Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= D2013_2
(1083 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532677|ref|NP_495982.1| g-protein beta WD-40 repeat (42.3 k... 716 0.0
gi|39580638|emb|CAE72914.1| Hypothetical protein CBG20232 [Caeno... 374 e-102
gi|47217506|emb|CAG10886.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|50761511|ref|XP_424742.1| PREDICTED: similar to Cockayne synd... 47 6e-04
gi|50426037|ref|XP_461615.1| unnamed protein product [Debaryomyc... 47 8e-04
gi|23336935|gb|AAH37200.1| Cockayne syndrome 1 homolog [Mus musc... 46 0.002
gi|21312586|ref|NP_082318.1| Cockayne syndrome 1 homolog [Mus mu... 46 0.002
gi|18077663|emb|CAD20255.1| cockayne syndrome group A [Mus muscu... 46 0.002
gi|4557467|ref|NP_000073.1| Cockayne syndrome 1 protein [Homo sa... 45 0.002
gi|22329677|ref|NP_173405.2| transducin family protein / WD-40 r... 45 0.003
gi|25513636|pir||F86330 F6F9.19 protein - Arabidopsis thaliana >... 45 0.003
gi|49085702|ref|XP_404951.1| hypothetical protein AN0814.2 [Aspe... 45 0.004
gi|32422743|ref|XP_331815.1| hypothetical protein [Neurospora cr... 44 0.005
gi|19112099|ref|NP_595307.1| WD repeat protein; putative Microtu... 44 0.005
gi|46107554|ref|XP_380836.1| conserved hypothetical protein [Gib... 44 0.005
gi|38109766|gb|EAA55585.1| hypothetical protein MG01236.4 [Magna... 44 0.005
gi|19113046|ref|NP_596254.1| transcription initiation factor TFI... 44 0.005
gi|38567154|emb|CAE76448.1| related to cell cycle protein p55cdc... 44 0.005
gi|45200863|ref|NP_986433.1| AGL234Wp [Eremothecium gossypii] >g... 41 0.006
gi|22329825|ref|NP_174105.2| transducin family protein / WD-40 r... 44 0.007
gi|25513596|pir||E86403 28.2K hypothetical protein - Arabidopsis... 44 0.007
gi|37535172|ref|NP_921888.1| putative WD domain containing prote... 44 0.007
gi|39545918|gb|AAR28022.1| TAF5 [Arabidopsis thaliana] 44 0.007
gi|46441950|gb|EAL01243.1| hypothetical protein CaO19.7900 [Cand... 44 0.008
gi|46441813|gb|EAL01107.1| hypothetical protein CaO19.268 [Candi... 43 0.011
gi|26380573|dbj|BAC25439.1| unnamed protein product [Mus musculus] 43 0.014
gi|46119952|ref|ZP_00179225.2| COG2319: FOG: WD40 repeat [Crocos... 43 0.014
gi|23480360|gb|EAA16941.1| putative WD-40 repeat protein [Plasmo... 43 0.014
gi|15292283|gb|AAK93410.1| LD45447p [Drosophila melanogaster] 42 0.025
gi|24650871|ref|NP_651635.2| CG1523-PA [Drosophila melanogaster]... 42 0.025
gi|46137077|ref|XP_390230.1| hypothetical protein FG10054.1 [Gib... 42 0.025
gi|23508064|ref|NP_700734.1| hypothetical protein [Plasmodium fa... 42 0.032
gi|23612855|ref|NP_704394.1| hypothetical protein, conserved [Pl... 42 0.032
gi|19114087|ref|NP_593175.1| yeast coronin CRN1 homolog [Schizos... 42 0.032
gi|32413455|ref|XP_327207.1| hypothetical protein [Neurospora cr... 41 0.055
gi|50549369|ref|XP_502155.1| hypothetical protein [Yarrowia lipo... 40 0.072
gi|34854214|ref|XP_226789.2| similar to cockayne syndrome group ... 40 0.094
gi|38505813|ref|NP_942432.1| WD-repeat protein [Synechocystis sp... 40 0.094
gi|33146605|dbj|BAC79801.1| putative TATA box binding protein-as... 40 0.12
gi|48097292|ref|XP_391870.1| similar to ENSANGP00000017965 [Apis... 40 0.12
gi|46390704|dbj|BAD16204.1| putative cockayne syndrome 1 homolog... 40 0.12
gi|31202123|ref|XP_310009.1| ENSANGP00000015076 [Anopheles gambi... 40 0.12
gi|46226954|gb|EAK87920.1| WD repeat protein [Cryptosporidium pa... 40 0.12
gi|6978695|ref|NP_036664.1| ceruloplasmin; Ceruloplasmin (ferrox... 39 0.16
gi|92233|pir||A35210 ferroxidase (EC 1.16.3.1) precursor - rat 39 0.16
gi|34855491|ref|XP_215541.2| hypothetical protein XP_215541 [Rat... 39 0.16
gi|19075402|ref|NP_587902.1| tfiid subunit taf72p. [Schizosaccha... 39 0.16
gi|32411159|ref|XP_326060.1| hypothetical protein [Neurospora cr... 39 0.16
gi|2494901|sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 ... 39 0.16
gi|50547851|ref|XP_501395.1| hypothetical protein [Yarrowia lipo... 39 0.16
gi|6970046|gb|AAF34175.1| GPI-anchored ceruloplasmin [Rattus nor... 39 0.16
gi|30689741|ref|NP_197897.2| transducin family protein / WD-40 r... 39 0.21
gi|50405035|ref|YP_054127.1| Conserved WD40 and TPR repeat-conta... 39 0.21
gi|31203713|ref|XP_310805.1| ENSANGP00000014888 [Anopheles gambi... 39 0.21
gi|50420307|ref|XP_458687.1| unnamed protein product [Debaryomyc... 39 0.21
gi|6324322|ref|NP_014392.1| Required for amino acid permease tra... 39 0.27
gi|4505731|ref|NP_000279.1| peroxisomal biogenesis factor 7; per... 38 0.36
gi|45185206|ref|NP_982923.1| ABL024Wp [Eremothecium gossypii] >g... 38 0.36
gi|21595088|gb|AAH31606.1| PEX7 protein [Homo sapiens] 38 0.36
gi|50259595|gb|EAL22268.1| hypothetical protein CNBC4060 [Crypto... 38 0.47
gi|50742704|ref|XP_419724.1| PREDICTED: similar to peroxisomal P... 38 0.47
gi|18421178|ref|NP_568505.1| transducin family protein / WD-40 r... 38 0.47
gi|6319926|ref|NP_010007.1| General repressor of transcription (... 38 0.47
gi|173067|gb|AAA35182.1| TUP1 protein 38 0.47
gi|9955107|pdb|1ERJ|A Chain A, Crystal Structure Of The C-Termin... 38 0.47
gi|21553502|gb|AAM62595.1| unknown [Arabidopsis thaliana] 38 0.47
gi|4460|emb|CAA34411.1| unnamed protein product [Saccharomyces c... 38 0.47
gi|49084494|ref|XP_404442.1| hypothetical protein AN0305.2 [Aspe... 38 0.47
gi|50311657|ref|XP_455855.1| unnamed protein product [Kluyveromy... 37 0.61
gi|3298595|gb|AAC41376.1| fizzy1 [Xenopus laevis] 37 0.61
gi|50286567|ref|XP_445712.1| unnamed protein product [Candida gl... 37 0.61
gi|37572965|dbj|BAC98615.1| putative Trp-Asp repeat protein [Ory... 37 0.61
gi|50256589|gb|EAL19314.1| hypothetical protein CNBH4130 [Crypto... 37 0.61
gi|41724850|ref|ZP_00151660.1| COG2319: FOG: WD40 repeat [Dechlo... 37 0.79
gi|47212372|emb|CAF89937.1| unnamed protein product [Tetraodon n... 37 0.79
gi|50293335|ref|XP_449079.1| unnamed protein product [Candida gl... 37 0.79
gi|50259040|gb|EAL21719.1| hypothetical protein CNBC5830 [Crypto... 37 0.79
gi|49085686|ref|XP_404945.1| hypothetical protein AN0808.2 [Aspe... 37 0.79
gi|50289053|ref|XP_446956.1| unnamed protein product [Candida gl... 37 0.79
gi|49085854|ref|XP_405017.1| hypothetical protein AN0880.2 [Aspe... 37 0.79
gi|46436039|gb|EAK95409.1| hypothetical protein CaO19.3629 [Cand... 37 0.79
gi|47221369|emb|CAF97287.1| unnamed protein product [Tetraodon n... 37 0.79
gi|17555622|ref|NP_498151.1| g-protein beta WD-40 repeat (3G476)... 37 0.79
gi|50742535|ref|XP_419667.1| PREDICTED: similar to Nucleoporin N... 37 1.0
gi|34852639|ref|XP_218778.2| similar to peroxisomal PTS2 recepto... 37 1.0
gi|49095822|ref|XP_409372.1| hypothetical protein AN5235.2 [Aspe... 37 1.0
gi|42568637|ref|NP_200684.2| transducin family protein / WD-40 r... 36 1.4
gi|38111610|gb|EAA57164.1| hypothetical protein MG08133.4 [Magna... 36 1.4
gi|6679283|ref|NP_032848.1| peroxisome biogenesis factor 7 [Mus ... 36 1.4
gi|46432886|gb|EAK92349.1| hypothetical protein CaO19.6355 [Cand... 36 1.4
gi|4558462|gb|AAD22612.1| cell cycle switch protein [Medicago sa... 36 1.4
gi|7158292|gb|AAF37386.1| WD-repeat cell cycle regulatory protei... 36 1.4
gi|34897006|ref|NP_909849.1| unknown protein [Oryza sativa (japo... 36 1.4
gi|47223622|emb|CAF99231.1| unnamed protein product [Tetraodon n... 36 1.4
gi|50423917|ref|XP_460543.1| unnamed protein product [Debaryomyc... 36 1.4
gi|8843796|dbj|BAA97344.1| unnamed protein product [Arabidopsis ... 36 1.4
gi|5733806|gb|AAD49742.1| G protein beta subunit [Pisum sativum] 36 1.4
gi|22476946|gb|AAM97354.1| G protein beta subunit [Pisum sativum] 36 1.4
gi|4929352|gb|AAD33959.1| G protein beta subunit [Pisum sativum] 36 1.4
gi|19112601|ref|NP_595809.1| putative U3 small nucleolar RNA (U3... 36 1.8
gi|15240441|ref|NP_198060.1| WD-40 repeat family protein [Arabid... 36 1.8
gi|33860243|gb|AAQ54906.1| cell cycle switch protein CCS52a [Lup... 36 1.8
gi|46227206|gb|EAK88156.1| WD repeat protein [Cryptosporidium pa... 36 1.8
gi|50547673|ref|XP_501306.1| hypothetical protein [Yarrowia lipo... 36 1.8
gi|33860245|gb|AAQ54907.1| cell cycle switch protein CCS52a [Lup... 36 1.8
gi|50553638|ref|XP_504230.1| hypothetical protein [Yarrowia lipo... 36 1.8
gi|5732032|gb|AAD48933.1| contains similarity to Pfam family PF0... 36 1.8
gi|7485255|pir||T01768 hypothetical protein A_IG002P16.8 - Arabi... 35 2.3
gi|45188115|ref|NP_984338.1| ADR242Cp [Eremothecium gossypii] >g... 35 2.3
gi|48115068|ref|XP_396382.1| similar to EG:25E8.3 [Apis mellifera] 35 2.3
gi|5281319|gb|AAD41477.1| ceruloplasmin [Ovis aries] 35 2.3
gi|46562016|gb|AAT01224.1| katanin p80 subunit PF15p [Chlamydomo... 35 2.3
gi|18400003|ref|NP_564469.1| WD-40 repeat family protein [Arabid... 35 2.3
gi|29841234|gb|AAP06266.1| similar to GenBank Accession Number U... 35 2.3
gi|6598592|gb|AAF18647.1| F5J5.6 [Arabidopsis thaliana] 35 2.3
gi|18447428|gb|AAL68278.1| RE21021p [Drosophila melanogaster] 35 2.3
gi|20129863|ref|NP_610623.1| CG6751-PA [Drosophila melanogaster]... 35 2.3
gi|46133991|ref|XP_389311.1| hypothetical protein FG09135.1 [Gib... 35 2.3
gi|15240403|ref|NP_198042.1| WD-40 repeat family protein [Arabid... 35 2.3
gi|47086251|ref|NP_998057.1| hypothetical protein zgc:77032 [Dan... 35 2.3
gi|12324715|gb|AAG52318.1| unknown protein; 4584-7806 [Arabidops... 35 2.3
gi|40823395|gb|AAR92280.1| At5g50230 [Arabidopsis thaliana] 35 2.3
gi|15240637|ref|NP_199834.1| transducin family protein / WD-40 r... 35 2.3
gi|25405023|pir||G96809 protein F28K19.28 [imported] - Arabidops... 35 3.0
gi|38175727|dbj|BAD01450.1| transducin / WD-40 repeat protein-li... 35 3.0
gi|29246903|gb|EAA38483.1| GLP_76_38824_37691 [Giardia lamblia A... 35 3.0
gi|42572153|ref|NP_974167.1| WD-40 repeat family protein [Arabid... 35 3.0
gi|13937195|gb|AAK50091.1| At1g78070/F28K19_28 [Arabidopsis thal... 35 3.0
gi|39580650|emb|CAE61332.1| Hypothetical protein CBG05170 [Caeno... 35 3.0
gi|50549155|ref|XP_502048.1| hypothetical protein [Yarrowia lipo... 35 3.9
gi|6323158|ref|NP_013230.1| Nucleolar protein, specifically asso... 35 3.9
gi|3668118|emb|CAA11819.1| hypothetical protein [Brassica napus] 35 3.9
gi|46226664|gb|EAK87643.1| WD repeat protein [Cryptosporidium pa... 35 3.9
gi|31243125|ref|XP_322003.1| ENSANGP00000004131 [Anopheles gambi... 35 3.9
gi|7512929|pir||T17345 hypothetical protein DKFZp586M1824.1 - hu... 35 3.9
gi|10434331|dbj|BAB14222.1| unnamed protein product [Homo sapiens] 35 3.9
gi|15240985|ref|NP_198109.1| WD-40 repeat family protein [Arabid... 35 3.9
gi|2204278|emb|CAA97700.1| DIP2 [Saccharomyces cerevisiae] >gnl|... 35 3.9
gi|19114073|ref|NP_593161.1| wd-domain protein; CDC20/p55CDC/Fiz... 35 3.9
gi|18676480|dbj|BAB84892.1| FLJ00137 protein [Homo sapiens] 35 3.9
gi|31216935|ref|XP_316328.1| ENSANGP00000020634 [Anopheles gambi... 35 3.9
gi|22001417|ref|NP_056280.1| gemin 5 [Homo sapiens] >gnl|BL_ORD_... 35 3.9
gi|15234128|ref|NP_195053.1| WD-40 repeat family protein [Arabid... 34 5.2
gi|28277337|gb|AAH45242.1| LOC398044 protein [Xenopus laevis] 34 5.2
gi|25446692|gb|AAN74839.1| Putative cell cycle switch protein [O... 34 5.2
gi|50370184|gb|AAH76805.1| LOC398044 protein [Xenopus laevis] 34 5.2
gi|47847430|dbj|BAD21387.1| mFLJ00137 protein [Mus musculus] 34 5.2
gi|27503900|gb|AAH42288.1| MGC53536 protein [Xenopus laevis] 34 5.2
gi|45360545|ref|NP_988945.1| hypothetical protein MGC75919 [Xeno... 34 5.2
gi|48102488|ref|XP_392780.1| similar to CG8882-PA [Apis mellifera] 34 5.2
gi|45200901|ref|NP_986471.1| AGL196Cp [Eremothecium gossypii] >g... 34 5.2
gi|30681950|ref|NP_192929.2| WD-40 repeat family protein [Arabid... 34 5.2
gi|50306603|ref|XP_453275.1| unnamed protein product [Kluyveromy... 34 5.2
gi|34870759|ref|XP_220448.2| similar to gem (nuclear organelle) ... 34 5.2
gi|7446140|pir||T09351 hypothetical protein T26M18.130 - Arabido... 34 5.2
gi|50881464|gb|AAT85309.1| WD domain, G-beta repeat containing p... 34 5.2
gi|49094388|ref|XP_408655.1| hypothetical protein AN4518.2 [Aspe... 34 5.2
gi|50288717|ref|XP_446788.1| unnamed protein product [Candida gl... 34 5.2
gi|21357095|ref|NP_650705.1| CG8064-PA [Drosophila melanogaster]... 34 5.2
gi|38345769|emb|CAE03470.2| OSJNBa0083N12.7 [Oryza sativa (japon... 34 5.2
gi|27369782|ref|NP_766146.1| gem (nuclear organelle) associated ... 34 5.2
gi|34870580|ref|XP_213271.2| similar to 3230401M21Rik protein [R... 34 5.2
gi|15234125|ref|NP_195052.1| WD-40 repeat family protein [Arabid... 34 5.2
gi|6491862|gb|AAF14048.1| putative cdc20 protein [Arabidopsis th... 34 5.2
gi|47201285|emb|CAF88644.1| unnamed protein product [Tetraodon n... 34 5.2
gi|25091532|sp|Q26544|WS17_SCHMA WD-repeat protein SL1-17 >gnl|B... 34 5.2
gi|39581361|emb|CAE69258.1| Hypothetical protein CBG15309 [Caeno... 34 6.7
gi|1620909|dbj|BAA08084.1| ceruloplasmin [Homo sapiens] 34 6.7
gi|50554013|ref|XP_504415.1| hypothetical protein [Yarrowia lipo... 34 6.7
gi|49068958|ref|XP_398768.1| hypothetical protein UM01153.1 [Ust... 34 6.7
gi|728992|sp|Q06366|BXEN_CLOBU BOTULINUM NEUROTOXIN TYPE E, NONT... 34 6.7
gi|477048|pir||A47708 progenitor toxin nontoxic component - Clos... 34 6.7
gi|1168713|sp|P46082|BXEN_CLOBO Botulinum neurotoxin type E, non... 34 6.7
gi|25090901|sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 ... 34 6.7
gi|32189380|ref|NP_078923.3| nucleoporin 43kDa; nucleoporin Nup4... 34 6.7
gi|15224798|ref|NP_179544.1| transducin family protein / WD-40 r... 34 6.7
gi|1942284|pdb|1KCW| X-Ray Crystal Structure Of Human Cerulopla... 34 6.7
gi|4557485|ref|NP_000087.1| ceruloplasmin (ferroxidase); Cerulop... 34 6.7
gi|1070458|pir||KUHU ferroxidase (EC 1.16.3.1) precursor [valida... 34 6.7
gi|180249|gb|AAA51975.1| ceruloplasmin 34 6.7
gi|50294243|ref|XP_449533.1| unnamed protein product [Candida gl... 34 6.7
gi|19922278|ref|NP_610996.1| CG12797-PA [Drosophila melanogaster... 34 6.7
gi|19173267|ref|NP_597070.1| hypothetical protein [Encephalitozo... 34 6.7
gi|6979998|gb|AAF34688.1| putative microtubule severing protein ... 34 6.7
gi|45773816|gb|AAS76712.1| At5g13480 [Arabidopsis thaliana] 33 8.8
gi|49093804|ref|XP_408363.1| hypothetical protein AN4226.2 [Aspe... 33 8.8
gi|48137179|ref|XP_396787.1| similar to gemin 5 [Apis mellifera] 33 8.8
gi|45187819|ref|NP_984042.1| ADL054Wp [Eremothecium gossypii] >g... 33 8.8
gi|50751446|ref|XP_422402.1| PREDICTED: similar to Hypothetical ... 33 8.8
gi|17137788|ref|NP_477501.1| CG4274-PA [Drosophila melanogaster]... 33 8.8
gi|33636539|gb|AAQ23567.1| RE39287p [Drosophila melanogaster] 33 8.8
gi|38111235|gb|EAA56843.1| hypothetical protein MG07198.4 [Magna... 33 8.8
gi|6323795|ref|NP_013866.1| Subunit of the core complex of trans... 33 8.8
gi|32699064|ref|NP_872433.1| hypothetical protein MGC64882 [Homo... 33 8.8
gi|47228269|emb|CAG07664.1| unnamed protein product [Tetraodon n... 33 8.8
gi|49086932|ref|XP_405472.1| hypothetical protein AN1335.2 [Aspe... 33 8.8
gi|41052668|dbj|BAD07515.1| putative WD-40 repeat protein [Oryza... 33 8.8
gi|38073739|ref|XP_354695.1| similar to hypothetical protein MGC... 33 8.8
gi|38422777|emb|CAE54912.1| Hypothetical protein Y111B2A.28 [Cae... 33 8.8
gi|42567822|ref|NP_196852.2| WD-40 repeat family protein [Arabid... 33 8.8
gi|45506973|ref|ZP_00159321.1| COG2319: FOG: WD40 repeat [Anabae... 33 8.8
gi|50746511|ref|XP_420529.1| PREDICTED: similar to WD repeat dom... 33 8.8
>gi|17532677|ref|NP_495982.1| g-protein beta WD-40 repeat (42.3 kD)
(2J608) [Caenorhabditis elegans]
gi|7498171|pir||T20340 hypothetical protein D2013.3 - Caenorhabditis
elegans
gi|3875378|emb|CAA87775.1| Hypothetical protein D2013.3
[Caenorhabditis elegans]
Length = 360
Score = 716 bits (1849), Expect = 0.0
Identities = 349/360 (96%), Positives = 349/360 (96%)
Frame = -1
Query: 1083 MTVRHEEYMFSCDLKKRRVFEEQQVSRALLNFRWTKHIPMGCDQTGKGHQEDISAIDIDD 904
MTVRHEEYMFSCDLKKRRVFEEQQVSRALLNFRWTKHIPMGCDQTGKGHQEDISAIDIDD
Sbjct: 1 MTVRHEEYMFSCDLKKRRVFEEQQVSRALLNFRWTKHIPMGCDQTGKGHQEDISAIDIDD 60
Query: 903 GDQMLLFGSHSGSVSVAXXXXXXXXXXXKPMTLKLAKQSLKTIKWCPIDLRLFMVTTASN 724
GDQMLLFGSHSGSVSVA KPMTLKLAKQSLKTIKWCPIDLRLFMVTTASN
Sbjct: 61 GDQMLLFGSHSGSVSVAKYKYLDRKKWKKPMTLKLAKQSLKTIKWCPIDLRLFMVTTASN 120
Query: 723 WMRVCDSTMEKVVHGKQFEGDVYFDWNEYNMTNSKVAVADGGRSMKIIDFRVGMDLPQSI 544
WMRVCDSTMEKVVHGKQFEGDVYFDWNEYNMTNSKVAVADGGRSMKIIDFRVGMDLPQSI
Sbjct: 121 WMRVCDSTMEKVVHGKQFEGDVYFDWNEYNMTNSKVAVADGGRSMKIIDFRVGMDLPQSI 180
Query: 543 YWNDEPIDVVQWYPSKHHYLYAGRRDGTIGLFDIRSTRGAIAEKSLHKSQIYGLKISADG 364
YWNDEPIDVVQWYPSKHHYLYAGRRDGTIGLFDIRSTRGAIAEKSLHKSQIYGLKISADG
Sbjct: 181 YWNDEPIDVVQWYPSKHHYLYAGRRDGTIGLFDIRSTRGAIAEKSLHKSQIYGLKISADG 240
Query: 363 HRLISADRSGYIHVADTWDFSTKFDFSCEFDPLMQRRPNLEFIYEKDFYVATNFEKLTII 184
HRLISADRSGYIHVADTWDFSTKFDFSCEFDPLMQRRPNLEFIYEKDFYVATNFEKLTII
Sbjct: 241 HRLISADRSGYIHVADTWDFSTKFDFSCEFDPLMQRRPNLEFIYEKDFYVATNFEKLTII 300
Query: 183 RFSDNDKSRRNPDFREVEAKVLWDKPFIFRKSSYEIITGFNYNHLNILSLDRSTKDQDEV 4
RFSDNDKSRRNPDFREVEAKVLWDKPFIFRKSSYEIITGFNYNHLNILSLDRSTKDQDEV
Sbjct: 301 RFSDNDKSRRNPDFREVEAKVLWDKPFIFRKSSYEIITGFNYNHLNILSLDRSTKDQDEV 360