi|47221831|emb|CAG08885.1| unnamed protein product [Tetraodon n... 35 1.0
gi|39584405|emb|CAE72543.1| Hypothetical protein CBG19727 [Caeno... 35 1.0
gi|18420042|ref|NP_568027.1| arabinogalactan-protein (AGP18) [Ar... 35 1.0
gi|7482002|pir||T18353 protein P97 - Mycoplasma hyopneumoniae >g... 35 1.0
gi|23508177|ref|NP_700847.1| gene 11-1 protein precursor [Plasmo... 35 1.0
gi|18859991|ref|NP_572962.1| CG9411-PA [Drosophila melanogaster]... 35 1.0
gi|16129213|ref|NP_415768.1| energy transducer; uptake of iron, ... 35 1.0
gi|50303721|ref|XP_451805.1| unnamed protein product [Kluyveromy... 35 1.0
gi|25149138|ref|NP_741212.1| putative mitochondrial protein (3I2... 35 1.4
gi|50557112|ref|XP_505964.1| hypothetical protein [Yarrowia lipo... 35 1.4
gi|32488418|emb|CAE02761.1| OSJNBb0085F13.8 [Oryza sativa (japon... 35 1.4
gi|32565823|ref|NP_872049.1| WH1 (2N946) [Caenorhabditis elegans... 35 1.4
gi|34866461|ref|XP_345993.1| similar to Chloride intracellular c... 35 1.4
gi|32487383|emb|CAE03136.1| OJ000114_01.17 [Oryza sativa (japoni... 35 1.4
gi|28867307|ref|NP_789926.1| tonB protein [Pseudomonas syringae ... 35 1.4
gi|46120816|ref|ZP_00172408.2| hypothetical protein Mflag021710 ... 35 1.4
gi|33326187|gb|AAQ08503.1| Szp protein [Streptococcus equi subsp... 35 1.4
gi|38107158|gb|EAA53372.1| predicted protein [Magnaporthe grisea... 35 1.4
gi|29830748|ref|NP_825382.1| putative two-component system senso... 35 1.4
gi|30349411|gb|AAP22285.1| M-like protein [Streptococcus equi su... 35 1.4
gi|33326185|gb|AAQ08502.1| Szp protein [Streptococcus equi subsp... 35 1.4
gi|33326171|gb|AAQ08495.1| Szp protein [Streptococcus equi subsp... 35 1.4
gi|30575590|gb|AAP33081.1| M-like protein [Streptococcus equi su... 35 1.4
gi|37051101|dbj|BAC81647.1| hydroxyproline-rich glycoprotein-2 [... 35 1.4
gi|33326175|gb|AAQ08497.1| Szp protein [Streptococcus equi subsp... 35 1.4
gi|34903028|ref|NP_912861.1| unnamed protein product [Oryza sati... 35 1.4
gi|16330139|ref|NP_440867.1| DNA polymerase III subunit [Synecho... 35 1.4
gi|8163724|gb|AAF73826.1| surface protein PcpC [Streptococcus pn... 35 1.4
gi|6694371|gb|AAF25206.1| EBNA2-like protein [cercopithicine her... 35 1.4
gi|20454847|sp|Q9BX69|CAR6_HUMAN Caspase recruitment domain prot... 35 1.4
gi|16554564|ref|NP_115976.2| caspase recruitment domain family, ... 35 1.4
gi|33326181|gb|AAQ08500.1| Szp protein [Streptococcus equi subsp... 35 1.4
>gi|17551288|ref|NP_509508.1| Neuropeptide-Like Protein (23.7 kD)
(nlp-14) [Caenorhabditis elegans]
gi|7498079|pir||T15878 hypothetical protein D1009.4 -
Caenorhabditis elegans
gi|1072172|gb|AAA81697.1| Neuropeptide-like protein protein 14
[Caenorhabditis elegans]
Length = 224
Score = 281 bits (718), Expect = 1e-74
Identities = 157/224 (70%), Positives = 157/224 (70%)
Frame = -1
Query: 675 MLHLIXXXXXXXXXVTAGRPRRAXXXXXXXXXXXDKRALNSLDGAGFGFEKRALNSLDGQ 496
MLHLI VTAGRPRRA DKRALNSLDGAGFGFEKRALNSLDGQ
Sbjct: 1 MLHLIVLLVALSSAVTAGRPRRALDGLDGSGFGFDKRALNSLDGAGFGFEKRALNSLDGQ 60
Query: 495 GFGFEKRXXXXXXXXXXXXDKRALNSLDGAGFGFEKRAXXXXXXXXXXXDKRALNSLDGA 316
GFGFEKR DKRALNSLDGAGFGFEKRA DKRALNSLDGA
Sbjct: 61 GFGFEKRALDGLDGAGFGFDKRALNSLDGAGFGFEKRALDGLDGSGFGFDKRALNSLDGA 120
Query: 315 GFGFEKRALNSLDGAGFGFEKRXXXXXXXXXXXXDKRALNSLDGAGFGFEKRXXXXXXXX 136
GFGFEKRALNSLDGAGFGFEKR DKRALNSLDGAGFGFEKR
Sbjct: 121 GFGFEKRALNSLDGAGFGFEKRALDGLDGAGFGFDKRALNSLDGAGFGFEKRALDGLDGA 180
Query: 135 XXXXDKRALNSLDGNGFGFDKRTFKHSSNKLRSVFRNLKGFKQH 4
DKRALNSLDGNGFGFDKRTFKHSSNKLRSVFRNLKGFKQH
Sbjct: 181 GFGFDKRALNSLDGNGFGFDKRTFKHSSNKLRSVFRNLKGFKQH 224