Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= D2013_4
(690 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25153277|ref|NP_495984.2| RAB family member (rab-39) [Caenorh... 471 e-132
gi|39580636|emb|CAE72912.1| Hypothetical protein CBG20230 [Caeno... 444 e-123
gi|7498168|pir||T20339 hypothetical protein D2013.1 - Caenorhabd... 374 e-103
gi|17945831|gb|AAL48962.1| RE37651p [Drosophila melanogaster] 244 2e-63
gi|24640395|ref|NP_572405.2| CG12156-PA [Drosophila melanogaster... 243 3e-63
gi|25188193|ref|NP_741995.1| RAB39B, member RAS oncogene family ... 220 2e-56
gi|30424726|ref|NP_780331.1| RAB39B, member RAS oncogene family ... 220 2e-56
gi|22651417|gb|AAL12244.1| Rab39 [Homo sapiens] 218 9e-56
gi|34863407|ref|XP_236242.2| similar to Ras-related protein Rab-... 214 2e-54
gi|30425356|ref|NP_780771.1| RAB39, member RAS oncogene family [... 211 1e-53
gi|39930371|ref|NP_059986.1| rab-related GTP-binding protein [Ho... 210 2e-53
gi|38512236|gb|AAH60898.1| Zgc:73061 protein [Danio rerio] 205 6e-52
gi|1491714|emb|CAA68227.1| rab-related GTP-binding protein [Homo... 204 1e-51
gi|50759922|ref|XP_425771.1| PREDICTED: similar to Zgc:73061 pro... 192 4e-48
gi|29841194|gb|AAP06207.1| similar to XM_084662 rab-related GTP-... 186 3e-46
gi|31203435|ref|XP_310666.1| ENSANGP00000020782 [Anopheles gambi... 186 4e-46
gi|47214423|emb|CAG00264.1| unnamed protein product [Tetraodon n... 185 7e-46
gi|10047433|gb|AAG12240.1| guanine nucleotide-binding protein Ra... 178 8e-44
gi|31212835|ref|XP_315402.1| ENSANGP00000020903 [Anopheles gambi... 177 2e-43
gi|26892279|gb|AAN86142.1| RAB2B [Homo sapiens] 176 4e-43
gi|39586261|emb|CAE66672.1| Hypothetical protein CBG12011 [Caeno... 176 4e-43
gi|49257196|gb|AAH71068.1| Unknown (protein for MGC:78967) [Xeno... 176 4e-43
gi|21361884|ref|NP_116235.2| RAB2B protein; RAS family, member R... 176 5e-43
gi|17137088|ref|NP_477090.1| CG3269-PA [Drosophila melanogaster]... 176 5e-43
gi|49257826|gb|AAH74632.1| Unknown (protein for MGC:69558) [Xeno... 175 9e-43
gi|17507539|ref|NP_491233.1| RAB family member (23.6 kD) (rab-2)... 174 1e-42
gi|47213473|emb|CAF91130.1| unnamed protein product [Tetraodon n... 174 1e-42
gi|45382561|ref|NP_990559.1| GTP-binding protein [Gallus gallus]... 174 2e-42
gi|1588651|prf||2209256A rab2 gene 174 2e-42
gi|5738168|gb|AAD50281.1| putative intermediate compartment prot... 173 3e-42
gi|106185|pir||B34323 GTP-binding protein Rab2 - human >gnl|BL_O... 173 3e-42
gi|27675132|ref|XP_223991.1| similar to Ras-related protein Rab-... 173 3e-42
gi|6517192|dbj|BAA87878.1| Drab2 [Drosophila melanogaster] 173 3e-42
gi|30525051|ref|NP_766189.1| RAB2B protein [Mus musculus] >gnl|B... 172 4e-42
gi|32451720|gb|AAH54719.1| Unknown (protein for MGC:64765) [Mus ... 172 4e-42
gi|29250860|gb|EAA42348.1| GLP_440_103492_104175 [Giardia lambli... 172 4e-42
gi|41393075|ref|NP_958862.1| RAB2, member RAS oncogene family [D... 172 4e-42
gi|4506365|ref|NP_002856.1| RAB2, member RAS oncogene family [Ho... 172 6e-42
gi|10946940|ref|NP_067493.1| RAB2, member RAS oncogene family; G... 172 6e-42
gi|464526|sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 >gnl|BL... 172 6e-42
gi|266878|sp|Q01971|RB2A_RABIT Ras-related protein Rab-2A >gnl|B... 172 6e-42
gi|12837642|dbj|BAB23894.1| unnamed protein product [Mus musculus] 171 1e-41
gi|13929006|ref|NP_113906.1| RAB2, member RAS oncogene family [R... 171 1e-41
gi|34849826|gb|AAH58382.1| RAB2, member RAS oncogene family [Mus... 171 2e-41
gi|38079252|ref|XP_144080.2| similar to RAB39 protein [Mus muscu... 169 4e-41
gi|2500074|sp|Q39570|YPT4_CHLRE GTP-binding protein YPTC4 >gnl|B... 168 8e-41
gi|549811|sp|P36863|YPT4_VOLCA GTP-binding protein yptV4 (RAB2 h... 168 8e-41
gi|15233367|ref|NP_195311.1| Ras-related GTP-binding protein, pu... 166 3e-40
gi|28556900|dbj|BAC57527.1| GTP-binding protein rab-2 homologue ... 166 3e-40
gi|38344743|emb|CAE03047.2| OSJNBa0089K21.1 [Oryza sativa (japon... 166 4e-40
gi|26335369|dbj|BAC31385.1| unnamed protein product [Mus musculus] 166 4e-40
gi|48101226|ref|XP_392651.1| similar to ENSANGP00000020903 [Apis... 165 9e-40
gi|4837727|gb|AAD30658.1| small GTP binding protein Rab2 [Sporob... 165 9e-40
gi|7438438|pir||T04362 GTP-binding protein yptm3 - maize >gnl|BL... 165 9e-40
gi|50404925|ref|YP_054017.1| GTP-binding protein RAB2 homolog [P... 164 2e-39
gi|1346956|sp|P49103|RB2A_MAIZE Ras-related protein Rab-2-A >gnl... 164 2e-39
gi|18390323|ref|NP_080973.1| RAB14, member RAS oncogene family [... 164 2e-39
gi|16758368|ref|NP_446041.1| GTPase Rab14 [Rattus norvegicus] >g... 164 2e-39
gi|6624302|dbj|BAA88497.1| small GTP-binding protein [Carica pap... 163 3e-39
gi|1346957|sp|P49104|RB2B_MAIZE Ras-related protein Rab-2-B >gnl... 163 3e-39
gi|41393147|ref|NP_958903.1| RAB14, member RAS oncogene family [... 163 3e-39
gi|46806275|dbj|BAD17483.1| putative GTP-binding protein yptm3 [... 163 3e-39
gi|41053455|ref|NP_956977.1| hypothetical protein MGC63643 [Dani... 162 5e-39
gi|5738170|gb|AAD50282.1| putative intermediate compartment prot... 162 5e-39
gi|50741401|ref|XP_419573.1| PREDICTED: similar to RAB4A, member... 162 6e-39
gi|38303943|gb|AAH62016.1| Unknown (protein for MGC:72520) [Ratt... 162 6e-39
gi|6679595|ref|NP_033029.1| RAB4A, member RAS oncogene family [M... 161 1e-38
gi|33150586|gb|AAP97171.1| rab4b [Homo sapiens] 161 1e-38
gi|19923260|ref|NP_004569.2| RAB4A, member RAS oncogene family; ... 160 2e-38
gi|29337213|sp|P20338|RB4A_HUMAN Ras-related protein Rab-4A 160 2e-38
gi|420272|pir||E42148 GTP-binding protein rab14 - rat 160 2e-38
gi|131793|sp|P05714|RB4A_RAT Ras-related protein Rab-4A >gnl|BL_... 160 2e-38
gi|8394136|ref|NP_059051.1| ras-related GTP-binding protein 4b [... 160 3e-38
gi|21361509|ref|NP_057238.2| ras-related GTP-binding protein 4b ... 159 4e-38
gi|1370176|emb|CAA98165.1| RAB2A [Lotus corniculatus var. japoni... 159 4e-38
gi|7438437|pir||T03767 GTP-binding protein rab2 - rice >gnl|BL_O... 159 4e-38
gi|38524287|emb|CAD57744.1| RAB-like small G-protein [Hordeum vu... 159 4e-38
gi|6981454|ref|NP_037151.1| RAB4A, member RAS oncogene family; R... 159 4e-38
gi|7438379|pir||E71440 GTP-binding protein RAB2A - Arabidopsis t... 159 5e-38
gi|15235981|ref|NP_193450.1| Rab2-like GTP-binding protein (RAB2... 159 5e-38
gi|548665|sp|P36409|RAB2_DICDI Ras-related protein Rab2 >gnl|BL_... 159 5e-38
gi|7438383|pir||S71559 GTP-binding protein rab2 - soybean >gnl|B... 159 7e-38
gi|27924185|gb|AAH44974.1| Rab4a-prov protein [Xenopus laevis] 159 7e-38
gi|46577634|sp|P61017|RB4B_CANFA Ras-related protein Rab-4B >gnl... 159 7e-38
gi|50416282|gb|AAH77886.1| Unknown (protein for MGC:80680) [Xeno... 159 7e-38
gi|106188|pir||E34323 GTP-binding protein Rab4 - human >gnl|BL_O... 159 7e-38
gi|14275890|dbj|BAB58891.1| rab-like protein E [Giardia intestin... 158 9e-38
gi|17568765|ref|NP_510572.1| RAB family member (23.4 kD) (rab-14... 158 1e-37
gi|31221293|ref|XP_317028.1| ENSANGP00000023275 [Anopheles gambi... 157 1e-37
gi|31221287|ref|XP_317027.1| ENSANGP00000019319 [Anopheles gambi... 157 1e-37
gi|34194035|gb|AAH56535.1| Rab4a protein [Danio rerio] 157 2e-37
gi|548666|sp|P36410|RAB4_DICDI Ras-related protein Rab4 >gnl|BL_... 157 2e-37
gi|39596714|emb|CAE63333.1| Hypothetical protein CBG07733 [Caeno... 157 2e-37
gi|16755592|gb|AAL28022.1| small GTPase Rab2 [Nicotiana tabacum] 157 2e-37
gi|47217171|emb|CAG11007.1| unnamed protein product [Tetraodon n... 156 3e-37
gi|28574179|ref|NP_788057.1| CG4212-PC [Drosophila melanogaster]... 156 4e-37
gi|17137218|ref|NP_477171.1| CG4212-PA [Drosophila melanogaster]... 156 4e-37
gi|17647849|ref|NP_523777.1| CG4921-PB [Drosophila melanogaster]... 156 4e-37
gi|28574177|ref|NP_788056.1| CG4212-PB [Drosophila melanogaster]... 156 4e-37
gi|50757153|ref|XP_415402.1| PREDICTED: similar to GTPase Rab14 ... 155 6e-37
gi|31208277|ref|XP_313105.1| ENSANGP00000012897 [Anopheles gambi... 155 6e-37
gi|15235980|ref|NP_193449.1| Ras-related GTP-binding protein, pu... 155 9e-37
gi|15986733|gb|AAL11725.1| GTP-binding protein RAB4 [Mus musculus] 155 9e-37
gi|17862462|gb|AAL39708.1| LD29476p [Drosophila melanogaster] 154 2e-36
gi|39586275|emb|CAE66686.1| Hypothetical protein CBG12025 [Caeno... 153 3e-36
gi|50412303|ref|XP_457123.1| unnamed protein product [Debaryomyc... 152 5e-36
gi|47225841|emb|CAF98321.1| unnamed protein product [Tetraodon n... 152 6e-36
gi|7498104|pir||T33855 hypothetical protein D1037.4 - Caenorhabd... 152 8e-36
gi|23508994|ref|NP_701662.1| Rab2 GTPase, putative [Plasmodium f... 151 1e-35
gi|14275884|dbj|BAB58888.1| rab-like protein B [Giardia intestin... 150 2e-35
gi|13397937|emb|CAC34627.1| putative Rab2 GTPase [Plasmodium fal... 150 2e-35
gi|25150215|ref|NP_491199.2| RAB family member (24.0 kD) (rab-8)... 150 2e-35
gi|46431579|gb|EAK91125.1| hypothetical protein CaO19.10153 [Can... 150 2e-35
gi|37532342|ref|NP_920473.1| putative small GTP binding protein ... 150 2e-35
gi|23619155|ref|NP_705117.1| small GTPase Rab11 [Plasmodium falc... 150 3e-35
gi|23463313|ref|NP_695229.1| GTPase Rab8b [Rattus norvegicus] >g... 150 3e-35
gi|15231847|ref|NP_190929.1| Ras-related GTP-binding protein, pu... 149 4e-35
gi|31745716|gb|AAP57202.1| Rab11 [Toxoplasma gondii] 149 4e-35
gi|50752811|ref|XP_413757.1| PREDICTED: similar to GTPase Rab8b ... 149 4e-35
gi|11493388|emb|CAC17572.1| dJ803J11.1 (RAB4, member RAS oncogen... 149 4e-35
gi|7706563|ref|NP_057614.1| RAB8B, member RAS oncogene family; R... 149 4e-35
gi|46326983|gb|AAS88430.1| ethylene-responsive small GTP-binding... 149 5e-35
gi|38080002|ref|XP_124519.2| similar to GTP-binding protein [Mus... 149 5e-35
gi|50604253|gb|AAH78133.1| Unknown (protein for MGC:84543) [Xeno... 149 5e-35
gi|19115492|ref|NP_594580.1| ypt1-related protein 2 [Schizosacch... 149 7e-35
gi|29841087|gb|AAP06100.1| similar to GenBank Accession Number A... 149 7e-35
gi|29124128|gb|AAO65869.1| ethylene-responsive small GTP-binding... 148 9e-35
gi|3024527|sp|Q39433|RAB1_BETVU Ras-related protein RAB1BV >gnl|... 148 9e-35
gi|23480789|gb|EAA17254.1| putative Rab2 GTPase [Plasmodium yoel... 148 9e-35
gi|131848|sp|P22128|RAB8_DISOM Ras-related protein Rab-8 (ORA2) ... 148 1e-34
gi|15238542|ref|NP_200792.1| Ras-related GTP-binding family prot... 147 2e-34
gi|47900325|gb|AAT39172.1| putative GTP-binding protein [Oryza s... 147 2e-34
gi|1370190|emb|CAA98172.1| RAB8A [Lotus corniculatus var. japoni... 147 2e-34
gi|1362067|pir||S57478 GTP-binding protein GTP13 - garden pea >g... 147 2e-34
gi|32398899|emb|CAD98364.1| small GTP binding protein rab1a, pro... 147 2e-34
gi|18447913|dbj|BAB84322.1| ras-related protein RAB8-1 [Nicotian... 147 3e-34
gi|18447915|dbj|BAB84323.1| ras-related protein RAB8-2 [Nicotian... 147 3e-34
gi|38175435|dbj|BAC83185.2| putative ras-related protein [Oryza ... 147 3e-34
gi|15231322|ref|NP_190192.1| Ras-related protein (ARA-3) / small... 146 3e-34
gi|7438394|pir||T14405 small GTP-binding protein rab-1 - turnip ... 146 3e-34
gi|29841352|gb|AAP06384.1| similar to GenBank Accession Number A... 146 3e-34
gi|18447917|dbj|BAB84324.1| ras-related protein RAB8-3 [Nicotian... 146 4e-34
gi|1362066|pir||S57471 GTP-binding protein GTP6 - garden pea >gn... 146 4e-34
gi|464532|sp|P34143|RABC_DICDI Ras-related protein RabC >gnl|BL_... 146 4e-34
gi|5669640|gb|AAD46405.1| ethylene-responsive small GTP-binding ... 145 6e-34
gi|30585389|gb|AAP36967.1| Homo sapiens mel transforming oncogen... 145 6e-34
gi|1710002|sp|P55258|RB8A_MOUSE Ras-related protein Rab-8A (Onco... 145 6e-34
gi|234746|gb|AAB19681.1| RAS-related protein MEL [Homo sapiens] 145 6e-34
gi|49522647|gb|AAH71176.1| Unknown (protein for IMAGE:7098881) [... 145 6e-34
gi|1370196|emb|CAA98175.1| RAB8D [Lotus corniculatus var. japoni... 145 6e-34
gi|50287271|ref|XP_446065.1| unnamed protein product [Candida gl... 145 6e-34
gi|1370198|emb|CAA98176.1| RAB8E [Lotus corniculatus var. japoni... 145 6e-34
gi|1362065|pir||S57462 GTP-binding protein GTP11 - garden pea >g... 145 6e-34
gi|16933567|ref|NP_005361.2| mel transforming oncogene; ras-asso... 145 6e-34
gi|38372905|ref|NP_075615.2| cell line NK14 derived transforming... 145 6e-34
gi|50308977|ref|XP_454494.1| unnamed protein product [Kluyveromy... 145 7e-34
gi|19115708|ref|NP_594796.1| rab protein; involved in endocytosi... 145 7e-34
gi|42733994|gb|AAM33191.3| similar to Dictyostelium discoideum (... 145 7e-34
gi|33146687|dbj|BAC80082.1| putative ethylene-responsive small G... 145 1e-33
gi|23484033|gb|EAA19507.1| small GTPase rab11-related [Plasmodiu... 144 1e-33
gi|21311975|ref|NP_080953.1| RAS-associated protein RAB13 [Mus m... 144 1e-33
gi|1195465|gb|AAC46990.1| ras-related protein RAB-4 144 1e-33
gi|32492052|gb|AAP85298.1| Rab2 [Babesia bovis] 144 2e-33
gi|401686|sp|P31584|YPT1_VOLCA GTP-binding protein yptV1 >gnl|BL... 144 2e-33
gi|29789271|ref|NP_112354.1| RAB13 [Rattus norvegicus] >gnl|BL_O... 144 2e-33
gi|18447921|dbj|BAB84326.1| ras-related protein RAB8-5 [Nicotian... 144 2e-33
gi|479442|pir||S33900 GTP-binding protein ypt2 - tomato >gnl|BL_... 144 2e-33
gi|47225037|emb|CAF97452.1| unnamed protein product [Tetraodon n... 144 2e-33
gi|1362064|pir||S57474 GTP-binding protein - garden pea >gnl|BL_... 143 3e-33
gi|15232784|ref|NP_187601.1| Ras-related GTP-binding protein, pu... 143 4e-33
gi|2500076|sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT... 143 4e-33
gi|47208089|emb|CAF90842.1| unnamed protein product [Tetraodon n... 143 4e-33
gi|2500073|sp|Q39571|YPT1_CHLRE GTP-binding protein YPTC1 >gnl|B... 143 4e-33
gi|2808638|emb|CAA04701.1| small GTP-binding protein [Daucus car... 142 5e-33
gi|134228|sp|P20790|SAS1_DICDI GTP-binding protein SAS1 >gnl|BL_... 142 5e-33
gi|103724|pir||B38625 GTP-binding protein ora2 - electric ray (D... 142 5e-33
gi|1370194|emb|CAA98174.1| RAB8C [Lotus corniculatus var. japoni... 142 5e-33
gi|7438429|pir||T06444 GTP-binding protein - garden pea (fragmen... 142 8e-33
gi|5926718|dbj|BAA84640.1| PRA2 [Pisum sativum] 142 8e-33
gi|47211161|emb|CAF92536.1| unnamed protein product [Tetraodon n... 141 1e-32
gi|131785|sp|P22125|RAB1_DISOM Ras-related protein ORAB-1 >gnl|B... 141 1e-32
gi|49074732|ref|XP_401480.1| hypothetical protein UM03865.1 [Ust... 141 1e-32
gi|134236|sp|P20791|SAS2_DICDI GTP-binding protein SAS2 >gnl|BL_... 141 1e-32
gi|30677910|ref|NP_171628.2| Ras-related GTP-binding protein, pu... 141 1e-32
gi|27924279|gb|AAH45014.1| Rab1-prov protein [Xenopus laevis] >g... 141 1e-32
gi|730510|sp|P40392|RIC1_ORYSA Ras-related protein RIC1 >gnl|BL_... 141 1e-32
gi|27817324|emb|CAD61089.1| SI:zC101N13.3 (novel protein similar... 141 1e-32
gi|464524|sp|Q05974|RAB1_LYMST Ras-related protein Rab-1A >gnl|B... 141 1e-32
gi|13785146|emb|CAA72626.2| rab4A-like protein [Trichinella pseu... 141 1e-32
gi|1370144|emb|CAA98178.1| RAB11B [Lotus corniculatus var. japon... 140 2e-32
gi|114085|sp|P19892|ARA1_ARATH Ras-related protein ARA-1 >gnl|BL... 140 2e-32
gi|50259473|gb|EAL22146.1| hypothetical protein CNBC2840 [Crypto... 140 2e-32
gi|42561732|ref|NP_563750.2| Ras-related protein (ARA-1) (ARA) /... 140 2e-32
gi|24648682|ref|NP_732610.1| CG3320-PA [Drosophila melanogaster]... 140 2e-32
gi|1053067|gb|AAA80680.1| small GTP-binding protein 140 2e-32
gi|34914060|ref|NP_918377.1| putative RIC1_ORYSA RAS-RELATED PRO... 140 2e-32
gi|7643790|gb|AAF65510.1| small GTP-binding protein [Capsicum an... 140 2e-32
gi|41152205|ref|NP_958486.1| RAB13, member RAS oncogene family [... 140 2e-32
gi|3025293|sp|Q39572|YPT6_CHLRE Ras-related protein YPTC6 >gnl|B... 140 2e-32
gi|28376635|ref|NP_783865.1| RAB37, member RAS oncogene family; ... 140 2e-32
gi|49070122|ref|XP_399350.1| hypothetical protein UM01735.1 [Ust... 140 2e-32
gi|1370166|emb|CAA98160.1| RAB1C [Lotus corniculatus var. japoni... 140 2e-32
gi|41055496|ref|NP_957436.1| similar to RAB1, member RAS oncogen... 140 2e-32
gi|29336944|sp|Q9GP33|RB4A_ECHMU Probable Ras-related protein Ra... 140 2e-32
gi|45201075|ref|NP_986645.1| AGL021Wp [Eremothecium gossypii] >g... 140 2e-32
gi|421942|pir||S34253 GTP-binding protein, ras-related - common ... 140 2e-32
gi|15242773|ref|NP_195972.1| Ras-related GTP-binding protein, pu... 140 3e-32
gi|23613148|ref|NP_703470.1| GTPase, putative [Plasmodium falcip... 140 3e-32
gi|34908298|ref|NP_915496.1| Ras-related GTP-binding protein [Or... 140 3e-32
gi|7438404|pir||T03626 GTP-binding protein Rab11e - common tobac... 140 3e-32
gi|4758988|ref|NP_004152.1| RAB1A, member RAS oncogene family; R... 140 3e-32
gi|21592670|gb|AAM64619.1| putative Ras-like GTP-binding protein... 139 4e-32
gi|17380746|gb|AAL36203.1| putative RAS-related protein ARA-1 [A... 139 4e-32
gi|7438428|pir||T06443 GTP-binding protein - garden pea >gnl|BL_... 139 4e-32
gi|1616614|emb|CAA69701.1| small GTP-binding protein [Nicotiana ... 139 4e-32
gi|17737663|ref|NP_524172.1| CG8287-PA [Drosophila melanogaster]... 139 4e-32
gi|49257311|gb|AAH73168.1| RAB13 protein [Homo sapiens] 139 5e-32
gi|49074658|ref|XP_401448.1| YPT1_NEUCR GTP-binding protein ypt1... 139 5e-32
gi|28828965|gb|AAO51546.1| similar to RAS-related protein [Caeno... 139 5e-32
gi|19114579|ref|NP_593667.1| YPT1-related rab subfamily protein ... 139 5e-32
gi|92339|pir||S06147 GTP-binding protein rab1B - rat >gnl|BL_ORD... 139 5e-32
gi|131787|sp|P05711|RB1A_RAT Ras-related protein Rab-1A >gnl|BL_... 139 5e-32
gi|14318517|ref|NP_116650.1| Secretory vesicle associated Rab GT... 139 5e-32
gi|31243023|ref|XP_321946.1| ENSANGP00000013866 [Anopheles gambi... 139 5e-32
gi|4506363|ref|NP_002861.1| RAB13, member RAS oncogene family; R... 139 5e-32
gi|303750|dbj|BAA02116.1| GTP-binding protein [Pisum sativum] >g... 139 7e-32
gi|11558500|emb|CAC17744.1| small GTP-binding protein YPTI [Hypo... 139 7e-32
gi|11558649|emb|CAC17833.1| secretion related GTPase (SrgB) [Asp... 139 7e-32
gi|50256143|gb|EAL18870.1| hypothetical protein CNBI1310 [Crypto... 139 7e-32
gi|41469625|gb|AAS07348.1| putative GTP-binding protein [Oryza s... 139 7e-32
gi|34897394|ref|NP_910043.1| Ras-related GTP-binding protein [Or... 139 7e-32
gi|549810|sp|P36862|YPT3_VOLCA GTP-binding protein yptV3 >gnl|BL... 139 7e-32
gi|14249144|ref|NP_116006.1| RAB11B, member RAS oncogene family ... 138 9e-32
gi|49456343|emb|CAG46492.1| RAB11B [Homo sapiens] 138 9e-32
gi|6679583|ref|NP_033023.1| RAB11B, member RAS oncogene family [... 138 9e-32
gi|47550807|ref|NP_999935.1| zgc:55760 [Danio rerio] >gnl|BL_ORD... 138 9e-32
gi|40225607|gb|AAH09227.2| RAB13 protein [Homo sapiens] 138 9e-32
gi|10129780|emb|CAC08198.1| putative GTP-binding protein [Kluyve... 138 9e-32
gi|25012906|gb|AAN71540.1| RH21315p [Drosophila melanogaster] 138 9e-32
gi|47216652|emb|CAG04850.1| unnamed protein product [Tetraodon n... 138 9e-32
gi|46485881|gb|AAS98506.1| putative GTP-binding protein Rab11 [O... 138 9e-32
gi|37360618|dbj|BAC98287.1| mKIAA3012 protein [Mus musculus] 138 9e-32
gi|46561764|gb|AAT01087.1| putative rab11 [Homalodisca coagulata] 138 9e-32
gi|1184985|gb|AAA87884.1| ATGB3 [Arabidopsis thaliana] 138 9e-32
gi|15236099|ref|NP_195709.1| Ras-related GTP-binding protein, pu... 138 9e-32
gi|21617896|gb|AAM66946.1| GTP-binding protein GB3 [Arabidopsis ... 138 9e-32
gi|19112997|ref|NP_596205.1| ypt1-related protein 1 [Schizosacch... 138 9e-32
gi|26337951|dbj|BAC32661.1| unnamed protein product [Mus musculus] 138 1e-31
gi|17737369|ref|NP_523419.1| CG17060-PA [Drosophila melanogaster... 138 1e-31
gi|46138717|ref|XP_391049.1| YPT1_NEUCR GTP-binding protein ypt1... 138 1e-31
gi|548673|sp|P36412|RB11_DICDI Ras-related protein Rab11 >gnl|BL... 138 1e-31
gi|13569962|ref|NP_112243.1| RAB1B, member RAS oncogene family; ... 138 1e-31
gi|27709432|ref|XP_229035.1| similar to Ras-related protein Rab-... 138 1e-31
gi|17559534|ref|NP_507083.1| GTP-binding protein like (5Q673) [C... 138 1e-31
gi|31324876|gb|AAP48704.1| rab11-2 [Limulus polyphemus] 138 1e-31
gi|21313162|ref|NP_083852.1| RIKEN cDNA 1110011F09 [Mus musculus... 138 1e-31
gi|31208125|ref|XP_313029.1| ENSANGP00000011746 [Anopheles gambi... 138 1e-31
gi|19923264|ref|NP_004571.2| Ras-related protein Rab-27A; GTP-bi... 138 1e-31
gi|48146269|emb|CAG33357.1| RAB27A [Homo sapiens] 138 1e-31
gi|12643422|sp|P51159|RB27_HUMAN Ras-related protein Rab-27A (Ra... 138 1e-31
gi|24306110|gb|AAN52527.1| GTP-binding protein [Pichia angusta] ... 138 1e-31
gi|17559536|ref|NP_507084.1| predicted CDS, GTP-binding protein ... 138 1e-31
gi|3024501|sp|Q40193|R11C_LOTJA Ras-related protein Rab11C >gnl|... 137 2e-31
gi|15221005|ref|NP_173258.1| Ras-related GTP-binding family prot... 137 2e-31
gi|4758986|ref|NP_004209.1| RAB11B, member RAS oncogene family; ... 137 2e-31
gi|50738954|ref|XP_419342.1| PREDICTED: similar to ras-related p... 137 2e-31
gi|1381678|gb|AAB97115.1| small GTP-binding protein [Glycine max] 137 2e-31
gi|38109427|gb|EAA55305.1| hypothetical protein MG06962.4 [Magna... 137 2e-31
gi|7438392|pir||T14391 GTP-binding protein homolog - turnip >gnl... 137 2e-31
gi|50292669|ref|XP_448767.1| unnamed protein product [Candida gl... 137 2e-31
gi|3024528|sp|Q39434|RAB2_BETVU Ras-related protein Rab2BV >gnl|... 137 2e-31
gi|17137216|ref|NP_477170.1| CG5771-PB [Drosophila melanogaster]... 137 2e-31
gi|131803|sp|P10536|RB1B_RAT Ras-related protein Rab-1B >gnl|BL_... 137 2e-31
gi|7533034|gb|AAF63333.1| YptA [Aspergillus awamori] 137 2e-31
gi|49065350|emb|CAG38493.1| RAB1B [Homo sapiens] 137 2e-31
gi|29841143|gb|AAP06156.1| similar to NM_070996 RAS-related prot... 137 2e-31
gi|9719734|gb|AAF97836.1| Contains similarity to ras-related GTP... 137 2e-31
gi|49093914|ref|XP_408418.1| YPT1_NEUCR GTP-binding protein ypt1... 137 2e-31
gi|131849|sp|P22129|R11B_DISOM Ras-related protein Rab-11B (ORA3... 137 2e-31
gi|49168476|emb|CAG38733.1| RAB11B [Homo sapiens] 137 2e-31
gi|5902803|sp|P28188|ARA5_ARATH Ras-related protein ARA-5 >gnl|B... 137 2e-31
gi|15231462|ref|NP_187397.1| Ras-related GTP-binding family prot... 137 2e-31
gi|103720|pir||D38625 GTP-binding protein o-rab1 - electric ray ... 137 2e-31
gi|45592944|ref|NP_996661.1| Unknown (protein for MGC:77145); wu... 137 2e-31
gi|17558550|ref|NP_503397.1| RAB family member (22.5 kD) (rab-1)... 137 2e-31
gi|15238852|ref|NP_199607.1| Ras-related GTP-binding family prot... 137 2e-31
gi|50760924|ref|XP_418183.1| PREDICTED: similar to GTP-binding p... 137 2e-31
gi|49115537|gb|AAH73442.1| Unknown (protein for MGC:80943) [Xeno... 137 2e-31
gi|8394142|ref|NP_059013.1| low Mr GTP-binding protein [Rattus n... 137 2e-31
gi|466171|sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 >gnl|BL_... 137 2e-31
gi|1053063|gb|AAA80678.1| small GTP-binding protein 137 2e-31
gi|15217622|ref|NP_171715.1| Ras-related protein (ARA-5) / small... 137 2e-31
gi|41056251|ref|NP_956417.1| Unknown (protein for MGC:63565); wu... 137 3e-31
gi|82803|pir||S04590 GTP-binding protein ypt1 - fission yeast (... 137 3e-31
gi|14318480|ref|NP_116615.1| Ras-like small GTPase, involved in ... 137 3e-31
gi|4293|emb|CAA25036.1| unnamed protein product [Saccharomyces c... 137 3e-31
gi|15222396|ref|NP_172221.1| Ras-related GTP-binding protein, pu... 137 3e-31
gi|3024552|sp|Q40723|RGP2_ORYSA Ras-related protein RGP2 (GTP-bi... 137 3e-31
gi|6320869|ref|NP_010948.1| probably involved in intra-Golgi tra... 137 3e-31
gi|3334326|sp|O14462|SEC4_CANAL Ras-related protein SEC4 >gnl|BL... 137 3e-31
gi|303732|dbj|BAA02117.1| GTP-binding protein [Pisum sativum] >g... 137 3e-31
gi|50553762|ref|XP_504292.1| YlRYL1 [Yarrowia lipolytica] >gnl|B... 137 3e-31
gi|1370174|emb|CAA98164.1| RAB1Y [Lotus corniculatus var. japoni... 137 3e-31
gi|38082075|ref|XP_283428.2| RAB26, member RAS oncogene family [... 136 3e-31
gi|50258203|gb|EAL20897.1| hypothetical protein CNBE2580 [Crypto... 136 3e-31
gi|15230422|ref|NP_187823.1| Ras-related GTP-binding family prot... 136 3e-31
gi|31204497|ref|XP_311197.1| ENSANGP00000019091 [Anopheles gambi... 136 3e-31
gi|4586580|dbj|BAA76422.1| rab-type small GTP-binding protein [C... 136 3e-31
gi|37788825|gb|AAP51290.1| Rab11-1a [Limulus polyphemus] >gnl|BL... 136 3e-31
gi|39588485|emb|CAE58008.1| Hypothetical protein CBG01077 [Caeno... 136 3e-31
gi|10047431|gb|AAG12239.1| guanine nucleotide-binding protein Ra... 136 3e-31
gi|31209781|ref|XP_313857.1| ENSANGP00000024287 [Anopheles gambi... 136 3e-31
gi|34909538|ref|NP_916116.1| putative GTP-binding protein [Oryza... 136 3e-31
gi|13128964|ref|NP_076124.1| RAB27A protein; ashen [Mus musculus... 136 3e-31
gi|4758984|ref|NP_004654.1| Ras-related protein Rab-11A; RAB 11A... 136 5e-31
gi|50285709|ref|XP_445283.1| unnamed protein product [Candida gl... 136 5e-31
gi|27370881|gb|AAH41250.1| Rab11b-prov protein [Xenopus laevis] 136 5e-31
gi|49671143|gb|AAH75268.1| Unknown (protein for MGC:88884) [Xeno... 136 5e-31
gi|50753230|ref|XP_413914.1| PREDICTED: similar to RAB11a, membe... 136 5e-31
gi|30584069|gb|AAP36283.1| Homo sapiens RAB11A, member RAS oncog... 136 5e-31
gi|37788823|gb|AAP51289.1| Rab11-1c [Limulus polyphemus] 136 5e-31
gi|2136080|pir||I39198 Ram/Rab27 - human 136 5e-31
gi|2133238|pir||S51495 GTP-binding protein RYL1 - yeast (Yarrowi... 136 5e-31
gi|47216650|emb|CAG04848.1| unnamed protein product [Tetraodon n... 135 6e-31
gi|50540176|ref|NP_001002555.1| zgc:92772 [Danio rerio] >gnl|BL_... 135 6e-31
gi|47216427|emb|CAG01978.1| unnamed protein product [Tetraodon n... 135 6e-31
gi|1076457|pir||S52024 GTP-binding protein bra - rape >gnl|BL_OR... 135 6e-31
gi|50251643|dbj|BAD29646.1| putative Ras-related protein RGP1 [O... 135 6e-31
gi|50258123|gb|EAL20817.1| hypothetical protein CNBE1790 [Crypto... 135 6e-31
gi|49069954|ref|XP_399266.1| hypothetical protein UM01651.1 [Ust... 135 6e-31
gi|32418088|ref|XP_329522.1| GTP-BINDING PROTEIN YPT1 [Neurospor... 135 6e-31
gi|7108528|gb|AAF36458.1| small GTPase [Mus musculus] 135 8e-31
gi|15225121|ref|NP_180726.1| Ras-related GTP-binding protein, pu... 135 8e-31
gi|45191035|ref|NP_985289.1| AER434Cp [Eremothecium gossypii] >g... 135 8e-31
gi|541978|pir||S41430 GTP-binding protein, ras-like (clone vfa-y... 135 8e-31
gi|18376163|emb|CAD21237.1| probable GTP-binding protein Drab11 ... 135 8e-31
gi|15232785|ref|NP_187602.1| Ras-related GTP-binding protein, pu... 135 8e-31
gi|1370164|emb|CAA98159.1| RAB1B [Lotus corniculatus var. japoni... 135 8e-31
gi|42543202|pdb|1OIV|A Chain A, X-Ray Structure Of The Small G P... 135 8e-31
gi|12084567|pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanos... 135 8e-31
gi|39595276|emb|CAE60313.1| Hypothetical protein CBG03904 [Caeno... 135 1e-30
gi|17507543|ref|NP_490675.1| RAB family member (23.4 kD) (rab-11... 135 1e-30
gi|31201759|ref|XP_309827.1| ENSANGP00000018266 [Anopheles gambi... 135 1e-30
gi|7438417|pir||JE0318 GTP-binding protein rabB - silkworm >gnl|... 135 1e-30
gi|15224226|ref|NP_181842.1| Ras-related protein (ARA-4) / small... 135 1e-30
gi|15232652|ref|NP_190267.1| Ras-related protein (RAB11A) / smal... 135 1e-30
gi|303748|dbj|BAA02115.1| GTP-binding protein [Pisum sativum] >g... 135 1e-30
gi|1370162|emb|CAA66447.1| RAB1A [Lotus corniculatus var. japoni... 135 1e-30
gi|50752910|ref|XP_413795.1| PREDICTED: similar to Ras-related p... 135 1e-30
gi|47211718|emb|CAF95873.1| unnamed protein product [Tetraodon n... 135 1e-30
gi|32492050|gb|AAP85297.1| Rab1b [Babesia bovis] 135 1e-30
gi|1370168|emb|CAA98161.1| RAB1D [Lotus corniculatus var. japoni... 135 1e-30
gi|1370170|emb|CAA98162.1| RAB1E [Lotus corniculatus var. japoni... 135 1e-30
gi|14140133|emb|CAC39050.1| putative GTP-binding protein [Oryza ... 135 1e-30
gi|5764095|gb|AAD51132.1| small GTP-binding protein rab1 [Theile... 135 1e-30
gi|1370154|emb|CAA98183.1| RAB11G [Lotus corniculatus var. japon... 134 1e-30
gi|3024505|sp|Q40522|R11D_TOBAC Ras-related protein Rab11D >gnl|... 134 1e-30
gi|38303826|gb|AAH61984.1| Rab26 protein [Rattus norvegicus] 134 1e-30
gi|24641152|ref|NP_727472.1| CG32670-PA [Drosophila melanogaster... 134 1e-30
gi|730512|sp|P40393|RIC2_ORYSA Ras-related protein RIC2 >gnl|BL_... 134 1e-30
gi|13195452|gb|AAK15703.1| GTP-binding protein [Oryza sativa] 134 1e-30
gi|464523|sp|P34139|RB1A_DICDI Ras-related protein Rab1A >gnl|BL... 134 1e-30
gi|15229836|ref|NP_187779.1| Ras-related GTP-binding protein, pu... 134 1e-30
gi|34906164|ref|NP_914429.1| putative GTP-binding protein [Oryza... 134 1e-30
gi|50539696|ref|NP_001002318.1| zgc:86635 [Danio rerio] >gnl|BL_... 134 1e-30
gi|13537449|dbj|BAB40679.1| small GTPase Rab11C [Entamoeba histo... 134 1e-30
gi|49258038|gb|AAH74344.1| Unknown (protein for MGC:84182) [Xeno... 134 2e-30
gi|15219955|ref|NP_173136.1| Ras-related GTP-binding protein, pu... 134 2e-30
gi|49333370|gb|AAT64010.1| putative GTP-binding protein [Gossypi... 134 2e-30
gi|17506899|ref|NP_492481.1| RAB family member (22.8 kD) (rab-5)... 134 2e-30
gi|11558647|emb|CAC17832.1| secretion related GTPase, (SrgA) [As... 134 2e-30
gi|15236555|ref|NP_193486.1| Ras-related GTP-binding protein, pu... 134 2e-30
gi|47225370|emb|CAG11853.1| unnamed protein product [Tetraodon n... 134 2e-30
gi|15237828|ref|NP_200723.1| Ras-related GTP-binding protein, pu... 134 2e-30
gi|15217568|ref|NP_172434.1| Ras-related GTP-binding protein, pu... 134 2e-30
gi|23619341|ref|NP_705303.1| GTP-binding protein, putative [Plas... 134 2e-30
gi|46575955|gb|AAT01316.1| putative GTP-binding protein RIC2 [Or... 134 2e-30
gi|50413456|ref|XP_457265.1| unnamed protein product [Debaryomyc... 134 2e-30
gi|18422766|ref|NP_568678.1| Ras-related GTP-binding protein, pu... 134 2e-30
gi|50540198|ref|NP_001002566.1| zgc:92757 [Danio rerio] >gnl|BL_... 134 2e-30
gi|38194437|gb|AAR13228.1| Rab family GTPase Rab8 [Fucus distichus] 134 2e-30
gi|19920864|ref|NP_609094.1| CG9100-PB [Drosophila melanogaster]... 134 2e-30
gi|50754287|ref|XP_414313.1| PREDICTED: similar to Ras-related p... 134 2e-30
gi|466172|sp|Q05737|YPT2_MAIZE GTP-binding protein YPTM2 >gnl|BL... 134 2e-30
gi|21555752|gb|AAM63927.1| guanine nucleotide regulatory protein... 133 3e-30
gi|7710086|ref|NP_057885.1| RAB10, member RAS oncogene family [M... 133 3e-30
gi|131804|sp|P24409|RB10_CANFA Ras-related protein Rab-10 >gnl|B... 133 3e-30
gi|50728924|ref|XP_416347.1| PREDICTED: similar to dGTPase (EC 3... 133 3e-30
gi|49901476|gb|AAH76437.1| Zgc:100889 protein [Danio rerio] 133 3e-30
gi|15233873|ref|NP_193578.1| Ras-related GTP-binding protein, pu... 133 3e-30
gi|5714658|gb|AAD48018.1| Rab GTP-binding protein Rab11a [Gossyp... 133 3e-30
gi|7438430|pir||T06445 GTP-binding protein - garden pea >gnl|BL_... 133 3e-30
gi|15077428|gb|AAK83158.1| small GTP-binding protein Ypt1p [Cand... 133 3e-30
gi|131847|sp|P22127|RB10_DISOM Ras-related protein Rab-10 (ORA1)... 133 4e-30
gi|1370172|emb|CAA98163.1| RAB1X [Lotus corniculatus var. japoni... 133 4e-30
gi|217841|dbj|BAA00832.1| small GTP-binding protein [Arabidopsis... 133 4e-30
gi|6321228|ref|NP_011305.1| probably involved in intra-Golgi tra... 133 4e-30
gi|18266415|gb|AAL67567.1| small GTP binding protein rab6 [Babes... 133 4e-30
gi|17509233|ref|NP_491857.1| RAB family member (22.7 kD) (rab-10... 133 4e-30
gi|37550537|ref|XP_290714.2| RAB41 protein [Homo sapiens] >gnl|B... 133 4e-30
gi|81634|pir||PS0279 GTP-binding protein ara-5 - Arabidopsis tha... 133 4e-30
gi|23613161|ref|NP_703483.1| Rab1 protein [Plasmodium falciparum... 133 4e-30
gi|4585808|emb|CAB40900.1| putative Rab1A protein [Plasmodium fa... 133 4e-30
gi|31199429|ref|XP_308662.1| ENSANGP00000011129 [Anopheles gambi... 133 4e-30
gi|47222415|emb|CAG12935.1| unnamed protein product [Tetraodon n... 132 5e-30
gi|37747686|gb|AAH60015.1| MGC68629 protein [Xenopus laevis] 132 5e-30
gi|49333384|gb|AAT64023.1| putative GTP-binding protein [Gossypi... 132 5e-30
gi|17737545|ref|NP_523970.1| CG7062-PA [Drosophila melanogaster]... 132 5e-30
gi|34853590|ref|XP_229401.2| similar to Ras-related protein Rab-... 132 5e-30
gi|45185452|ref|NP_983169.1| ABR220Wp [Eremothecium gossypii] >g... 132 5e-30
gi|16974365|gb|AAL31108.1| AT4g17530/dl4800c [Arabidopsis thaliana] 132 5e-30
gi|39595692|emb|CAE67195.1| Hypothetical protein CBG12631 [Caeno... 132 5e-30
gi|47228002|emb|CAF97631.1| unnamed protein product [Tetraodon n... 132 5e-30
gi|1370160|emb|CAA98186.1| RAB11J [Lotus corniculatus var. japon... 132 5e-30
gi|18414255|ref|NP_568121.1| Ras-related GTP-binding family prot... 132 5e-30
gi|42543204|pdb|1OIW|A Chain A, X-Ray Structure Of The Small G P... 132 5e-30
gi|47223593|emb|CAF99202.1| unnamed protein product [Tetraodon n... 132 5e-30
gi|1613773|gb|AAB16753.1| Rab1 132 5e-30
gi|29647488|dbj|BAC75417.1| putative GTP-binding protein(RAB11G)... 132 7e-30
gi|28628539|gb|AAO49245.1| GTPase Rab11-like protein [Giardia in... 132 7e-30
gi|50550177|ref|XP_502561.1| hypothetical protein [Yarrowia lipo... 132 7e-30
gi|32414965|ref|XP_327962.1| hypothetical protein ( (NM_017382) ... 132 7e-30
gi|31205793|ref|XP_311848.1| ENSANGP00000018202 [Anopheles gambi... 132 7e-30
gi|7438431|pir||T06446 GTP-binding protein - garden pea >gnl|BL_... 132 7e-30
gi|47223089|emb|CAG07176.1| unnamed protein product [Tetraodon n... 132 7e-30
gi|12084563|pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp >g... 132 7e-30
gi|13537447|dbj|BAB40678.1| small GTPase Rab11B [Entamoeba histo... 132 9e-30
gi|15238392|ref|NP_201330.1| Ras-related GTP-binding family prot... 132 9e-30
gi|48104721|ref|XP_392967.1| similar to CG3320-PA [Apis mellifera] 132 9e-30
gi|50370256|gb|AAH76054.1| Unknown (protein for MGC:92523) [Dani... 132 9e-30
gi|560504|emb|CAA82710.1| guanine nucleotide regulatory protein ... 132 9e-30
gi|50292391|ref|XP_448628.1| unnamed protein product [Candida gl... 132 9e-30
gi|7438375|pir||H71444 GTP-binding protein - Arabidopsis thalian... 132 9e-30
gi|50424201|ref|XP_460687.1| unnamed protein product [Debaryomyc... 132 9e-30
gi|12843097|dbj|BAB25858.1| unnamed protein product [Mus musculus] 131 1e-29
gi|7438425|pir||T07059 GTP-binding protein sra1 - soybean (fragm... 131 1e-29
gi|14475537|emb|CAC41973.1| putative Rab/GTPase [Colletotrichum ... 131 1e-29
gi|3024500|sp|Q40191|R11A_LOTJA Ras-related protein Rab11A >gnl|... 131 1e-29
gi|20139581|sp|Q96AX2|RB37_HUMAN Ras-related protein Rab-37 >gnl... 131 1e-29
gi|50556768|ref|XP_505792.1| hypothetical protein [Yarrowia lipo... 131 1e-29
gi|3024506|sp|Q40523|R11A_TOBAC Ras-related protein Rab11A >gnl|... 131 1e-29
gi|50306647|ref|XP_453297.1| unnamed protein product [Kluyveromy... 131 1e-29
gi|20129057|ref|NP_608373.1| CG9575-PA [Drosophila melanogaster]... 131 1e-29
gi|45360657|ref|NP_989002.1| hypothetical protein MGC75714 [Xeno... 131 1e-29
gi|48096836|ref|XP_392533.1| similar to ENSANGP00000020507 [Apis... 131 1e-29
gi|32411557|ref|XP_326259.1| RAS-RELATED PROTEIN RAB1BV [Neurosp... 131 1e-29
gi|15218575|ref|NP_175056.1| Ras-related GTP-binding protein, pu... 131 1e-29
gi|23479748|gb|EAA16491.1| putative GTPase [Plasmodium yoelii yo... 131 1e-29
gi|23490566|gb|EAA22313.1| Rab1 protein [Plasmodium yoelii yoelii] 131 1e-29
gi|33695095|ref|NP_057215.2| ras-related GTP-binding protein RAB... 130 2e-29
gi|48716902|dbj|BAD23597.1| putative GTP-binding protein [Oryza ... 130 2e-29
gi|499068|emb|CAA54506.1| GTPase [Glycine max] 130 2e-29
gi|37534998|ref|NP_921801.1| putative GTP-binding protein [Oryza... 130 2e-29
gi|47217979|emb|CAG02262.1| unnamed protein product [Tetraodon n... 130 2e-29
gi|22597170|gb|AAN03472.1| GTP-binding protein [Glycine max] 130 2e-29
gi|33873723|gb|AAH07681.2| RAB26 protein [Homo sapiens] 130 2e-29
gi|7677422|gb|AAF67162.1| GTPase Rab37 [Mus musculus] >gnl|BL_OR... 130 2e-29
gi|15451614|gb|AAK98738.1| Putative GTP-binding protein [Oryza s... 130 2e-29
gi|46116970|ref|XP_384503.1| hypothetical protein FG04327.1 [Gib... 130 2e-29
gi|46361978|ref|NP_055168.2| RAB26, member RAS oncogene family [... 130 2e-29
gi|44890744|gb|AAH66913.1| RAB26, member RAS oncogene family [Ho... 130 2e-29
gi|420269|pir||B42148 GTP-binding protein rab10 - rat 130 2e-29
gi|19424272|ref|NP_598264.1| RAB26, member RAS oncogene family [... 130 2e-29
gi|2463536|dbj|BAA22522.1| GTP binding protein [Rattus norvegicus] 130 2e-29
gi|15218719|ref|NP_174177.1| Ras-related GTP-binding protein, pu... 130 2e-29
gi|32492048|gb|AAP85296.1| Rab1a [Babesia bovis] 130 2e-29
gi|29841162|gb|AAP06175.1| similar to NM_002868 RAB5B, member RA... 130 2e-29
gi|541948|pir||S39565 GTP-binding protein rab1 - soybean >gnl|BL... 130 2e-29
gi|7438432|pir||T06447 GTP-binding protein - garden pea >gnl|BL_... 130 2e-29
gi|15232477|ref|NP_188124.1| Ras-related GTP-binding family prot... 130 2e-29
gi|1016750|gb|AAA79138.1| rab-related GTP-binding protein 130 2e-29
gi|34068436|gb|AAQ56773.1| ras-related GTP-binding protein Rab18... 130 2e-29
gi|15238115|ref|NP_199563.1| Ras-related GTP-binding protein, pu... 130 2e-29
gi|21361418|ref|NP_055303.2| RAB30, member RAS oncogene family [... 130 2e-29
gi|46123663|ref|XP_386385.1| hypothetical protein FG06209.1 [Gib... 130 2e-29
gi|15242483|ref|NP_199387.1| Ras-related GTP-binding protein, pu... 130 3e-29
gi|21536533|gb|AAM60865.1| Rab-type small GTP-binding protein-li... 130 3e-29
gi|27694927|gb|AAH43866.1| Rab5a-prov protein [Xenopus laevis] 130 3e-29
gi|50305705|ref|XP_452813.1| unnamed protein product [Kluyveromy... 130 3e-29
gi|25294121|pir||A86209 protein F22G5.24 [imported] - Arabidopsi... 130 3e-29
gi|7438373|pir||S72515 GTP-binding protein RAB1 - garden petunia... 130 3e-29
gi|49102994|ref|XP_411111.1| hypothetical protein AN6974.2 [Aspe... 130 3e-29
gi|50511479|gb|AAT77401.1| putative GTP-binding protein [Oryza s... 130 3e-29
gi|33859608|ref|NP_035356.1| RAB19, member RAS oncogene family [... 130 3e-29
gi|3041721|sp|P35294|RB19_MOUSE Ras-related protein Rab-19 >gnl|... 130 3e-29
gi|41150482|ref|XP_370980.1| similar to RAB41 [Homo sapiens] 130 3e-29
gi|50732756|ref|XP_418748.1| PREDICTED: similar to GTP-binding p... 130 3e-29
gi|47203604|emb|CAF87898.1| unnamed protein product [Tetraodon n... 130 3e-29
gi|46359908|gb|AAS88840.1| putative GTP-binding protein [Oryza s... 130 3e-29
gi|32401324|gb|AAP80834.1| GTP-binding protein [Griffithsia japo... 129 4e-29
gi|1370192|emb|CAA98173.1| RAB8B [Lotus corniculatus var. japoni... 129 4e-29
gi|541979|pir||S41431 GTP-binding protein, ras-like - fava bean ... 129 4e-29
gi|33416792|gb|AAH56058.1| Rab5-prov protein [Xenopus laevis] 129 4e-29
gi|12083645|ref|NP_073183.1| small GTP-binding protein rab5 [Rat... 129 4e-29
gi|5410357|gb|AAD43049.1| Rab27 isoform [Homo sapiens] 129 4e-29
gi|13537433|dbj|BAB40671.1| small GTPase RabD [Entamoeba histoly... 129 4e-29
gi|41393159|ref|NP_958909.1| RAB5C, member RAS oncogene family [... 129 4e-29
gi|7438389|pir||T12097 GTP-binding protein, ras-like (clone vfa-... 129 4e-29
gi|12322015|gb|AAG51053.1| ras-related GTP-binding protein, puta... 129 4e-29
gi|2708641|gb|AAB92559.1| GTPase rab11b [Dictyostelium discoideum] 129 4e-29
>gi|25153277|ref|NP_495984.2| RAB family member (rab-39)
[Caenorhabditis elegans]
gi|19571635|emb|CAA87774.2| Hypothetical protein D2013.1
[Caenorhabditis elegans]
Length = 229
Score = 471 bits (1211), Expect = e-132
Identities = 229/229 (100%), Positives = 229/229 (100%)
Frame = -1
Query: 690 METNFIGDDYGPLFHYQYRLIVIGDSTVGKSSLLRYFTEGKMAEISDPTVGVDFYARMIE 511
METNFIGDDYGPLFHYQYRLIVIGDSTVGKSSLLRYFTEGKMAEISDPTVGVDFYARMIE
Sbjct: 1 METNFIGDDYGPLFHYQYRLIVIGDSTVGKSSLLRYFTEGKMAEISDPTVGVDFYARMIE 60
Query: 510 LRPGYRVKLQLWDTAGQEKFRSITKSYYRNSVGVLAIYDTTNRESFEHVENWVKEAALNL 331
LRPGYRVKLQLWDTAGQEKFRSITKSYYRNSVGVLAIYDTTNRESFEHVENWVKEAALNL
Sbjct: 61 LRPGYRVKLQLWDTAGQEKFRSITKSYYRNSVGVLAIYDTTNRESFEHVENWVKEAALNL 120
Query: 330 GGPSPSKCVFQLVGTKSDMDSQRQVNYEEGEYFAKYHKMKFIETSSRTGDNVNEAFHMIA 151
GGPSPSKCVFQLVGTKSDMDSQRQVNYEEGEYFAKYHKMKFIETSSRTGDNVNEAFHMIA
Sbjct: 121 GGPSPSKCVFQLVGTKSDMDSQRQVNYEEGEYFAKYHKMKFIETSSRTGDNVNEAFHMIA 180
Query: 150 QEIQNRVDDGELRPVDGWEGLKTGIMRSQSVCLSERSFPQNSSAGACGC 4
QEIQNRVDDGELRPVDGWEGLKTGIMRSQSVCLSERSFPQNSSAGACGC
Sbjct: 181 QEIQNRVDDGELRPVDGWEGLKTGIMRSQSVCLSERSFPQNSSAGACGC 229