Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= D2023_7
(1011 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ... 263 5e-69
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno... 256 7e-67
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col... 98 3e-19
gi|39597491|emb|CAE59721.1| Hypothetical protein CBG03154 [Caeno... 97 8e-19
gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals ... 96 1e-18
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 95 2e-18
gi|39578830|emb|CAE57099.1| Hypothetical protein CBG24999 [Caeno... 83 9e-15
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 78 4e-13
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 77 8e-13
gi|687634|gb|AAA62504.1| collagen 76 1e-12
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 67 6e-10
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 64 5e-09
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 62 2e-08
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 62 2e-08
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 54 5e-08
gi|17535069|ref|NP_496535.1| COLlagen structural gene (col-84) [... 60 6e-08
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 60 8e-08
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 59 2e-07
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 59 2e-07
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 57 7e-07
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 57 9e-07
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 56 1e-06
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 55 2e-06
gi|39597161|emb|CAE59388.1| Hypothetical protein CBG02745 [Caeno... 55 2e-06
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 55 2e-06
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 55 3e-06
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 54 4e-06
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 54 6e-06
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 54 7e-06
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 54 7e-06
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 52 2e-05
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 52 3e-05
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 52 3e-05
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 52 3e-05
gi|17542824|ref|NP_501756.1| COLlagen structural gene (col-123) ... 51 5e-05
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 50 6e-05
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 50 6e-05
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 50 6e-05
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno... 50 6e-05
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 50 8e-05
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 50 8e-05
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 50 1e-04
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 49 1e-04
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 49 1e-04
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm... 49 1e-04
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P... 49 1e-04
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,... 49 2e-04
gi|23510135|ref|NP_702801.1| hypothetical protein [Plasmodium fa... 48 3e-04
gi|23508177|ref|NP_700847.1| gene 11-1 protein precursor [Plasmo... 48 4e-04
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno... 47 5e-04
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 47 5e-04
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 47 5e-04
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 47 5e-04
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 47 5e-04
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 47 5e-04
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 47 7e-04
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 47 7e-04
gi|50551527|ref|XP_503237.1| hypothetical protein [Yarrowia lipo... 47 7e-04
gi|124732|sp|P17941|INVO_HYLLA Involucrin >gnl|BL_ORD_ID|1811533... 47 7e-04
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 47 9e-04
gi|49121568|ref|XP_412424.1| hypothetical protein AN8287.2 [Aspe... 46 0.001
gi|48096459|ref|XP_392462.1| similar to CG18255-PA [Apis mellifera] 46 0.001
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (... 46 0.001
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,... 46 0.002
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 46 0.002
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (... 46 0.002
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy... 46 0.002
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc... 46 0.002
gi|39589597|emb|CAE66832.1| Hypothetical protein CBG12202 [Caeno... 46 0.002
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot... 46 0.002
gi|46227016|gb|EAK87966.1| hypothetical protein cgd5_2420 [Crypt... 45 0.002
gi|50556082|ref|XP_505449.1| hypothetical protein [Yarrowia lipo... 45 0.002
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 45 0.002
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 45 0.002
gi|2144789|pir||I37061 involucrin M - gorilla >gnl|BL_ORD_ID|838... 45 0.002
gi|39596974|emb|CAE59201.1| Hypothetical protein CBG02512 [Caeno... 45 0.003
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 45 0.003
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno... 45 0.003
gi|29251343|gb|EAA42825.1| GLP_574_57226_57648 [Giardia lamblia ... 45 0.003
gi|23483514|gb|EAA19159.1| hypothetical protein [Plasmodium yoel... 45 0.003
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r... 45 0.003
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 45 0.003
gi|50419303|ref|XP_458176.1| unnamed protein product [Debaryomyc... 45 0.003
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 45 0.003
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 45 0.003
gi|1711421|sp|P54705|SNWA_DICDI Protein snwA >gnl|BL_ORD_ID|9602... 45 0.003
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 45 0.003
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec... 45 0.003
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo... 44 0.004
gi|23507939|ref|NP_700609.1| hypothetical protein [Plasmodium fa... 44 0.004
gi|2144790|pir||I37060 involucrin L - gorilla >gnl|BL_ORD_ID|150... 44 0.004
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens] 44 0.004
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 44 0.004
gi|2144793|pir||I37062 involucrin S - gorilla >gnl|BL_ORD_ID|801... 44 0.004
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD... 44 0.004
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens] 44 0.006
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 44 0.006
gi|47847440|dbj|BAD21392.1| mFLJ00158 protein [Mus musculus] 44 0.006
gi|9826|emb|CAA30336.1| 11-1 polypeptide [Plasmodium falciparum] 44 0.006
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 44 0.006
gi|84211|pir||S00485 gene 11-1 protein precursor - malaria paras... 44 0.006
gi|115410|sp|P12114|CCS1_CAEEL Cuticle collagen sqt-1 >gnl|BL_OR... 44 0.006
gi|17535735|ref|NP_496421.1| SQuaT SQT-1, ROLler: helically twis... 44 0.006
gi|39597300|emb|CAE59528.1| Hypothetical protein CBG02923 [Caeno... 44 0.006
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 44 0.008
gi|32403550|ref|XP_322388.1| hypothetical protein [Neurospora cr... 44 0.008
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr... 44 0.008
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 44 0.008
gi|283629|pir||S27770 hypothetical protein 1 - African malaria m... 44 0.008
gi|28829971|gb|AAO52461.1| similar to Plasmodium falciparum. Hyp... 44 0.008
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ... 43 0.010
gi|28828501|gb|AAO51109.1| similar to Plasmodium falciparum (iso... 43 0.010
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot... 43 0.010
gi|33413774|gb|AAN39445.1| normocyte binding protein 2a [Plasmod... 43 0.010
gi|49094848|ref|XP_408885.1| hypothetical protein AN4748.2 [Aspe... 43 0.010
gi|49117079|gb|AAH73018.1| Unknown (protein for IMAGE:5048167) [... 43 0.010
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 43 0.010
gi|11346371|pir||T47235 sex determining protein [imported] - wes... 43 0.010
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ... 43 0.010
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ... 43 0.010
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno... 43 0.010
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 43 0.010
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno... 43 0.010
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 43 0.010
gi|28871907|ref|NP_794526.1| conserved hypothetical protein [Pse... 43 0.013
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo... 43 0.013
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno... 43 0.013
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna... 43 0.013
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo... 42 0.017
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 42 0.017
gi|902016|gb|AAB17102.1| EmmL2(A207) [Streptococcus pyogenes] 42 0.017
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate... 42 0.017
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 42 0.017
gi|33413782|gb|AAN39444.1| normocyte binding protein 2a [Plasmod... 42 0.017
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ... 42 0.017
gi|46227005|gb|EAK87955.1| membrane associated thioredoxin [Cryp... 42 0.017
gi|24954594|gb|AAN64683.1| M protein [Streptococcus pyogenes] 42 0.017
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 42 0.017
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 42 0.017
gi|33413776|gb|AAN39446.1| normocyte binding protein 2a [Plasmod... 42 0.017
gi|28510494|ref|XP_110955.2| similar to hypothetical protein DKF... 42 0.022
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl... 42 0.022
gi|50260271|gb|EAL22930.1| hypothetical protein CNBA6990 [Crypto... 42 0.022
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus... 42 0.022
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc... 42 0.022
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 42 0.022
gi|21755689|dbj|BAC04736.1| unnamed protein product [Homo sapiens] 42 0.022
gi|47214667|emb|CAG00903.1| unnamed protein product [Tetraodon n... 42 0.022
gi|40850918|gb|AAH65238.1| ENAH protein [Homo sapiens] 42 0.022
gi|32418656|ref|XP_329806.1| hypothetical protein [Neurospora cr... 42 0.022
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det... 42 0.022
gi|23509044|ref|NP_701712.1| hypothetical protein [Plasmodium fa... 42 0.022
gi|124731|sp|P07476|INVO_HUMAN Involucrin >gnl|BL_ORD_ID|1848736... 42 0.022
gi|11423493|ref|XP_001677.1| similar to Involucrin [Homo sapiens... 42 0.022
gi|7505675|pir||T32092 hypothetical protein K09F6.6 - Caenorhabd... 42 0.022
gi|25148570|ref|NP_740973.1| M protein repeat containing protein... 42 0.022
gi|23613722|ref|NP_704743.1| hypothetical protein [Plasmodium fa... 42 0.022
gi|39930375|ref|NP_060682.2| enabled homolog [Homo sapiens] >gnl... 42 0.022
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 42 0.022
gi|124736|sp|P14708|INVO_PONPY Involucrin >gnl|BL_ORD_ID|1318093... 42 0.022
gi|48428086|sp|Q8N8S7|ENAH_HUMAN Enabled protein homolog >gnl|BL... 42 0.022
gi|23619293|ref|NP_705255.1| reticulocyte binding protein 2 homo... 42 0.029
gi|13345187|gb|AAK19244.1| reticulocyte binding protein 2 homolo... 42 0.029
gi|124734|sp|P14591|INVO_PANPA Involucrin >gnl|BL_ORD_ID|553935 ... 42 0.029
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 42 0.029
gi|3024638|sp|Q62565|SRY_MUSSI Sex-determining region Y protein ... 42 0.029
gi|34485686|gb|AAQ73228.1| M protein [Streptococcus pyogenes] 42 0.029
gi|37531244|ref|NP_919924.1| unknown protein [Oryza sativa (japo... 42 0.029
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 42 0.029
gi|437639|gb|AAA72295.1| [Plasmodium falciparum 3' end.], gene p... 42 0.029
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ... 42 0.029
gi|22655493|gb|AAN04082.1| M76 [Streptococcus pyogenes] 42 0.029
gi|33598984|gb|AAQ23117.1| M73 [Streptococcus pyogenes] 42 0.029
gi|29290093|gb|AAO67564.1| Pol protein [Drosophila virilis] 42 0.029
gi|50752937|ref|XP_413803.1| PREDICTED: similar to senescence do... 42 0.029
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697... 42 0.029
gi|50786817|ref|XP_427726.1| PREDICTED: similar to senescence do... 42 0.029
gi|3044185|gb|AAC13303.1| mature parasite-infected erythrocyte s... 42 0.029
gi|32421759|ref|XP_331323.1| hypothetical protein [Neurospora cr... 42 0.029
gi|15238640|ref|NP_197870.1| expressed protein [Arabidopsis thal... 41 0.038
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 41 0.038
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 41 0.038
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis] 41 0.038
gi|50306605|ref|XP_453276.1| unnamed protein product [Kluyveromy... 41 0.038
gi|15030181|gb|AAH11346.1| Map4k6-pending protein [Mus musculus] 41 0.038
gi|28882060|ref|NP_795712.1| mitogen-activated protein kinase ki... 41 0.038
gi|29428007|sp|Q9JM52|M4K6_MOUSE Mitogen-activated protein kinas... 41 0.038
gi|30851421|gb|AAH52474.1| Map4k6-pending protein [Mus musculus] 41 0.038
gi|7657335|ref|NP_056531.1| misshapen/NIK-related kinase isoform... 41 0.038
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno... 41 0.038
gi|29290086|gb|AAO67558.1| Gag protein [Drosophila virilis] >gnl... 41 0.038
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi] 41 0.038
gi|24850117|ref|NP_733763.1| misshapen/NIK-related kinase isofor... 41 0.038
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat... 41 0.038
gi|7710058|ref|NP_057922.1| mitogen-activated protein kinase kin... 41 0.038
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli... 41 0.038
gi|29427834|sp|Q8N4C8|M4K6_HUMAN Mitogen-activated protein kinas... 41 0.038
gi|27436917|ref|NP_722549.2| misshapen/NIK-related kinase isofor... 41 0.038
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 41 0.049
gi|28830197|gb|AAO52648.1| similar to Dictyostelium discoideum (... 41 0.049
gi|1076839|pir||S49313 protein kinase - slime mold (Dictyosteliu... 41 0.049
gi|11467826|ref|NP_050877.1| hypothetical chloroplast RF2 [Nephr... 41 0.049
gi|28974295|gb|AAO61620.1| Rim101p [Candida dubliniensis] 41 0.049
gi|24286732|gb|AAN46886.1| nucleotide exchange factor RasGEF R [... 41 0.049
gi|28828532|gb|AAO51140.1| similar to Homo sapiens (Human). FLJ0... 41 0.049
gi|30689268|ref|NP_173925.3| phytochrome and flowering time regu... 41 0.049
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA... 41 0.049
gi|25518714|pir||G86385 hypothetical protein F2J7.4 [imported] -... 41 0.049
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 41 0.049
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ... 41 0.049
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 41 0.049
gi|17554908|ref|NP_497967.1| cyclin-like F-box (3F797) [Caenorha... 41 0.049
gi|25395695|pir||G88436 protein T04A8.13 [imported] - Caenorhabd... 41 0.049
gi|17544226|ref|NP_500151.1| putative prenylated nuclear protein... 40 0.064
gi|30721677|gb|AAP33688.1| phoshoprotein 300 [Plasmodium falcipa... 40 0.064
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays] 40 0.064
gi|39979199|emb|CAE85570.1| related to histone acetyltransferase... 40 0.064
gi|38343901|emb|CAE51956.2| M protein [Streptococcus pyogenes] 40 0.064
gi|50355643|dbj|BAD29962.1| Be158 [Babesia equi] 40 0.064
gi|6469707|gb|AAF13404.1| M protein precursor [Streptococcus pyo... 40 0.064
gi|7335658|gb|AAC27083.2| M protein [Streptococcus pyogenes] 40 0.064
gi|32413483|ref|XP_327221.1| predicted protein [Neurospora crass... 40 0.064
gi|39597356|emb|CAE59584.1| Hypothetical protein CBG02984 [Caeno... 40 0.064
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor... 40 0.064
gi|17505643|ref|NP_493296.1| putative N-myristoylated protein fa... 40 0.064
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 40 0.064
gi|32407080|ref|XP_324139.1| hypothetical protein [Neurospora cr... 40 0.064
gi|34485702|gb|AAQ73236.1| M protein [Streptococcus pyogenes] 40 0.064
gi|34864325|ref|XP_236385.2| similar to KIAA1749 protein [Rattus... 40 0.064
gi|23491384|gb|EAA22928.1| hypothetical protein [Plasmodium yoel... 40 0.064
gi|50308049|ref|XP_454025.1| unnamed protein product [Kluyveromy... 40 0.064
gi|27802723|emb|CAD60828.1| SI:bZ1D10.2 (novel protein similar t... 40 0.064
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 40 0.064
gi|45550724|ref|NP_649983.2| CG6254-PA [Drosophila melanogaster]... 40 0.064
gi|40882475|gb|AAR96149.1| RE70312p [Drosophila melanogaster] 40 0.064
gi|2981069|gb|AAC06230.1| M protein [Streptococcus pyogenes] 40 0.064
gi|24954676|gb|AAN64695.1| M protein [Streptococcus pyogenes] 40 0.064
gi|46116454|ref|XP_384245.1| hypothetical protein FG04069.1 [Gib... 40 0.084
gi|24954561|gb|AAN64677.1| M protein [Streptococcus pyogenes] 40 0.084
gi|33329250|gb|AAQ10025.1| putative esophageal gland cell secret... 40 0.084
gi|6321569|ref|NP_011646.1| Protein of unknown function; green f... 40 0.084
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ... 40 0.084
gi|15235082|ref|NP_195100.1| expressed protein [Arabidopsis thal... 40 0.084
gi|37595258|gb|AAQ94514.1| M protein [Streptococcus pyogenes] 40 0.084
gi|134874|sp|P16230|SRCH_RABIT Sarcoplasmic reticulum histidine-... 40 0.084
gi|50413693|ref|XP_457302.1| unnamed protein product [Debaryomyc... 40 0.084
gi|47087297|ref|NP_998654.1| zgc:63496 [Danio rerio] >gnl|BL_ORD... 40 0.084
gi|11544574|emb|CAC17668.1| dJ599F21.1 (KIAA1637) [Homo sapiens] 40 0.084
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno... 40 0.084
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis] 40 0.084
gi|11526821|gb|AAG36793.1| nuclear receptor coactivator CIA [Hom... 40 0.084
gi|11497246|ref|NP_051373.1| ErpM [Borrelia burgdorferi B31] >gn... 40 0.084
gi|23613415|ref|NP_703259.1| asparagine-rich antigen Pfa35-2 [Pl... 40 0.084
gi|11071800|emb|CAC14644.1| lectin-related protein [Leishmania m... 40 0.084
gi|15147335|ref|NP_066018.1| nuclear receptor coactivator 5; coa... 40 0.084
gi|2623357|gb|AAC53436.1| sex determining protein [Mus musculus ... 40 0.084
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr... 40 0.084
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 40 0.084
gi|32470418|ref|NP_863634.1| putative membrane protein TraK [Sta... 40 0.084
gi|15230788|ref|NP_189665.1| hypothetical protein [Arabidopsis t... 40 0.084
gi|28829970|gb|AAO52460.1| similar to Dictyostelium discoideum (... 40 0.11
gi|15232767|ref|NP_190311.1| hypothetical protein [Arabidopsis t... 40 0.11
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut... 40 0.11
gi|382658|prf||1819485A CENP-E protein 40 0.11
gi|48096897|ref|XP_392541.1| similar to ENSANGP00000014221 [Apis... 40 0.11
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C... 40 0.11
gi|46431871|gb|EAK91393.1| hypothetical protein CaO19.6160 [Cand... 40 0.11
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [... 40 0.11
gi|23508562|ref|NP_701231.1| hypothetical protein [Plasmodium fa... 40 0.11
gi|27806661|ref|NP_776463.1| dentin matrix acidic phosphoprotein... 40 0.11
gi|28850391|gb|AAO53165.1| similar to midasin, a large protein w... 40 0.11
gi|28569857|dbj|BAC57901.1| gag-like protein [Anopheles gambiae] 40 0.11
gi|45554124|ref|NP_996345.1| CG32776-PB [Drosophila melanogaster... 40 0.11
gi|46228483|gb|EAK89353.1| hypothetical protein cgd8_1380 [Crypt... 40 0.11
gi|49068676|ref|XP_398627.1| hypothetical protein UM01012.1 [Ust... 40 0.11
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 40 0.11
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 40 0.11
gi|19112576|ref|NP_595784.1| hypothetical coiled-coil protein [S... 40 0.11
gi|50550293|ref|XP_502619.1| hypothetical protein [Yarrowia lipo... 40 0.11
gi|23619292|ref|NP_705254.1| Plasmodium falciparum reticulocyte ... 39 0.14
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 39 0.14
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 39 0.14
gi|25411550|pir||F84514 hypothetical protein At2g14140 [imported... 39 0.14
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 39 0.14
gi|45478244|gb|AAS66293.1| LRRGT00202 [Rattus norvegicus] 39 0.14
gi|13345189|gb|AAK19245.1| reticulocyte binding protein 2 homolo... 39 0.14
gi|15223730|ref|NP_177804.1| expressed protein [Arabidopsis thal... 39 0.14
gi|7494334|pir||G71621 MAK16 homolog PFB0175c - malaria parasite... 39 0.14
gi|33413778|gb|AAN39448.1| normocyte binding protein 2b [Plasmod... 39 0.14
gi|22788715|ref|NP_690423.1| hypothetical protein HZV_4 [Helioth... 39 0.14
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc... 39 0.14
gi|42784018|ref|NP_981265.1| S-layer homology domain protein [Ba... 39 0.14
gi|15241453|ref|NP_199241.1| zinc finger (C3HC4-type RING finger... 39 0.14
gi|39593522|emb|CAE61814.1| Hypothetical protein CBG05782 [Caeno... 39 0.14
gi|23593269|ref|NP_472963.2| hypothetical protein [Plasmodium fa... 39 0.14
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ... 39 0.14
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 39 0.14
gi|32420697|ref|XP_330792.1| predicted protein [Neurospora crass... 39 0.14
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis] 39 0.14
gi|50752881|ref|XP_413790.1| PREDICTED: similar to hypothetical ... 39 0.14
gi|46229415|gb|EAK90233.1| membrane protein with multiple cystei... 39 0.14
gi|31205109|ref|XP_311503.1| ENSANGP00000013657 [Anopheles gambi... 39 0.14
gi|46434633|gb|EAK94037.1| hypothetical protein CaO19.1897 [Cand... 39 0.19
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 39 0.19
gi|113007|sp|P23745|ABRA_PLAFG 101 kDa malaria antigen (P101) (A... 39 0.19
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 39 0.19
gi|50289021|ref|XP_446940.1| unnamed protein product [Candida gl... 39 0.19
gi|7158835|gb|AAF37556.1| p101/acidic basic repeat antigen [Plas... 39 0.19
gi|113005|sp|P22620|ABRA_PLAFC 101 kDa malaria antigen (P101) (A... 39 0.19
gi|23508971|ref|NP_701639.1| 101 kd malaria antigen [Plasmodium ... 39 0.19
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 39 0.19
gi|24641597|ref|NP_536797.2| CG4013-PA [Drosophila melanogaster]... 39 0.19
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 39 0.19
gi|46444158|gb|EAL03435.1| hypothetical protein CaO19.4998 [Cand... 39 0.19
gi|15238595|ref|NP_200811.1| expressed protein [Arabidopsis thal... 39 0.19
gi|24661837|ref|NP_648347.1| CG16711-PA [Drosophila melanogaster... 39 0.19
gi|42734056|gb|AAS38928.1| similar to Dictyostelium discoideum (... 39 0.19
gi|50233906|ref|NP_956976.2| hypothetical protein MGC65888 [Dani... 39 0.19
gi|34849582|gb|AAH58319.1| Zgc:65888 protein [Danio rerio] 39 0.19
gi|50759944|ref|XP_425782.1| PREDICTED: similar to Hu-Claspin [G... 39 0.19
gi|31215736|ref|XP_316086.1| ENSANGP00000012452 [Anopheles gambi... 39 0.19
gi|18858043|ref|NP_572255.1| CG15772-PA [Drosophila melanogaster... 39 0.19
gi|47180733|emb|CAG14181.1| unnamed protein product [Tetraodon n... 39 0.19
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (... 39 0.19
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g... 39 0.19
gi|2801529|gb|AAB97359.1| IgG immunoreactive antigen [Strongyloi... 39 0.19
gi|40807185|gb|AAH65317.1| Pinx1 protein [Danio rerio] 39 0.19
gi|21357267|ref|NP_649312.1| CG6014-PA [Drosophila melanogaster]... 39 0.19
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 39 0.25
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 39 0.25
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 39 0.25
gi|47221995|emb|CAG08250.1| unnamed protein product [Tetraodon n... 39 0.25
gi|4959901|gb|AAD34546.1| M protein [Streptococcus pyogenes] 39 0.25
gi|2271479|gb|AAC53450.1| sex determining protein [Mus musculus ... 39 0.25
gi|23510180|ref|NP_702846.1| ran binding protein 1 [Plasmodium f... 39 0.25
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha... 39 0.25
gi|39586364|emb|CAE74021.1| Hypothetical protein CBG21669 [Caeno... 39 0.25
gi|24640147|ref|NP_572325.1| CG3950-PA [Drosophila melanogaster]... 39 0.25
gi|23612655|ref|NP_704216.1| hypothetical protein [Plasmodium fa... 39 0.25
gi|39979119|emb|CAE85494.1| putative protein [Neurospora crassa] 39 0.25
gi|39586591|emb|CAE73718.1| Hypothetical protein CBG21232 [Caeno... 39 0.25
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 39 0.25
gi|124727|sp|P24708|INVO_AOTTR Involucrin >gnl|BL_ORD_ID|1836165... 39 0.25
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 39 0.25
gi|17558378|ref|NP_504775.1| putative protein, with 4 coiled coi... 39 0.25
gi|6322648|ref|NP_012721.1| Putative positive regulator of manno... 39 0.25
gi|2980817|emb|CAA82046.1| MNN4 [Saccharomyces cerevisiae] 39 0.25
gi|23508165|ref|NP_700835.1| DNA polymerase zeta catalytic subun... 39 0.25
gi|28850383|gb|AAO53158.1| similar to Plasmodium falciparum (iso... 39 0.25
gi|16804991|ref|NP_473020.1| hypothetical protein [Plasmodium fa... 38 0.32
gi|6960212|gb|AAF33404.1| cytoplasmic protein 89BC [Drosophila m... 38 0.32
gi|32406504|ref|XP_323865.1| hypothetical protein [Neurospora cr... 38 0.32
gi|17864668|ref|NP_524996.1| CG6815-PA [Drosophila melanogaster]... 38 0.32
gi|31241691|ref|XP_321276.1| ENSANGP00000018412 [Anopheles gambi... 38 0.32
gi|17158247|ref|NP_477665.1| wsv143 [shrimp white spot syndrome ... 38 0.32
gi|15021476|gb|AAK77753.1| ORF84 [shrimp white spot syndrome virus] 38 0.32
gi|23271723|gb|AAH23707.1| 4930570G11Rik protein [Mus musculus] 38 0.32
gi|34785442|gb|AAH57524.1| LOC402861 protein [Danio rerio] 38 0.32
gi|32422107|ref|XP_331497.1| predicted protein [Neurospora crass... 38 0.32
gi|49086664|ref|XP_405362.1| hypothetical protein AN1225.2 [Aspe... 38 0.32
gi|32407697|ref|XP_324355.1| hypothetical protein [Neurospora cr... 38 0.32
gi|7484702|pir||T10738 hypothetical protein FbLate-2 - sea-islan... 38 0.32
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 38 0.32
gi|121286|sp|P11827|GLCX_SOYBN Beta-conglycinin, alpha' chain pr... 38 0.32
gi|23098755|ref|NP_692221.1| hypothetical protein OB1300 [Oceano... 38 0.32
gi|16198095|gb|AAL13845.1| LD30988p [Drosophila melanogaster] 38 0.32
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 38 0.32
gi|46309052|ref|ZP_00211244.1| COG3505: Type IV secretory pathwa... 38 0.32
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot... 38 0.32
gi|3551531|dbj|BAA33016.1| avena [Gallus gallus] 38 0.32
gi|38076392|ref|XP_127780.3| RIKEN cDNA 4930570G11 [Mus musculus] 38 0.32
gi|11602810|dbj|BAB18909.1| avenaII [Gallus gallus] 38 0.32
gi|23486300|gb|EAA20765.1| hypothetical protein [Plasmodium yoel... 38 0.32
gi|23486663|gb|EAA20861.1| strong similarity to unknown protein-... 38 0.32
gi|9967361|dbj|BAA74452.2| alpha' subunit of beta-conglycinin [G... 38 0.32
gi|45383540|ref|NP_989631.1| enabled homolog [Gallus gallus] >gn... 38 0.32
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno... 38 0.32
gi|19481790|gb|AAL89066.1| WSSV198 [shrimp white spot syndrome v... 38 0.32
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D... 38 0.42
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster... 38 0.42
gi|7710046|ref|NP_057914.1| kinesin family member 21A; N-5 kines... 38 0.42
gi|47218995|emb|CAG02033.1| unnamed protein product [Tetraodon n... 38 0.42
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ... 38 0.42
gi|2072290|gb|AAC60120.1| XL-INCENP [Xenopus laevis] 38 0.42
gi|23613032|ref|NP_703354.1| Mature parasite-infected erythrocyt... 38 0.42
gi|37360516|dbj|BAC98236.1| mKIAA1708 protein [Mus musculus] 38 0.42
gi|31210793|ref|XP_314363.1| ENSANGP00000012739 [Anopheles gambi... 38 0.42
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster... 38 0.42
gi|50426497|ref|XP_461845.1| unnamed protein product [Debaryomyc... 38 0.42
gi|45383522|ref|NP_989644.1| histone deacetylase 4 [Gallus gallu... 38 0.42
gi|23508231|ref|NP_700900.1| hypothetical protein [Plasmodium fa... 38 0.42
gi|28829000|gb|AAO51575.1| similar to Homo sapiens (Human). Myot... 38 0.42
gi|9910376|ref|NP_064623.1| inner centromere protein antigens 13... 38 0.42
gi|24659567|ref|NP_648056.1| CG10107-PA [Drosophila melanogaster... 38 0.42
gi|49619033|gb|AAT68101.1| twistnb-like [Danio rerio] 38 0.42
gi|46227735|gb|EAK88655.1| WD repeat protein [Cryptosporidium pa... 38 0.42
gi|38603523|dbj|BAD02898.1| bacteriolytic enzyme [Bacillus clausii] 38 0.42
gi|7494396|pir||H71602 protein with DnaJ domain (RESA-like) PFB0... 38 0.42
gi|1711494|sp|P50470|SPH_STRPY Immunoglobulin G binding protein ... 38 0.42
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster... 38 0.42
gi|23508651|ref|NP_701320.1| hypothetical protein [Plasmodium fa... 38 0.42
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me... 38 0.42
gi|21392058|gb|AAM48383.1| RE01412p [Drosophila melanogaster] 38 0.42
gi|38173724|gb|AAH60698.1| Kif21a protein [Mus musculus] >gnl|BL... 38 0.42
gi|32398688|emb|CAD98648.1| retinitis pigmentosa GTPase regulato... 38 0.42
gi|46228936|gb|EAK89785.1| hypothetical protein with signal pept... 38 0.42
gi|23593332|ref|NP_473112.2| hypothetical protein [Plasmodium fa... 38 0.42
gi|50401187|sp|Q9QXL2|K21A_MOUSE Kinesin family member 21A 38 0.42
gi|46125747|ref|XP_387427.1| hypothetical protein FG07251.1 [Gib... 38 0.42
gi|7494317|pir||E71606 hypothetical protein PFB0765w - malaria p... 37 0.55
gi|24654024|ref|NP_725525.1| CG8421-PA [Drosophila melanogaster]... 37 0.55
gi|31235077|ref|XP_319177.1| ENSANGP00000012409 [Anopheles gambi... 37 0.55
gi|34865500|ref|XP_345960.1| similar to hypothetical protein [Ra... 37 0.55
gi|23593319|ref|NP_703169.1| hypothetical protein [Plasmodium fa... 37 0.55
gi|13173388|gb|AAK14386.1| lysine/glutamic acid-rich protein [Ca... 37 0.55
gi|2498165|sp|Q12797|ASPH_HUMAN Aspartyl/asparaginyl beta-hydrox... 37 0.55
gi|44680105|ref|NP_149129.2| caldesmon 1 isoform 1 [Homo sapiens] 37 0.55
gi|2498204|sp|Q05682|CALD_HUMAN Caldesmon (CDM) >gnl|BL_ORD_ID|3... 37 0.55
gi|50422753|ref|XP_459953.1| unnamed protein product [Debaryomyc... 37 0.55
gi|11497346|ref|NP_051450.1| ErpQ [Borrelia burgdorferi B31] >gn... 37 0.55
gi|39583527|emb|CAE73985.1| Hypothetical protein CBG21616 [Caeno... 37 0.55
gi|50405707|ref|XP_456492.1| unnamed protein product [Debaryomyc... 37 0.55
gi|17550336|ref|NP_510658.1| TBP-Associated transcription Factor... 37 0.55
gi|14589860|ref|NP_115855.1| aspartate beta-hydroxylase isoform ... 37 0.55
gi|124737|sp|P24712|INVO_SAGOE Involucrin >gnl|BL_ORD_ID|574947 ... 37 0.55
gi|9857|emb|CAA35526.1| unnamed protein product [Plasmodium falc... 37 0.55
gi|39579513|emb|CAE56338.1| Hypothetical protein CBG24007 [Caeno... 37 0.55
gi|21401759|ref|NP_657744.1| HD, HD domain [Bacillus anthracis A... 37 0.55
gi|7688242|emb|CAB89812.1| convicilin [Lens culinaris] 37 0.55
gi|24654027|ref|NP_725526.1| CG8421-PD [Drosophila melanogaster]... 37 0.55
gi|16768468|gb|AAL28453.1| GM05229p [Drosophila melanogaster] 37 0.55
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 37 0.55
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 37 0.55
gi|49478075|ref|YP_037307.1| conserved hypothetical protein, glu... 37 0.55
gi|17647175|ref|NP_523757.1| CG8421-PB [Drosophila melanogaster]... 37 0.55
gi|46226679|gb|EAK87658.1| Low complexity protein with large Glu... 37 0.55
gi|14589864|ref|NP_115857.1| aspartate beta-hydroxylase isoform ... 37 0.55
gi|21231078|ref|NP_636995.1| unknown acidic aa rich protein [Xan... 37 0.55
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 37 0.55
gi|23613219|ref|NP_703541.1| hypothetical protein [Plasmodium fa... 37 0.55
gi|23509422|ref|NP_702089.1| hypothetical protein [Plasmodium fa... 37 0.55
gi|42734064|gb|AAS38936.1| similar to Plasmodium falciparum (iso... 37 0.55
gi|1916332|gb|AAB51153.1| M protein precursor [Streptococcus pyo... 37 0.55
gi|48838225|ref|ZP_00295172.1| hypothetical protein Meth02003882... 37 0.55
gi|2126731|pir||S62074 M-like protein enn precursor - Streptococ... 37 0.55
gi|50290483|ref|XP_447673.1| unnamed protein product [Candida gl... 37 0.55
gi|34189305|gb|AAH15518.1| ASPH protein [Homo sapiens] 37 0.55
gi|14589866|ref|NP_004309.2| aspartate beta-hydroxylase isoform ... 37 0.55
gi|1911652|gb|AAB50779.1| aspartyl(asparaginyl)beta-hydroxylase;... 37 0.55
gi|39590156|emb|CAE61154.1| Hypothetical protein CBG04920 [Caeno... 37 0.55
gi|2935563|gb|AAC05160.1| M protein [Streptococcus pyogenes] 37 0.55
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [... 37 0.55
gi|2623355|gb|AAC53435.1| sex determining protein [Mus musculus ... 37 0.55
gi|23380433|gb|AAN17932.1| Erp24 protein [Borrelia burgdorferi] 37 0.55
gi|120558|sp|P13709|FSH_DROME FEMALE STERILE HOMEOTIC PROTEIN (F... 37 0.71
gi|24648119|ref|NP_650778.1| CG6026-PA [Drosophila melanogaster]... 37 0.71
gi|34877251|ref|XP_214044.2| similar to FIP1-like 1; rearranged ... 37 0.71
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 37 0.71
gi|28436809|gb|AAH47109.1| Radixin [Homo sapiens] 37 0.71
gi|17539078|ref|NP_502507.1| COLlagen structural gene (col-131) ... 37 0.71
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 37 0.71
gi|16198327|gb|AAL14009.1| SD07158p [Drosophila melanogaster] 37 0.71
gi|31560210|ref|NP_077145.2| FIP1 like 1 [Mus musculus] >gnl|BL_... 37 0.71
gi|34880180|ref|XP_223350.2| similar to 1300019H17Rik protein [R... 37 0.71
gi|13182946|gb|AAK14999.1| centromere binding protein 1 [Candida... 37 0.71
gi|6688939|emb|CAB65345.1| PR7 protein [Plasmodium falciparum] 37 0.71
gi|28572050|ref|NP_733137.2| CG32474-PA [Drosophila melanogaster... 37 0.71
gi|11078661|gb|AAG29138.1| Ras guanine nucleotide exchange facto... 37 0.71
gi|24286634|gb|AAN46871.1| nucleotide exchange factor RasGEF B [... 37 0.71
gi|23612220|ref|NP_703800.1| myosin-like protein, putative [Plas... 37 0.71
gi|12842820|dbj|BAB25745.1| unnamed protein product [Mus musculus] 37 0.71
gi|47220975|emb|CAF98204.1| unnamed protein product [Tetraodon n... 37 0.71
gi|21751898|dbj|BAC04065.1| unnamed protein product [Homo sapiens] 37 0.71
gi|50414793|gb|AAH77786.1| Unknown (protein for IMAGE:4970537) [... 37 0.71
gi|47204292|emb|CAG13587.1| unnamed protein product [Tetraodon n... 37 0.71
gi|30794328|ref|NP_851362.1| cyclic nucleotide gated channel bet... 37 0.71
gi|9631517|ref|NP_048117.1| ORF MSV046 hypothetical protein [Mel... 37 0.71
gi|39584941|emb|CAE64365.1| Hypothetical protein CBG09052 [Caeno... 37 0.71
gi|25005391|emb|CAD56488.1| M protein [Streptococcus pyogenes] 37 0.71
gi|45185072|ref|NP_982789.1| ABL158Cp [Eremothecium gossypii] >g... 37 0.71
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 37 0.71
gi|20129887|ref|NP_610708.1| CG13185-PA [Drosophila melanogaster... 37 0.71
gi|50084124|ref|YP_045634.1| ATP-dependent dsDNA exonuclease (Su... 37 0.71
gi|24639615|ref|NP_726905.1| CG32778-PA [Drosophila melanogaster... 37 0.71
gi|26340408|dbj|BAC33867.1| unnamed protein product [Mus musculus] 37 0.71
gi|32403762|ref|XP_322494.1| predicted protein [Neurospora crass... 37 0.71
gi|50307259|ref|XP_453608.1| unnamed protein product [Kluyveromy... 37 0.71
gi|50288897|ref|XP_446878.1| unnamed protein product [Candida gl... 37 0.71
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass... 37 0.71
gi|38089141|ref|XP_146248.3| MYST histone acetyltransferase (mon... 37 0.71
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno... 37 0.93
gi|39584297|emb|CAE65461.1| Hypothetical protein CBG10426 [Caeno... 37 0.93
gi|15232498|ref|NP_188130.1| AAA-type ATPase family protein [Ara... 37 0.93
gi|29421206|dbj|BAB21840.2| KIAA1749 protein [Homo sapiens] 37 0.93
gi|124729|sp|P24709|INVO_CEBAL Involucrin >gnl|BL_ORD_ID|1943485... 37 0.93
gi|17554688|ref|NP_497667.1| putative membrane protein, with 5 c... 37 0.93
gi|46442947|gb|EAL02232.1| hypothetical protein CaO19.8420 [Cand... 37 0.93
gi|17551634|ref|NP_508124.1| kinase (40.9 kD) (XB213) [Caenorhab... 37 0.93
gi|17569623|ref|NP_509801.1| esophageal gland cell secretory pro... 37 0.93
gi|42782297|ref|NP_979544.1| lipoprotein, putative [Bacillus cer... 37 0.93
>gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD)
(col-158) [Caenorhabditis elegans]
gi|7498188|pir||T20348 hypothetical protein D2023.7 -
Caenorhabditis elegans
gi|3875408|emb|CAB02874.1| Hypothetical protein D2023.7
[Caenorhabditis elegans]
Length = 336
Score = 263 bits (672), Expect = 5e-69
Identities = 133/163 (81%), Positives = 133/163 (81%)
Frame = +1
Query: 1 MSVTKATAGALCLSSATLILSLYAIFSIYSDVQSIWSQLDQEMDQFKVTTDDLWTQMLGL 180
MSVTKATAGALCLSSATLILSLYAIFSIYSDVQSIWSQLDQEMDQFKVTTDDLWTQMLGL
Sbjct: 1 MSVTKATAGALCLSSATLILSLYAIFSIYSDVQSIWSQLDQEMDQFKVTTDDLWTQMLGL 60
Query: 181 GAATVSNRQRRQGKEQYGGYEAQGVNPGPTCSCSSGNGNGDDALGTXXXXXXXXXXXXXX 360
GAATVSNRQRRQGKEQYGGYEAQGVNPGPTCSCSSGNGNGDDALGT
Sbjct: 61 GAATVSNRQRRQGKEQYGGYEAQGVNPGPTCSCSSGNGNGDDALGTGGCPAGPSGPQGSA 120
Query: 361 XXXXXXXXXXXXXXXXENAEDSQNAPFNGCITCAPGKPGSPGE 489
ENAEDSQNAPFNGCITCAPGKPGSPGE
Sbjct: 121 GPDGIPGIDGQDGFPGENAEDSQNAPFNGCITCAPGKPGSPGE 163
Score = 83.2 bits (204), Expect = 9e-15
Identities = 37/53 (69%), Positives = 37/53 (69%)
Frame = +1
Query: 850 AAYCPCPDRNAPKENYASAPSHNPSNAPXXXXXXXXXXXXXXXXHAQNSYGKK 1008
AAYCPCPDRNAPKENYASAPSHNPSNAP HAQNSYGKK
Sbjct: 284 AAYCPCPDRNAPKENYASAPSHNPSNAPGASYSAGTGGYSGGTGHAQNSYGKK 336