Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= D2024_8
(966 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ... 271 2e-71
gi|7498195|pir||T34203 hypothetical protein D2024.8 - Caenorhabd... 264 2e-69
gi|39593552|emb|CAE61844.1| Hypothetical protein CBG05818 [Caeno... 239 9e-62
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 88 3e-16
gi|687634|gb|AAA62504.1| collagen 87 7e-16
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 83 1e-14
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 82 1e-14
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 82 1e-14
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 82 1e-14
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 81 4e-14
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 80 9e-14
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 80 9e-14
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 79 1e-13
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 79 2e-13
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 79 2e-13
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 79 2e-13
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 79 2e-13
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 78 3e-13
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 77 4e-13
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 74 4e-12
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 74 4e-12
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 74 4e-12
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 74 5e-12
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 74 5e-12
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 72 2e-11
gi|23480318|gb|EAA16908.1| Drosophila melanogaster CG8797 gene p... 71 3e-11
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 71 4e-11
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 63 6e-11
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 69 2e-10
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 69 2e-10
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 69 2e-10
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 69 2e-10
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 68 3e-10
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 67 5e-10
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 67 6e-10
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 66 1e-09
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 66 1e-09
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 57 1e-09
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 66 1e-09
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 66 1e-09
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 66 1e-09
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 65 2e-09
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 65 2e-09
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [... 65 2e-09
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 65 3e-09
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 65 3e-09
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697... 64 4e-09
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 64 4e-09
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 64 5e-09
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 64 5e-09
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 64 5e-09
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 64 7e-09
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 64 7e-09
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-... 64 7e-09
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 63 9e-09
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 63 9e-09
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 63 9e-09
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 63 1e-08
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 63 1e-08
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 63 1e-08
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 62 1e-08
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 62 2e-08
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 62 3e-08
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ... 62 3e-08
gi|1184072|gb|AAC47437.1| COL-1 62 3e-08
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno... 61 3e-08
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 61 3e-08
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno... 61 3e-08
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (... 61 4e-08
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno... 61 4e-08
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ... 60 6e-08
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 60 6e-08
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 60 6e-08
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 60 6e-08
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 60 7e-08
gi|1589837|gb|AAC48358.1| cuticle preprocollagen [Meloidogyne in... 60 1e-07
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 60 1e-07
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT... 60 1e-07
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 59 1e-07
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ... 59 2e-07
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ... 59 2e-07
gi|28374176|gb|AAH46263.1| LOC398566 protein [Xenopus laevis] 59 2e-07
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 59 2e-07
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 59 2e-07
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 58 3e-07
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo... 58 4e-07
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr... 58 4e-07
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 58 4e-07
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 58 4e-07
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 57 5e-07
gi|28829970|gb|AAO52460.1| similar to Dictyostelium discoideum (... 57 6e-07
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 57 6e-07
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 57 6e-07
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 57 8e-07
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 57 8e-07
gi|28569857|dbj|BAC57901.1| gag-like protein [Anopheles gambiae] 56 1e-06
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|... 56 1e-06
gi|46227023|gb|EAK87973.1| ubiquitin C-terminal hydrolase of the... 56 1e-06
gi|27367908|ref|NP_763435.1| TPR repeat containing protein [Vibr... 56 1e-06
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 56 1e-06
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det... 55 2e-06
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 55 2e-06
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (... 55 2e-06
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ... 55 2e-06
gi|39580392|emb|CAE70951.1| Hypothetical protein CBG17762 [Caeno... 55 2e-06
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 55 3e-06
gi|17550336|ref|NP_510658.1| TBP-Associated transcription Factor... 54 4e-06
gi|39580360|emb|CAE61465.1| Hypothetical protein CBG05357 [Caeno... 54 5e-06
gi|29290086|gb|AAO67558.1| Gag protein [Drosophila virilis] >gnl... 54 5e-06
gi|17537301|ref|NP_494562.1| COLlagen structural gene (37.0 kD) ... 54 5e-06
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (... 54 7e-06
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 53 9e-06
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 53 1e-05
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ... 52 2e-05
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ... 52 2e-05
gi|3024638|sp|Q62565|SRY_MUSSI Sex-determining region Y protein ... 52 2e-05
gi|39588428|emb|CAE72779.1| Hypothetical protein CBG20034 [Caeno... 52 2e-05
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 52 3e-05
gi|50806838|ref|XP_428858.1| PREDICTED: similar to tumor-related... 52 3e-05
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,... 52 3e-05
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 52 3e-05
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 51 3e-05
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r... 51 3e-05
gi|42733836|gb|AAS38754.1| hypothetical protein [Dictyostelium d... 51 3e-05
gi|24642197|ref|NP_573033.1| CG6324-PA [Drosophila melanogaster]... 51 4e-05
gi|7484702|pir||T10738 hypothetical protein FbLate-2 - sea-islan... 51 4e-05
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 51 4e-05
gi|28829875|gb|AAO52372.1| similar to Dictyostelium discoideum (... 51 4e-05
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc... 51 4e-05
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno... 51 4e-05
gi|39596517|emb|CAE63136.1| Hypothetical protein CBG07436 [Caeno... 51 4e-05
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ... 51 4e-05
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ... 50 6e-05
gi|4809258|gb|AAD30169.1| collagen [Haemonchus contortus] 50 6e-05
gi|40253455|dbj|BAD05406.1| unknown protein [Oryza sativa (japon... 50 8e-05
gi|23508683|ref|NP_701352.1| antigen 332, putative [Plasmodium f... 50 8e-05
gi|31201295|ref|XP_309595.1| ENSANGP00000010937 [Anopheles gambi... 50 8e-05
gi|34904902|ref|NP_913798.1| similar to pre-mRNA processing prot... 50 8e-05
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 50 8e-05
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her... 50 1e-04
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno... 50 1e-04
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 45 1e-04
gi|11346371|pir||T47235 sex determining protein [imported] - wes... 49 1e-04
gi|17550148|ref|NP_509861.1| putative protein (XL762) [Caenorhab... 49 1e-04
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno... 49 1e-04
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 49 1e-04
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno... 49 1e-04
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis] 49 2e-04
gi|11345238|gb|AAG34657.1| involucrin [Mus musculus] 49 2e-04
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus] 49 2e-04
gi|49523567|emb|CAF18245.1| STYLOSA protein [Antirrhinum majus] 49 2e-04
gi|11345242|gb|AAG34659.1| involucrin [Mus musculus] 49 2e-04
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738... 49 2e-04
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ... 49 2e-04
gi|39582210|emb|CAE64161.1| Hypothetical protein CBG08781 [Caeno... 49 2e-04
gi|17561476|ref|NP_505888.1| COLlagen structural gene (col-155) ... 49 2e-04
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 49 2e-04
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 49 2e-04
gi|25518714|pir||G86385 hypothetical protein F2J7.4 [imported] -... 49 2e-04
gi|32419885|ref|XP_330386.1| predicted protein [Neurospora crass... 49 2e-04
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 49 2e-04
gi|159171|gb|AAA29174.1| collagen 8E 49 2e-04
gi|467292|gb|AAA17387.1| glutamine-asparagine rich protein 49 2e-04
gi|30689268|ref|NP_173925.3| phytochrome and flowering time regu... 49 2e-04
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 49 2e-04
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [... 49 2e-04
gi|39596499|emb|CAE63118.1| Hypothetical protein CBG07415 [Caeno... 49 2e-04
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ... 48 3e-04
gi|23490544|gb|EAA22295.1| unnamed protein product, putative [Pl... 48 3e-04
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 48 3e-04
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 48 3e-04
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 48 3e-04
gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD) ... 48 3e-04
gi|39583745|emb|CAE63849.1| Hypothetical protein CBG08408 [Caeno... 48 3e-04
gi|17557099|ref|NP_499700.1| COLlagen structural gene (30.3 kD) ... 48 3e-04
gi|39588941|emb|CAE69571.1| Hypothetical protein CBG15783 [Caeno... 48 3e-04
gi|32698944|ref|NP_872367.1| hypothetical protein FLJ36144 [Homo... 48 4e-04
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 48 4e-04
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 48 4e-04
gi|23508177|ref|NP_700847.1| gene 11-1 protein precursor [Plasmo... 48 4e-04
gi|20386036|gb|AAM21558.1| MEK1 interacting protein 1 [Dictyoste... 48 4e-04
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc... 47 5e-04
gi|2133724|pir||S69205 stripe a/b protein - fruit fly (Drosophil... 47 5e-04
gi|1147787|gb|AAB02354.1| stripe b protein 47 5e-04
gi|321007|pir||B44984 collagen - nematode (Haemonchus contortus)... 47 5e-04
gi|37626131|gb|AAQ96507.1| hypothetical protein [Vibrio parahaem... 47 6e-04
gi|39583246|emb|CAE60038.1| Hypothetical protein CBG03549 [Caeno... 47 6e-04
gi|34881108|ref|XP_343803.1| similar to OPA-containing protein 1... 47 6e-04
gi|462434|sp|P34099|KAPC_DICDI cAMP-dependent protein kinase cat... 47 6e-04
gi|241277|gb|AAB20716.1| serine/threonine protein kinase [Dictyo... 47 6e-04
gi|1513206|gb|AAC48704.1| involucrin 47 6e-04
gi|33284886|emb|CAE17632.1| SI:bZ1G18.6.4 (novel protein similar... 47 6e-04
gi|21244048|ref|NP_643630.1| acidic amino acid rich protein [Xan... 47 6e-04
gi|21956190|gb|AAM83255.1| ARC105 [Xenopus laevis] 47 6e-04
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 47 6e-04
gi|126420|sp|P15714|LP61_EIMTE Antigen LPMC-61 >gnl|BL_ORD_ID|16... 47 6e-04
gi|158896|gb|AAA29079.1| antigen LPCM61 47 6e-04
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 47 8e-04
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis] 47 8e-04
gi|47218036|emb|CAG11441.1| unnamed protein product [Tetraodon n... 47 8e-04
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate... 47 8e-04
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat... 47 8e-04
gi|20066260|gb|AAM09367.1| similar to Dictyostelium discoideum (... 47 8e-04
gi|15425663|dbj|BAB64310.1| mblk-1 [Apis mellifera] 47 8e-04
gi|34872667|ref|XP_222232.2| similar to hypothetical protein MGC... 47 8e-04
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis] 46 0.001
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 46 0.001
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo... 46 0.001
gi|28901310|ref|NP_800965.1| hypothetical protein VPA1455 [Vibri... 46 0.001
gi|32422933|ref|XP_331910.1| predicted protein [Neurospora crass... 46 0.001
gi|24648119|ref|NP_650778.1| CG6026-PA [Drosophila melanogaster]... 46 0.001
gi|39586240|emb|CAE66651.1| Hypothetical protein CBG11988 [Caeno... 46 0.001
gi|115399|sp|P16252|CAC2_HAECO Cuticle collagen 2C >gnl|BL_ORD_I... 46 0.001
gi|1513204|gb|AAC48703.1| involucrin 46 0.001
gi|21755689|dbj|BAC04736.1| unnamed protein product [Homo sapiens] 46 0.001
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec... 46 0.001
gi|47123917|gb|AAH70536.1| ARC105 protein [Xenopus laevis] 46 0.001
gi|39930375|ref|NP_060682.2| enabled homolog [Homo sapiens] >gnl... 46 0.001
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna... 46 0.001
gi|48428086|sp|Q8N8S7|ENAH_HUMAN Enabled protein homolog >gnl|BL... 46 0.001
gi|37725922|gb|AAO38039.1| reticulocyte binding-like protein 2b ... 46 0.001
gi|28828361|gb|AAO51011.1| similar to Homo sapiens (Human). Hypo... 46 0.001
gi|40850918|gb|AAH65238.1| ENAH protein [Homo sapiens] 46 0.001
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl... 46 0.001
gi|1223914|gb|AAB47214.1| endo16 [Strongylocentrotus purpuratus] 46 0.001
gi|46432388|gb|EAK91872.1| hypothetical protein CaO19.13686 [Can... 45 0.002
gi|39979119|emb|CAE85494.1| putative protein [Neurospora crassa] 45 0.002
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 45 0.002
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri... 45 0.002
gi|17553116|ref|NP_498427.1| putative protein, with 3 coiled coi... 45 0.002
gi|2271479|gb|AAC53450.1| sex determining protein [Mus musculus ... 45 0.002
gi|6319766|ref|NP_009848.1| Involved in global regulation of tra... 45 0.002
gi|172638|gb|AAA35062.1| SNF5 protein 45 0.002
gi|30705097|gb|AAH52044.1| Hypothetical protein C230068E13 [Mus ... 45 0.002
gi|27370402|ref|NP_766501.1| hypothetical protein C230068E13 [Mu... 45 0.002
gi|47208936|emb|CAF90803.1| unnamed protein product [Tetraodon n... 45 0.002
gi|17558914|ref|NP_506120.1| predicted CDS, filamentous hemagglu... 45 0.002
gi|31198993|ref|XP_308444.1| ENSANGP00000017898 [Anopheles gambi... 45 0.002
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi... 45 0.002
gi|2623347|gb|AAC53431.1| sex determining protein [Mus musculus ... 45 0.002
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 45 0.002
gi|460123|gb|AAB60446.1| Sry >gnl|BL_ORD_ID|1784943 gi|2623359|g... 45 0.002
gi|50405279|ref|YP_054371.1| hypothetical protein, coiled-coil d... 45 0.002
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno... 45 0.002
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 45 0.002
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 45 0.002
gi|45190780|ref|NP_985034.1| AER177Wp [Eremothecium gossypii] >g... 45 0.002
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays] 45 0.002
gi|24659567|ref|NP_648056.1| CG10107-PA [Drosophila melanogaster... 45 0.002
gi|39591554|emb|CAE71130.1| Hypothetical protein CBG17984 [Caeno... 45 0.002
gi|46444158|gb|EAL03435.1| hypothetical protein CaO19.4998 [Cand... 45 0.002
gi|28316334|dbj|BAC56950.1| hair follicle protein AHF [Mus muscu... 45 0.002
gi|17535685|ref|NP_496589.1| ROLler: helically twisted, animals ... 45 0.002
gi|47217784|emb|CAG06006.1| unnamed protein product [Tetraodon n... 45 0.003
gi|24644022|ref|NP_649478.1| CG12584-PA [Drosophila melanogaster... 45 0.003
gi|39586363|emb|CAE74020.1| Hypothetical protein CBG21668 [Caeno... 45 0.003
gi|25152262|ref|NP_741897.1| zinc finger protein AT-BP2 (XL401) ... 45 0.003
gi|11544574|emb|CAC17668.1| dJ599F21.1 (KIAA1637) [Homo sapiens] 45 0.003
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib... 45 0.003
gi|42734252|emb|CAF31489.1| Hypothetical protein T05A10.1i [Caen... 45 0.003
gi|15147335|ref|NP_066018.1| nuclear receptor coactivator 5; coa... 45 0.003
gi|42734251|emb|CAF31488.1| Hypothetical protein T05A10.1j [Caen... 45 0.003
gi|28829482|gb|AAL92370.2| similar to Dictyostelium discoideum (... 45 0.003
gi|32420087|ref|XP_330487.1| predicted protein [Neurospora crass... 45 0.003
gi|46227016|gb|EAK87966.1| hypothetical protein cgd5_2420 [Crypt... 45 0.003
gi|42734257|emb|CAA92133.3| C. elegans SMA-9 protein (correspond... 45 0.003
gi|23613032|ref|NP_703354.1| Mature parasite-infected erythrocyt... 45 0.003
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 45 0.003
gi|42734255|emb|CAF31492.1| Hypothetical protein T05A10.1e [Caen... 45 0.003
gi|283629|pir||S27770 hypothetical protein 1 - African malaria m... 45 0.003
gi|42734254|emb|CAF31491.1| Hypothetical protein T05A10.1d [Caen... 45 0.003
gi|11526821|gb|AAG36793.1| nuclear receptor coactivator CIA [Hom... 45 0.003
gi|21327107|gb|AAM48175.1| unknown [Phytophthora sojae] 45 0.003
gi|25152259|ref|NP_741896.1| zinc finger protein AT-BP2 (XL401) ... 45 0.003
gi|42734256|emb|CAF31493.1| Hypothetical protein T05A10.1f [Caen... 45 0.003
gi|37620535|gb|AAQ94949.1| SMA-9 class B [Caenorhabditis elegans] 45 0.003
gi|21428764|gb|AAM50101.1| AT11549p [Drosophila melanogaster] 45 0.003
gi|7507124|pir||T24490 hypothetical protein T05A10.1 - Caenorhab... 45 0.003
gi|39578575|gb|AAR28681.1| zinc finger transcription factor SMA-... 45 0.003
gi|42734253|emb|CAF31490.1| Hypothetical protein T05A10.1g [Caen... 45 0.003
gi|42734248|emb|CAD44152.2| C. elegans SMA-9 protein (correspond... 45 0.003
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 44 0.004
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 44 0.004
gi|50308049|ref|XP_454025.1| unnamed protein product [Kluyveromy... 44 0.004
gi|2565059|gb|AAB91440.1| CAGH45 [Homo sapiens] 44 0.004
gi|1841872|gb|AAB47544.1| MigA [Dictyostelium discoideum] 44 0.004
gi|1828|emb|CAA35992.1| trichohyalin [Ovis sp.] 44 0.004
gi|1076839|pir||S49313 protein kinase - slime mold (Dictyosteliu... 44 0.004
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628... 44 0.004
gi|13508497|gb|AAF15293.3| erythrocyte membrane-associated giant... 44 0.004
gi|33354107|dbj|BAC81137.1| TNRC11 [Homo sapiens] 44 0.004
gi|33354109|dbj|BAC81138.1| TNRC11 [Pan troglodytes] 44 0.004
gi|1663694|dbj|BAA12112.1| Product has a CAG repeat region simil... 44 0.004
gi|4827042|ref|NP_005111.1| trinucleotide repeat containing 11 (... 44 0.004
gi|2623357|gb|AAC53436.1| sex determining protein [Mus musculus ... 44 0.004
gi|5524203|gb|AAD44162.1| OPA-containing protein [Homo sapiens] 44 0.004
gi|3426320|gb|AAC83163.1| OPA-containing protein [Homo sapiens] 44 0.004
gi|39591412|emb|CAE73466.1| Hypothetical protein CBG20917 [Caeno... 44 0.004
gi|31198741|ref|XP_308318.1| ENSANGP00000010717 [Anopheles gambi... 44 0.005
gi|1729824|sp|P54683|TAGB_DICDI Prestalk-specific protein tagB p... 44 0.005
gi|42733801|gb|AAS38719.1| similar to Dictyostelium discoideum (... 44 0.005
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 44 0.005
gi|38110797|gb|EAA56463.1| hypothetical protein MG06434.4 [Magna... 44 0.005
gi|23508231|ref|NP_700900.1| hypothetical protein [Plasmodium fa... 44 0.005
gi|50539473|emb|CAH04953.1| hypothetical protein [Ovis aries] 44 0.005
gi|50419303|ref|XP_458176.1| unnamed protein product [Debaryomyc... 44 0.005
gi|39598361|emb|CAE69054.1| Hypothetical protein CBG15063 [Caeno... 44 0.005
gi|33413782|gb|AAN39444.1| normocyte binding protein 2a [Plasmod... 44 0.005
gi|437639|gb|AAA72295.1| [Plasmodium falciparum 3' end.], gene p... 44 0.005
gi|2623355|gb|AAC53435.1| sex determining protein [Mus musculus ... 44 0.005
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor... 44 0.005
gi|2623363|gb|AAC53439.1| sex determining protein [Mus musculus ... 44 0.005
gi|23619293|ref|NP_705255.1| reticulocyte binding protein 2 homo... 44 0.005
gi|13345187|gb|AAK19244.1| reticulocyte binding protein 2 homolo... 44 0.005
gi|17539916|ref|NP_500598.1| COLlagen structural gene (col-110) ... 44 0.005
gi|124737|sp|P24712|INVO_SAGOE Involucrin >gnl|BL_ORD_ID|574947 ... 44 0.005
gi|42734026|gb|AAO52624.2| similar to Dictyostelium discoideum (... 44 0.007
gi|45185072|ref|NP_982789.1| ABL158Cp [Eremothecium gossypii] >g... 44 0.007
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc... 44 0.007
gi|21355931|ref|NP_648931.1| CG11915-PA [Drosophila melanogaster... 44 0.007
gi|50309267|ref|XP_454640.1| unnamed protein product [Kluyveromy... 44 0.007
gi|23593319|ref|NP_703169.1| hypothetical protein [Plasmodium fa... 44 0.007
gi|11345236|gb|AAG34656.1| involucrin [Mus musculus] 44 0.007
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g... 44 0.007
gi|8468621|gb|AAF75554.1| mature parasite-infected erythrocyte s... 44 0.007
gi|39595465|emb|CAE60503.1| Hypothetical protein CBG04122 [Caeno... 44 0.007
gi|24374614|ref|NP_718657.1| TPR domain protein [Shewanella onei... 44 0.007
gi|7494317|pir||E71606 hypothetical protein PFB0765w - malaria p... 44 0.007
gi|23508767|ref|NP_701435.1| hypothetical protein [Plasmodium fa... 44 0.007
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot... 44 0.007
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 44 0.007
gi|17568107|ref|NP_510273.1| COLlagen structural gene (col-9) [C... 44 0.007
gi|18418034|ref|NP_567896.1| WD-40 repeat family protein (LEUNIG... 43 0.009
gi|14164561|gb|AAK55123.1| Swift [Xenopus laevis] 43 0.009
gi|11141605|gb|AAG32022.1| LEUNIG [Arabidopsis thaliana] 43 0.009
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 43 0.009
gi|23488856|gb|EAA21422.1| immediate early protein homolog-relat... 43 0.009
gi|14276857|gb|AAK58423.1| PC2-glutamine-rich-associated protein... 43 0.009
gi|27734440|sp|Q96RN5|PCAP_HUMAN Positive cofactor 2 glutamine/Q... 43 0.009
gi|34849874|gb|AAH57119.1| Tnrc11 protein [Mus musculus] 43 0.009
gi|23270751|gb|AAH17110.1| PCQAP protein [Homo sapiens] 43 0.009
gi|3037135|gb|AAC12944.1| TPA inducible protein [Homo sapiens] 43 0.009
gi|23509439|ref|NP_702106.1| hypothetical protein [Plasmodium fa... 43 0.009
gi|45708378|gb|AAH03078.1| Unknown (protein for IMAGE:3504608) [... 43 0.009
gi|28828976|gb|AAO51556.1| similar to Plasmodium falciparum. Pro... 43 0.009
gi|46437420|gb|EAK96767.1| hypothetical protein CaO19.2850 [Cand... 43 0.009
gi|29251308|gb|EAA42790.1| GLP_574_10064_7116 [Giardia lamblia A... 43 0.009
gi|46442947|gb|EAL02232.1| hypothetical protein CaO19.8420 [Cand... 43 0.009
gi|11071800|emb|CAC14644.1| lectin-related protein [Leishmania m... 43 0.009
gi|39586364|emb|CAE74021.1| Hypothetical protein CBG21669 [Caeno... 43 0.009
gi|91094|pir||A26892 Mopa box protein - mouse (fragment) >gnl|BL... 43 0.009
gi|33468967|ref|NP_067496.1| trinucleotide repeat containing 11 ... 43 0.009
gi|27348124|dbj|BAC45237.1| Ah receptor [Cricetulus griseus] 43 0.009
gi|7486768|pir||T08588 hypothetical protein L23H3.30 - Arabidops... 43 0.009
gi|34784300|gb|AAH57085.1| Unknown (protein for MGC:67526) [Mus ... 43 0.009
gi|21312134|ref|NP_056973.2| positive cofactor 2, glutamine/Q-ri... 43 0.009
gi|33413776|gb|AAN39446.1| normocyte binding protein 2a [Plasmod... 43 0.012
gi|6680506|ref|NP_032438.1| involucrin [Mus musculus] >gnl|BL_OR... 43 0.012
gi|7512088|pir||T30282 calcium-binding protein - sea urchin (Str... 43 0.012
gi|26000388|gb|AAN75484.1| dentin matrix protein 1 [Plecotus tow... 43 0.012
gi|29150375|gb|AAO72384.1| unknow protein [Oryza sativa (japonic... 43 0.012
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 43 0.012
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,... 43 0.012
gi|41146708|ref|XP_087500.3| similar to NEFA-interacting nuclear... 43 0.012
gi|21748618|dbj|BAC03446.1| FLJ00386 protein [Homo sapiens] 43 0.012
gi|7489897|pir||T14577 protein kinase YakA (EC 2.7.1.-) - slime ... 43 0.012
gi|31235077|ref|XP_319177.1| ENSANGP00000012409 [Anopheles gambi... 43 0.012
gi|7512229|pir||T34073 paranemin - chicken 43 0.012
gi|47678605|emb|CAG30423.1| PCQAP [Homo sapiens] 43 0.012
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 43 0.012
gi|46432370|gb|EAK91855.1| hypothetical protein CaO19.6309 [Cand... 43 0.012
gi|29570382|gb|AAO38600.2| Dumpy : shorter than wild-type protei... 43 0.012
gi|30721677|gb|AAP33688.1| phoshoprotein 300 [Plasmodium falcipa... 43 0.012
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha... 43 0.012
gi|32565703|ref|NP_872048.1| dumpy shorter than wild-type protei... 43 0.012
gi|32565701|ref|NP_495366.2| collagen triple helix repeat family... 43 0.012
gi|39590294|emb|CAE66032.1| Hypothetical protein CBG11227 [Caeno... 43 0.012
gi|543968|sp|P35800|CCDA_CAEEL Cuticle collagen dpy-10 precursor... 43 0.012
gi|7494559|pir||T28887 collagen dpy-10 - Caenorhabditis elegans 43 0.012
gi|124734|sp|P14591|INVO_PANPA Involucrin >gnl|BL_ORD_ID|553935 ... 39 0.015
gi|10946479|gb|AAG24911.1| Tash1 protein [Theileria annulata] 42 0.016
gi|42780465|ref|NP_977712.1| conserved hypothetical protein, deg... 42 0.016
gi|11345232|gb|AAG34654.1| involucrin [Mus musculus] 42 0.016
gi|27819785|gb|AAO24941.1| RE65015p [Drosophila melanogaster] 42 0.016
gi|24584069|ref|NP_723801.1| CG6043-PA [Drosophila melanogaster]... 42 0.016
gi|16198129|gb|AAL13867.1| LD33732p [Drosophila melanogaster] 42 0.016
gi|11467826|ref|NP_050877.1| hypothetical chloroplast RF2 [Nephr... 42 0.016
gi|17976518|gb|AAC78200.3| Prion-like-(q/n-rich)-domain-bearing ... 42 0.016
gi|24584067|ref|NP_609629.1| CG6043-PD [Drosophila melanogaster]... 42 0.016
gi|21281598|gb|AAM45363.1| Prion-like-(q/n-rich)-domain-bearing ... 42 0.016
gi|21711749|gb|AAM75065.1| RE28238p [Drosophila melanogaster] 42 0.016
gi|24584075|ref|NP_723804.1| CG6043-PC [Drosophila melanogaster]... 42 0.016
gi|21281599|gb|AAM45364.1| Prion-like-(q/n-rich)-domain-bearing ... 42 0.016
gi|34854792|ref|XP_218287.2| similar to putative odorant recepto... 42 0.016
gi|47180733|emb|CAG14181.1| unnamed protein product [Tetraodon n... 42 0.016
gi|24655483|ref|NP_728652.1| CG7971-PC [Drosophila melanogaster]... 42 0.016
gi|47212911|emb|CAF93289.1| unnamed protein product [Tetraodon n... 42 0.016
gi|24655488|ref|NP_647642.2| CG7971-PA [Drosophila melanogaster]... 42 0.016
gi|24655493|ref|NP_728653.1| CG7971-PB [Drosophila melanogaster]... 42 0.016
gi|11345234|gb|AAG34655.1| involucrin [Mus musculus] 42 0.021
gi|50417567|gb|AAH77588.1| K14 protein [Xenopus laevis] 42 0.021
gi|17158247|ref|NP_477665.1| wsv143 [shrimp white spot syndrome ... 42 0.021
gi|19481790|gb|AAL89066.1| WSSV198 [shrimp white spot syndrome v... 42 0.021
gi|42660665|ref|XP_208835.4| similar to hypothetical protein FLJ... 42 0.021
gi|34304005|ref|NP_899141.1| hypothetical protein 6430402L03 [Mu... 42 0.021
gi|23613798|ref|NP_704819.1| hypothetical protein [Plasmodium fa... 42 0.021
gi|39584499|emb|CAE74577.1| Hypothetical protein CBG22342 [Caeno... 42 0.021
gi|9826|emb|CAA30336.1| 11-1 polypeptide [Plasmodium falciparum] 42 0.021
gi|84211|pir||S00485 gene 11-1 protein precursor - malaria paras... 42 0.021
gi|6322796|ref|NP_012869.1| RNAPII degradation factor, forms a c... 42 0.021
gi|28850383|gb|AAO53158.1| similar to Plasmodium falciparum (iso... 42 0.021
gi|28828426|gb|AAL96730.2| similar to Dictyostelium discoideum (... 42 0.021
gi|19882261|gb|AAC00208.2| paranemin [Gallus gallus] 42 0.021
gi|7511801|pir||T13167 Lola-like protein - fruit fly (Drosophila... 42 0.021
gi|32417370|ref|XP_329163.1| hypothetical protein [Neurospora cr... 42 0.021
gi|15021476|gb|AAK77753.1| ORF84 [shrimp white spot syndrome virus] 42 0.021
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 42 0.021
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 42 0.021
gi|5815245|gb|AAD52614.1| SANT domain protein SMRTER [Drosophila... 42 0.021
gi|3929670|emb|CAA77177.1| drosocrystallin [Drosophila melanogas... 42 0.021
gi|21357267|ref|NP_649312.1| CG6014-PA [Drosophila melanogaster]... 42 0.021
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 42 0.021
gi|23486147|gb|EAA20734.1| hypothetical protein [Plasmodium yoel... 42 0.021
gi|47222433|emb|CAG12953.1| unnamed protein product [Tetraodon n... 42 0.021
gi|24641597|ref|NP_536797.2| CG4013-PA [Drosophila melanogaster]... 42 0.021
gi|42761572|gb|AAS45390.1| similar to Babesia bigemina. 200 kDa ... 42 0.021
gi|7510074|pir||T31611 hypothetical protein Y50E8A.g - Caenorhab... 42 0.021
gi|47223366|emb|CAG04227.1| unnamed protein product [Tetraodon n... 42 0.027
gi|9453839|dbj|BAB03273.1| myosin [Chara corallina] 42 0.027
gi|38567183|emb|CAE76476.1| related to zinc finger protein crol ... 42 0.027
gi|24640194|ref|NP_572344.1| CG14441-PA [Drosophila melanogaster... 42 0.027
gi|6677817|ref|NP_033126.1| repetin [Mus musculus] >gnl|BL_ORD_I... 42 0.027
gi|1706291|sp|P54682|D7_DICDI cAMP-inducible prespore protein D7... 42 0.027
gi|29603322|emb|CAA84338.2| Hypothetical protein M88.5 [Caenorha... 42 0.027
gi|37676035|ref|NP_936431.1| TPR repeat containing protein [Vibr... 42 0.027
gi|46437397|gb|EAK96744.1| hypothetical protein CaO19.2827 [Cand... 42 0.027
gi|30468253|ref|NP_849140.1| ORF515 [Cyanidioschyzon merolae] >g... 42 0.027
gi|32422843|ref|XP_331865.1| hypothetical protein [Neurospora cr... 42 0.027
gi|6472600|dbj|BAA87057.1| unconventional myosin heavy chain [Ch... 42 0.027
gi|27802723|emb|CAD60828.1| SI:bZ1D10.2 (novel protein similar t... 42 0.027
gi|29747039|ref|XP_049037.7| trinucleotide repeat containing 9 [... 42 0.027
gi|47115570|sp|O00841|CUDA_DICDI Putative transcriptional regula... 42 0.027
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 42 0.027
gi|46125747|ref|XP_387427.1| hypothetical protein FG07251.1 [Gib... 42 0.027
gi|1082285|pir||H54024 protein kinase (EC 2.7.1.37) cdc2-related... 42 0.027
gi|17554288|ref|NP_497923.1| putative RNA binding protein with K... 42 0.027
gi|29246247|gb|EAA37851.1| GLP_74_7403_21910 [Giardia lamblia AT... 42 0.027
gi|24211982|sp|Q8T5T1|MDN1_GIALA Midasin (MIDAS-containing prote... 42 0.027
gi|50745756|ref|XP_420230.1| PREDICTED: similar to Mtap7 protein... 42 0.027
gi|2565048|gb|AAB91435.1| CAGF9 [Homo sapiens] 42 0.027
gi|42734053|gb|AAS38925.1| hypothetical protein [Dictyostelium d... 42 0.027
gi|18376049|emb|CAD21055.1| hypothetical protein [Neurospora cra... 42 0.027
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 42 0.027
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g... 41 0.035
gi|45361371|ref|NP_989263.1| hypothetical protein MGC76242 [Xeno... 41 0.035
gi|124727|sp|P24708|INVO_AOTTR Involucrin >gnl|BL_ORD_ID|1836165... 41 0.035
gi|49070826|ref|XP_399702.1| hypothetical protein UM02087.1 [Ust... 41 0.035
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 41 0.035
gi|17507323|ref|NP_492340.1| microfibrillar-associated protein 1... 41 0.035
gi|16225892|gb|AAL16019.1| defective chorion-1 fc125 protein pre... 41 0.035
gi|39590567|emb|CAE64937.1| Hypothetical protein CBG09768 [Caeno... 41 0.035
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 41 0.035
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 41 0.035
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli... 41 0.035
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 41 0.035
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno... 41 0.035
gi|39579838|emb|CAE56847.1| Hypothetical protein CBG24674 [Caeno... 41 0.035
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno... 41 0.035
gi|49069208|ref|XP_398893.1| hypothetical protein UM01278.1 [Ust... 41 0.035
gi|47565158|ref|ZP_00236201.1| spore germination protein IA [Bac... 41 0.035
gi|39579513|emb|CAE56338.1| Hypothetical protein CBG24007 [Caeno... 41 0.035
gi|21757308|dbj|BAC05084.1| unnamed protein product [Homo sapiens] 41 0.035
gi|32328882|dbj|BAC78524.1| prepro beta-conglycinin alpha prime ... 41 0.035
gi|23098983|ref|NP_692449.1| chromosome segregation SMC protein ... 41 0.035
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 41 0.035
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [... 41 0.035
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 41 0.035
gi|16225885|gb|AAL16017.1| defective chorion-1 fc177 protein pre... 41 0.035
gi|16225888|gb|AAL16018.1| defective chorion-1 fc106 protein pre... 41 0.035
gi|39587615|emb|CAE58553.1| Hypothetical protein CBG01712 [Caeno... 41 0.035
gi|37626197|gb|AAQ96572.1| hypothetical protein [Vibrio parahaem... 41 0.046
gi|121286|sp|P11827|GLCX_SOYBN Beta-conglycinin, alpha' chain pr... 41 0.046
gi|9967361|dbj|BAA74452.2| alpha' subunit of beta-conglycinin [G... 41 0.046
gi|18150906|ref|NP_542843.1| putative cointegrate resolution pro... 41 0.046
gi|21450271|ref|NP_659141.1| nuclear receptor coactivator 5 [Mus... 41 0.046
gi|46431871|gb|EAK91393.1| hypothetical protein CaO19.6160 [Cand... 41 0.046
gi|31243065|ref|XP_321967.1| ENSANGP00000012035 [Anopheles gambi... 41 0.046
gi|39590156|emb|CAE61154.1| Hypothetical protein CBG04920 [Caeno... 41 0.046
gi|32403428|ref|XP_322327.1| predicted protein [Neurospora crass... 41 0.046
gi|49071338|ref|XP_399958.1| hypothetical protein UM02343.1 [Ust... 41 0.046
gi|23481834|gb|EAA17992.1| probable RNA 3'-terminal phosphate cy... 41 0.046
gi|39580382|emb|CAE71742.1| Hypothetical protein CBG18726 [Caeno... 41 0.046
gi|50306605|ref|XP_453276.1| unnamed protein product [Kluyveromy... 41 0.046
gi|34865500|ref|XP_345960.1| similar to hypothetical protein [Ra... 41 0.046
gi|33413774|gb|AAN39445.1| normocyte binding protein 2a [Plasmod... 41 0.046
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 41 0.046
gi|17552718|ref|NP_498862.1| C.Elegans Chromodomain protein (33.... 41 0.046
gi|39583527|emb|CAE73985.1| Hypothetical protein CBG21616 [Caeno... 41 0.046
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 41 0.046
>gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114)
[Caenorhabditis elegans]
gi|14574015|gb|AAA82291.2| Collagen protein 114 [Caenorhabditis
elegans]
Length = 321
Score = 271 bits (692), Expect = 2e-71
Identities = 166/321 (51%), Positives = 166/321 (51%)
Frame = -1
Query: 966 MEDESCQRIKAYQWVANIAMCFAIVSVLTVCVSMPAIYMYMFHVKQLINTEVVSCEDHAR 787
MEDESCQRIKAYQWVANIAMCFAIVSVLTVCVSMPAIYMYMFHVKQLINTEVVSCEDHAR
Sbjct: 1 MEDESCQRIKAYQWVANIAMCFAIVSVLTVCVSMPAIYMYMFHVKQLINTEVVSCEDHAR 60
Query: 786 EIWREVEIMKNLPFTNRTSRFPRQXXXXXXXXXXXXXXXXXXXXXPPVIEAAXXXXXXXX 607
EIWREVEIMKNLPFTNRTSRFPRQ PPVIEAA
Sbjct: 61 EIWREVEIMKNLPFTNRTSRFPRQAAYKDAAPAGGGGGGEKYSEAPPVIEAAGGGSCGGC 120
Query: 606 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTTIQAPCEAASPPPCRVCPVGMPGEQGVT 427
KTTIQAPCEAASPPPCRVCPVGMPGEQGVT
Sbjct: 121 CPGGPGPNGKPGKPGRPGKPGAPGLPGVPGKTTIQAPCEAASPPPCRVCPVGMPGEQGVT 180
Query: 426 GAPGDKGPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEPGKDAPQEXXXXXXXX 247
GAPGDKGPA GEPGKDAPQE
Sbjct: 181 GAPGDKGPAGQPGRNGPDGPNGEPGPKGPPGQPGADGQPGMPGEPGKDAPQEGSPVPGDP 240
Query: 246 XXXXXXXXXXXXXXXXXXXXXXXXXXXXAKGQNXXXXXXXXXXXXXXXXXXXXXXXXXXX 67
AKGQN
Sbjct: 241 GPPGDSGIPGPPGPPGMAGPDGIPGMGGAKGQNGPDGPPGASGESGPNGPPGSGGGAGEK 300
Query: 66 GICPKYCAIDGGVFFEDGTRR 4
GICPKYCAIDGGVFFEDGTRR
Sbjct: 301 GICPKYCAIDGGVFFEDGTRR 321