Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= D2013_8
(885 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532683|ref|NP_495988.1| eukaryotic Initiation Factor (32.9 ... 585 e-166
gi|39580632|emb|CAE72908.1| Hypothetical protein CBG20226 [Caeno... 336 5e-91
gi|21313620|ref|NP_079620.1| eukaryotic translation initiation f... 176 6e-43
gi|34858904|ref|XP_215037.2| similar to eukaryotic translation i... 176 8e-43
gi|30584931|gb|AAP36731.1| Homo sapiens eukaryotic translation i... 175 1e-42
gi|21754858|dbj|BAC04577.1| unnamed protein product [Homo sapiens] 175 1e-42
gi|4503519|ref|NP_003745.1| eukaryotic translation initiation fa... 175 1e-42
gi|26353564|dbj|BAC40412.1| unnamed protein product [Mus musculus] 175 1e-42
gi|29731731|ref|XP_290345.1| similar to eukaryotic translation i... 175 1e-42
gi|50749406|ref|XP_421624.1| PREDICTED: similar to eukaryotic tr... 173 5e-42
gi|47213008|emb|CAF95400.1| unnamed protein product [Tetraodon n... 169 1e-40
gi|47682703|gb|AAH70473.1| Eukaryotic translation initiation fac... 167 4e-40
gi|48126476|ref|XP_396596.1| similar to ENSANGP00000011020 [Apis... 160 3e-38
gi|31206031|ref|XP_311967.1| ENSANGP00000011020 [Anopheles gambi... 155 1e-36
gi|13994333|ref|NP_114149.1| IFP38 [Homo sapiens] >gnl|BL_ORD_ID... 152 7e-36
gi|24644059|ref|NP_649489.1| CG9769-PA [Drosophila melanogaster]... 152 1e-35
gi|49067000|ref|XP_397790.1| hypothetical protein UM00175.1 [Ust... 132 1e-29
gi|50554065|ref|XP_504441.1| hypothetical protein [Yarrowia lipo... 124 3e-27
gi|45550366|ref|NP_610210.2| CG8335-PA [Drosophila melanogaster]... 121 2e-26
gi|17064960|gb|AAL32634.1| 26S proteasome regulatory subunit [Ar... 120 5e-26
gi|15225611|ref|NP_181528.1| eukaryotic translation initiation f... 118 2e-25
gi|46359906|gb|AAS88838.1| putative 26S proteasome regulatory su... 113 6e-24
gi|19113090|ref|NP_596298.1| putative 26s proteasome regulatory ... 111 2e-23
gi|32412067|ref|XP_326514.1| hypothetical protein [Neurospora cr... 105 1e-21
gi|50257519|gb|EAL20224.1| hypothetical protein CNBF0360 [Crypto... 101 2e-20
gi|38099534|gb|EAA46867.1| hypothetical protein MG10653.4 [Magna... 100 4e-20
gi|46137119|ref|XP_390251.1| hypothetical protein FG10075.1 [Gib... 94 5e-18
gi|17426420|gb|AAL38054.1| translation initiation factor-3 subun... 87 5e-16
gi|23490332|gb|EAA22136.1| no apparent S. cerevisiae ortholog, p... 82 2e-14
gi|23480463|gb|EAA17015.1| probable 26s proteasome regulatory su... 80 5e-14
gi|23613648|ref|NP_704669.1| 26S proteasome regulatory subunit, ... 79 1e-13
gi|23613701|ref|NP_704722.1| hypothetical protein, conserved [Pl... 77 4e-13
gi|31239957|ref|XP_320392.1| ENSANGP00000013949 [Anopheles gambi... 77 5e-13
gi|17297979|dbj|BAB78487.1| 26S proteasome regulatory particle n... 74 3e-12
gi|46229762|gb|EAK90580.1| eIF3-p47 with JAB/PAD domain [Cryptos... 74 6e-12
gi|15229710|ref|NP_187736.1| 26S proteasome non-ATPase regulator... 72 2e-11
gi|46442466|gb|EAL01755.1| hypothetical protein CaO19.4283 [Cand... 72 2e-11
gi|15239230|ref|NP_196197.1| 26S proteasome non-ATPase regulator... 71 3e-11
gi|48097859|ref|XP_391960.1| similar to ENSANGP00000013949 [Apis... 70 5e-11
gi|24762618|ref|NP_523845.2| CG3416-PA [Drosophila melanogaster]... 69 2e-10
gi|6754724|ref|NP_034947.1| proteasome (prosome, macropain) 26S ... 68 2e-10
gi|26326937|dbj|BAC27212.1| unnamed protein product [Mus musculus] 68 2e-10
gi|2134660|pir||S65491 26S proteasome regulatory chain 12 - huma... 67 4e-10
gi|25777615|ref|NP_002802.2| proteasome 26S non-ATPase subunit 7... 67 4e-10
gi|50417591|gb|AAH77668.1| Unknown (protein for IMAGE:7027546) [... 67 4e-10
gi|33875323|gb|AAH00338.1| PSMD7 protein [Homo sapiens] 67 4e-10
gi|23491498|gb|EAA23016.1| Mov34/MPN/PAD-1 family, putative [Pla... 67 5e-10
gi|50260734|gb|EAL23384.1| hypothetical protein CNBA0350 [Crypto... 67 7e-10
gi|16225442|gb|AAL15890.1| 26S proteasome regulatory subunit S12... 66 9e-10
gi|47219752|emb|CAG03379.1| unnamed protein product [Tetraodon n... 66 9e-10
gi|1085272|pir||JC4154 26S proteasome regulatory chain, p40 - hu... 66 1e-09
gi|34851726|ref|XP_226439.2| similar to 26S proteasome non-ATPas... 66 1e-09
gi|41054245|ref|NP_956083.1| proteasome (prosome, macropain) 26S... 65 2e-09
gi|46229483|gb|EAK90301.1| 26S proteasome regulatory subunit, in... 65 3e-09
gi|50423017|ref|XP_460087.1| unnamed protein product [Debaryomyc... 65 3e-09
gi|29841006|gb|AAP06019.1| similar to NM_010817 26S proteasome r... 63 8e-09
gi|38346065|emb|CAE04833.2| OSJNBa0084K01.5 [Oryza sativa (japon... 62 1e-08
gi|50305325|ref|XP_452622.1| unnamed protein product [Kluyveromy... 61 3e-08
gi|50754041|ref|XP_414229.1| PREDICTED: similar to 26S proteasom... 60 5e-08
gi|41149862|ref|XP_372447.1| similar to eukaryotic translation i... 59 1e-07
gi|45184708|ref|NP_982426.1| AAL116Wp [Eremothecium gossypii] >g... 57 4e-07
gi|49095594|ref|XP_409258.1| hypothetical protein AN5121.2 [Aspe... 56 9e-07
gi|32415013|ref|XP_327986.1| hypothetical protein ( (AF028783) p... 56 9e-07
gi|2599117|gb|AAB84057.1| proteasome regulatory subunit 12 [Hypo... 55 2e-06
gi|19075303|ref|NP_587803.1| 26S proteasome regulatory subunit 1... 55 2e-06
gi|18463059|gb|AAL72631.1| proteasome regulatory non-ATP-ase sub... 54 4e-06
gi|38102580|gb|EAA49401.1| hypothetical protein MG01059.4 [Magna... 54 5e-06
gi|49068894|ref|XP_398736.1| hypothetical protein UM01121.1 [Ust... 54 5e-06
gi|45269968|gb|AAS56365.1| YOR261C [Saccharomyces cerevisiae] 54 5e-06
gi|1709802|sp|P26270|PSD7_DROME 26S proteasome non-ATPase regula... 54 5e-06
gi|29248592|gb|EAA40122.1| GLP_80_30499_29639 [Giardia lamblia A... 54 6e-06
gi|46138447|ref|XP_390914.1| hypothetical protein FG10738.1 [Gib... 54 6e-06
gi|50425129|ref|XP_461156.1| unnamed protein product [Debaryomyc... 53 8e-06
gi|17508685|ref|NP_491319.1| proteasome Regulatory Particle, Non... 53 1e-05
gi|6324835|ref|NP_014904.1| Essential, non-ATPase regulatory sub... 53 1e-05
gi|50292347|ref|XP_448606.1| unnamed protein product [Candida gl... 53 1e-05
gi|42407349|dbj|BAD08810.1| putative COP9 complex subunit 6 [Ory... 53 1e-05
gi|39586329|emb|CAE66740.1| Hypothetical protein CBG12090 [Caeno... 52 1e-05
gi|50551151|ref|XP_503049.1| hypothetical protein [Yarrowia lipo... 51 4e-05
gi|49067938|ref|XP_398258.1| hypothetical protein UM00643.1 [Ust... 51 4e-05
gi|48097062|ref|XP_393678.1| similar to COP9 signalosome subunit... 49 1e-04
gi|46436167|gb|EAK95534.1| hypothetical protein CaO19.3168 [Cand... 49 2e-04
gi|46436306|gb|EAK95670.1| hypothetical protein CaO19.10677 [Can... 49 2e-04
gi|3986482|gb|AAC84044.1| translation initiation factor eIF3 p40... 46 0.001
gi|4503515|ref|NP_003747.1| eukaryotic translation initiation fa... 44 0.004
gi|38454242|ref|NP_942046.1| eukaryotic translation initiation f... 44 0.004
gi|18079341|ref|NP_542366.1| eukaryotic translation initiation f... 44 0.004
gi|45361565|ref|NP_989359.1| hypothetical protein MGC75580 [Xeno... 44 0.005
gi|26353442|dbj|BAC40351.1| unnamed protein product [Mus musculus] 44 0.005
gi|47224079|emb|CAG12908.1| unnamed protein product [Tetraodon n... 43 0.008
gi|17738125|ref|NP_524451.1| CG6932-PA [Drosophila melanogaster]... 43 0.011
gi|31223431|ref|XP_317307.1| ENSANGP00000006844 [Anopheles gambi... 42 0.024
gi|18391211|ref|NP_563880.1| eukaryotic translation initiation f... 41 0.040
gi|12407660|gb|AAG53614.1| eukaryotic initiation factor 3H1 subu... 41 0.040
gi|29250286|gb|EAA41782.1| GLP_111_4773_5777 [Giardia lamblia AT... 41 0.040
gi|9367753|emb|CAB97491.1| non ATPase subunit MPR1 of 26S protea... 41 0.040
gi|10801566|dbj|BAB16696.1| similar to elF3p40 [Bombyx mori] 40 0.069
gi|28317180|gb|AAD46836.2| GM14618p [Drosophila melanogaster] 39 0.12
gi|45549263|ref|NP_524834.2| CG9124-PA [Drosophila melanogaster]... 39 0.12
gi|31239135|ref|XP_319981.1| ENSANGP00000016885 [Anopheles gambi... 39 0.15
gi|38346118|emb|CAE04596.2| OSJNBb0006N15.13 [Oryza sativa (japo... 39 0.15
gi|45201101|ref|NP_986671.1| AGR006Wp [Eremothecium gossypii] >g... 38 0.34
gi|50293523|ref|XP_449173.1| unnamed protein product [Candida gl... 38 0.34
gi|49089006|ref|XP_406266.1| hypothetical protein AN2129.2 [Aspe... 38 0.34
gi|21227679|ref|NP_633601.1| Nicotinate-nucleotide pyrophosphory... 37 0.45
gi|50309165|ref|XP_454588.1| unnamed protein product [Kluyveromy... 37 0.58
gi|26280369|gb|AAN77865.1| 26S proteasome regulatory subunit [Sa... 37 0.58
gi|14318526|ref|NP_116659.1| Metalloprotease subunit of the 19S ... 37 0.58
gi|50556996|ref|XP_505906.1| hypothetical protein [Yarrowia lipo... 37 0.76
gi|23619601|ref|NP_705563.1| proteasome regulatory subunit, puta... 36 1.3
gi|50425673|ref|XP_461433.1| unnamed protein product [Debaryomyc... 36 1.3
gi|49094336|ref|XP_408629.1| conserved hypothetical protein [Asp... 36 1.3
gi|49093798|ref|XP_408360.1| hypothetical protein AN4223.2 [Aspe... 36 1.3
gi|23490958|gb|EAA22608.1| Mov34/MPN/PAD-1 family, putative [Pla... 36 1.3
gi|50257989|gb|EAL20683.1| hypothetical protein CNBE0480 [Crypto... 35 1.7
gi|46436667|gb|EAK96026.1| hypothetical protein CaO19.7264 [Cand... 35 1.7
gi|12322742|gb|AAG51366.1| hypothetical protein; 78375-76401 [Ar... 35 2.2
gi|46852193|ref|NP_083596.2| progesterone-induced blocking facto... 35 2.2
gi|40254158|ref|NP_083730.2| progesterone-induced blocking facto... 35 2.2
gi|34874574|ref|XP_224451.2| similar to Progesterone-induced blo... 35 2.2
gi|12854251|dbj|BAB29974.1| unnamed protein product [Mus musculus] 35 2.2
gi|15887399|ref|NP_353080.1| AGR_C_64p [Agrobacterium tumefacien... 35 2.9
gi|24380073|ref|NP_722028.1| conserved hypothetical protein [Str... 34 4.9
gi|21928603|dbj|BAC05890.1| seven transmembrane helix receptor [... 33 8.4
gi|41194244|ref|XP_293581.3| similar to seven transmembrane heli... 33 8.4
gi|50306931|ref|XP_453441.1| unnamed protein product [Kluyveromy... 33 8.4
gi|50744696|ref|XP_419835.1| PREDICTED: similar to Midasin (MIDA... 33 8.4
gi|17933966|ref|NP_530756.1| glutamine amidotransferase [Agrobac... 33 8.4
gi|29247201|gb|EAA38772.1| GLP_47_33632_31947 [Giardia lamblia A... 33 8.4
>gi|17532683|ref|NP_495988.1| eukaryotic Initiation Factor (32.9 kD)
(eif-3.F) [Caenorhabditis elegans]
gi|7498175|pir||T20338 hypothetical protein D2013.7 -
Caenorhabditis elegans
gi|3875376|emb|CAA87773.1| Hypothetical protein D2013.7
[Caenorhabditis elegans]
Length = 294
Score = 585 bits (1508), Expect = e-166
Identities = 294/294 (100%), Positives = 294/294 (100%)
Frame = +1
Query: 1 MASNLTVNVHPGVYMNVVDTHMRRTKSSAKNTGQEKCMGTLMGYYEKGSIQVTNCFAIPF 180
MASNLTVNVHPGVYMNVVDTHMRRTKSSAKNTGQEKCMGTLMGYYEKGSIQVTNCFAIPF
Sbjct: 1 MASNLTVNVHPGVYMNVVDTHMRRTKSSAKNTGQEKCMGTLMGYYEKGSIQVTNCFAIPF 60
Query: 181 NESNDDLEIDDQFNQQMISALKKTSPNEQPVGWFLTTSDITSSCLIYHDYYVRVITEASA 360
NESNDDLEIDDQFNQQMISALKKTSPNEQPVGWFLTTSDITSSCLIYHDYYVRVITEASA
Sbjct: 61 NESNDDLEIDDQFNQQMISALKKTSPNEQPVGWFLTTSDITSSCLIYHDYYVRVITEASA 120
Query: 361 RRESPPIVVLTIDTTFSGDMSKRMPVRAYLRSKAGIPGAAGPHCAIFNPLRVELAAFPGE 540
RRESPPIVVLTIDTTFSGDMSKRMPVRAYLRSKAGIPGAAGPHCAIFNPLRVELAAFPGE
Sbjct: 121 RRESPPIVVLTIDTTFSGDMSKRMPVRAYLRSKAGIPGAAGPHCAIFNPLRVELAAFPGE 180
Query: 541 LVAMQLIEKALDSRRREATLESGLEQLETSTAQMIEWLERMLHYVEDVNKNGEKPGDAQI 720
LVAMQLIEKALDSRRREATLESGLEQLETSTAQMIEWLERMLHYVEDVNKNGEKPGDAQI
Sbjct: 181 LVAMQLIEKALDSRRREATLESGLEQLETSTAQMIEWLERMLHYVEDVNKNGEKPGDAQI 240
Query: 721 GRQLMDIVTASSNNMQPEKLDTLVKNTLRDYVMVSYLAKLTQTQLQVHERLVSA 882
GRQLMDIVTASSNNMQPEKLDTLVKNTLRDYVMVSYLAKLTQTQLQVHERLVSA
Sbjct: 241 GRQLMDIVTASSNNMQPEKLDTLVKNTLRDYVMVSYLAKLTQTQLQVHERLVSA 294