Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= E02H1_3
(1209 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|1353139|sp|Q09524|YQN3_CAEEL Probable pseudouridylate synthas... 783 0.0
gi|39589177|emb|CAE57910.1| Hypothetical protein CBG00960 [Caeno... 609 e-173
gi|47214586|emb|CAG00940.1| unnamed protein product [Tetraodon n... 247 3e-64
gi|47208381|emb|CAF93145.1| unnamed protein product [Tetraodon n... 244 2e-63
gi|16550495|dbj|BAB70990.1| unnamed protein product [Homo sapiens] 240 4e-62
gi|31542636|ref|NP_112597.2| hypothetical protein FKSG32 [Homo s... 240 4e-62
gi|12276176|gb|AAG50280.1| FKSG32 [Homo sapiens] 239 9e-62
gi|48098021|ref|XP_393954.1| similar to ENSANGP00000021230 [Apis... 239 1e-61
gi|31981121|ref|NP_075781.2| pseudouridine synthase 3 [Mus muscu... 236 6e-61
gi|22137577|gb|AAH29253.1| Pseudouridine synthase 3 [Mus musculus] 236 6e-61
gi|9652099|gb|AAF91402.1| pseudouridine synthase 3 [Mus musculus] 236 8e-61
gi|50759985|ref|XP_417852.1| PREDICTED: similar to hypothetical ... 234 2e-60
gi|41056053|ref|NP_956361.1| Unknown (protein for MGC:56653); wu... 234 4e-60
gi|31231300|ref|XP_318500.1| ENSANGP00000021230 [Anopheles gambi... 233 9e-60
gi|45360593|ref|NP_988969.1| hypothetical protein MGC76010 [Xeno... 221 3e-56
gi|50256647|gb|EAL19370.1| hypothetical protein CNBH0640 [Crypto... 215 1e-54
gi|19922728|ref|NP_611646.1| CG3045-PA [Drosophila melanogaster]... 212 2e-53
gi|50556320|ref|XP_505568.1| hypothetical protein [Yarrowia lipo... 209 1e-52
gi|12847644|dbj|BAB27651.1| unnamed protein product [Mus musculus] 204 4e-51
gi|46432414|gb|EAK91897.1| hypothetical protein CaO19.13676 [Can... 201 4e-50
gi|34863030|ref|XP_235995.2| similar to CG3045-PA [Rattus norveg... 200 5e-50
gi|50293511|ref|XP_449167.1| unnamed protein product [Candida gl... 199 1e-49
gi|50420519|ref|XP_458796.1| unnamed protein product [Debaryomyc... 195 2e-48
gi|45201093|ref|NP_986663.1| AGL003Wp [Eremothecium gossypii] >g... 193 8e-48
gi|19115377|ref|NP_594465.1| probable pseudouridylate synthase [... 189 1e-46
gi|14318522|ref|NP_116655.1| Non-essential tRNA:pseudouridine sy... 188 2e-46
gi|50309181|ref|XP_454596.1| unnamed protein product [Kluyveromy... 183 8e-45
gi|18399149|ref|NP_564438.1| tRNA pseudouridine synthase family ... 178 3e-43
gi|49899182|gb|AAH75766.1| Zgc:56653 protein [Danio rerio] 176 8e-43
gi|38109098|gb|EAA55018.1| hypothetical protein MG06675.4 [Magna... 172 1e-41
gi|18376136|emb|CAD21201.1| related to pseudouridine synthase 3 ... 169 1e-40
gi|32415487|ref|XP_328223.1| hypothetical protein [Neurospora cr... 169 1e-40
gi|49091692|ref|XP_407307.1| hypothetical protein AN3170.2 [Aspe... 164 3e-39
gi|46138645|ref|XP_391013.1| hypothetical protein FG10837.1 [Gib... 164 4e-39
gi|25518167|pir||F86465 F12G12.3 protein - Arabidopsis thaliana ... 164 4e-39
gi|49076514|ref|XP_402223.1| hypothetical protein UM04608.1 [Ust... 153 9e-36
gi|40882706|gb|AAR96247.1| putative pseudouridine synthase [Oryz... 144 4e-33
gi|46228868|gb|EAK89738.1| Deg1p-like type II pseudouridylate sy... 136 9e-31
gi|48838879|ref|ZP_00295817.1| COG0101: Pseudouridylate synthase... 102 1e-20
gi|20089106|ref|NP_615181.1| pseudouridylate synthase [Methanosa... 102 2e-20
gi|21227597|ref|NP_633519.1| tRNA pseudouridine synthase A [Meth... 100 7e-20
gi|23613606|ref|NP_704627.1| tRNA pseudouridine synthase, putati... 98 3e-19
gi|15678860|ref|NP_275977.1| pseudouridylate synthase I [Methano... 98 4e-19
gi|11499319|ref|NP_070558.1| pseudouridylate synthase I (truA) [... 92 3e-17
gi|19074961|ref|NP_586467.1| tRNA PSEUDOURIDINE SYNTHASE A [Ence... 88 4e-16
gi|41720399|ref|ZP_00149212.1| COG0101: Pseudouridylate synthase... 86 2e-15
gi|34782865|gb|AAH13427.2| FKSG32 protein [Homo sapiens] 86 2e-15
gi|14591061|ref|NP_143136.1| pseudouridylate synthase [Pyrococcu... 84 5e-15
gi|18309973|ref|NP_561907.1| tRNA-pseudouridine synthase I [Clos... 82 2e-14
gi|30680075|ref|NP_187351.2| tRNA pseudouridine synthase family ... 82 3e-14
gi|6729002|gb|AAF26999.1| putative tRNA pseudouridine synthase [... 82 3e-14
gi|29247316|gb|EAA38882.1| GLP_180_17283_16483 [Giardia lamblia ... 77 6e-13
gi|29248079|gb|EAA39622.1| GLP_192_21454_20399 [Giardia lamblia ... 77 8e-13
gi|42779623|ref|NP_976870.1| tRNA pseudouridine synthase A [Baci... 77 8e-13
gi|49183490|ref|YP_026742.1| tRNA pseudouridine synthase A [Baci... 77 8e-13
gi|49476819|ref|YP_034755.1| tRNA pseudouridine synthase I (tRNA... 76 1e-12
gi|18977290|ref|NP_578647.1| putative tRNA pseudouridine synthas... 76 1e-12
gi|28212149|ref|NP_783093.1| tRNA pseudouridine synthase A [Clos... 75 2e-12
gi|14521207|ref|NP_126682.1| pseudouridylate synthase I [Pyrococ... 75 3e-12
gi|18311353|ref|NP_563287.1| tRNA-pseudouridine synthase I [Clos... 74 7e-12
gi|47567253|ref|ZP_00237967.1| tRNA pseudouridine synthase A [Ba... 74 9e-12
gi|27468710|ref|NP_765347.1| tRNA pseudouridine synthase A [Stap... 74 9e-12
gi|24648455|ref|NP_650899.1| CG4159-PA [Drosophila melanogaster]... 73 1e-11
gi|49484433|ref|YP_041657.1| putative tRNA pseudouridine synthas... 73 1e-11
gi|21283867|ref|NP_646955.1| tRNA pseudouridine synthase A [Stap... 73 2e-11
gi|15925209|ref|NP_372743.1| tRNA pseudouridine synthase A [Stap... 73 2e-11
gi|13431951|sp|Q9PJT0|TRUA_CHLMU tRNA pseudouridine synthase A (... 72 2e-11
gi|30018678|ref|NP_830309.1| tRNA pseudouridine synthase A [Baci... 72 3e-11
gi|29247315|gb|EAA38881.1| GLP_180_16444_15686 [Giardia lamblia ... 72 3e-11
gi|48863203|ref|ZP_00317097.1| COG0101: Pseudouridylate synthase... 72 3e-11
gi|15605190|ref|NP_219976.1| Pseudouridylate Synthase I [Chlamyd... 72 3e-11
gi|28211488|ref|NP_782432.1| tRNA pseudouridine synthase A [Clos... 71 4e-11
gi|48835026|ref|ZP_00292028.1| COG0101: Pseudouridylate synthase... 71 4e-11
gi|23121165|ref|ZP_00103551.1| COG0101: Pseudouridylate synthase... 71 6e-11
gi|15594358|ref|NP_212146.1| pseudouridylate synthase I (hisT) [... 71 6e-11
gi|15618490|ref|NP_224776.1| Pseudouridylate Synthase I [Chlamyd... 70 8e-11
gi|50294374|ref|XP_449598.1| unnamed protein product [Candida gl... 70 1e-10
gi|15836112|ref|NP_300636.1| pseudouridylate synthase I [Chlamyd... 70 1e-10
gi|50759235|ref|XP_417580.1| PREDICTED: similar to hypothetical ... 69 2e-10
gi|48767491|ref|ZP_00271846.1| COG0101: Pseudouridylate synthase... 69 2e-10
gi|30913405|sp|Q93NE2|TRUA_MYXXA tRNA pseudouridine synthase A (... 69 2e-10
gi|1665842|emb|CAA70351.1| pseudouridylate synthase I [Borrelia ... 69 2e-10
gi|15896350|ref|NP_349699.1| Pseudouridylate synthase, TRUA [Clo... 69 3e-10
gi|23097605|ref|NP_691071.1| tRNA pseudouridine synthase A [Ocea... 69 3e-10
gi|3915176|sp|Q45557|TRUA_BACSP tRNA pseudouridine synthase A (P... 68 5e-10
gi|31207153|ref|XP_312543.1| ENSANGP00000014976 [Anopheles gambi... 68 5e-10
gi|15677859|ref|NP_275027.1| tRNA pseudouridine synthase A [Neis... 67 6e-10
gi|16077216|ref|NP_388029.1| pseudouridylate synthase I [Bacillu... 67 6e-10
gi|15669871|ref|NP_248685.1| pseudouridylate synthase I (truA) [... 67 6e-10
gi|17546704|ref|NP_520106.1| PROBABLE TRNA PSEUDOURIDINE SYNTHAS... 67 8e-10
gi|42559832|sp|Q8NSV0|TRUA_CORGL tRNA pseudouridine synthase A (... 67 1e-09
gi|45531590|ref|ZP_00182630.1| COG0101: Pseudouridylate synthase... 67 1e-09
gi|19551801|ref|NP_599803.1| tRNA pseudouridine synthase A [Cory... 67 1e-09
gi|47208274|emb|CAF91572.1| unnamed protein product [Tetraodon n... 67 1e-09
gi|29831498|ref|NP_826132.1| putative pseudouridine synthase [St... 66 1e-09
gi|25027130|ref|NP_737184.1| putative tRNA pseudouridine synthas... 66 1e-09
gi|42559821|sp|Q8FS31|TRUA_COREF tRNA pseudouridine synthase A (... 66 1e-09
gi|42631522|ref|ZP_00157060.1| COG0101: Pseudouridylate synthase... 66 2e-09
gi|50756277|ref|XP_415090.1| PREDICTED: similar to tRNA pseudour... 66 2e-09
gi|45357831|ref|NP_987388.1| tRNA pseudouridine synthase Related... 65 2e-09
gi|50877245|emb|CAG37085.1| related to tRNA pseudouridine syntha... 65 3e-09
gi|50876213|emb|CAG36053.1| related to tRNA pseudouridine syntha... 65 3e-09
gi|18027830|gb|AAL55876.1| unknown [Homo sapiens] 65 3e-09
gi|13376820|ref|NP_079491.1| pseudouridylate synthase 1; pseudou... 65 3e-09
gi|48867793|ref|ZP_00321231.1| COG0101: Pseudouridylate synthase... 65 4e-09
gi|4455035|gb|AAD21042.1| pseudouridine synthase 1 [Homo sapiens] 65 4e-09
gi|15793409|ref|NP_283231.1| tRNA pseudouridine synthase [Neisse... 64 5e-09
gi|48858233|ref|ZP_00312194.1| COG0101: Pseudouridylate synthase... 64 5e-09
gi|48871226|ref|ZP_00323942.1| COG0101: Pseudouridylate synthase... 64 7e-09
gi|48784600|ref|ZP_00280966.1| COG0101: Pseudouridylate synthase... 64 7e-09
gi|46312495|ref|ZP_00213091.1| COG0101: Pseudouridylate synthase... 64 7e-09
gi|16273533|ref|NP_439786.1| pseudouridylate synthase I [Haemoph... 64 9e-09
gi|46446316|ref|YP_007681.1| putative tRNA-pseudouridine synthas... 63 2e-08
gi|21672480|ref|NP_660547.1| tRNA pseudouridine synthase A [Buch... 62 2e-08
gi|15612730|ref|NP_241033.1| tRNA pseudouridine synthase A (pseu... 62 2e-08
gi|15606137|ref|NP_213514.1| pseudouridine synthase I [Aquifex a... 62 2e-08
gi|28377870|ref|NP_784762.1| pseudouridylate synthase A [Lactoba... 62 3e-08
gi|27904686|ref|NP_777812.1| tRNA pseudouridine synthase A (Pseu... 62 3e-08
gi|15641014|ref|NP_230645.1| tRNA pseudouridine synthase A [Vibr... 62 3e-08
gi|26354378|dbj|BAC40817.1| unnamed protein product [Mus musculus] 62 4e-08
gi|9790183|ref|NP_062674.1| pseudouridine synthase 1 [Mus muscul... 62 4e-08
gi|18204779|gb|AAH21446.1| Pseudouridine synthase 1 [Mus musculus] 62 4e-08
gi|27262396|gb|AAN87479.1| tRNA pseudouridine synthase A [Heliob... 61 5e-08
gi|33596565|ref|NP_884208.1| tRNA pseudouridine synthase A [Bord... 61 5e-08
gi|38233160|ref|NP_938927.1| tRNA pseudouridine synthase A [Cory... 61 5e-08
gi|42559717|sp|P60349|TRUA_CORDI tRNA pseudouridine synthase A (... 61 5e-08
gi|48846472|ref|ZP_00300734.1| COG0101: Pseudouridylate synthase... 61 6e-08
gi|33592579|ref|NP_880223.1| tRNA pseudouridine synthase A [Bord... 61 6e-08
gi|27666512|ref|XP_222267.1| similar to pseudouridine synthase 1... 61 6e-08
gi|48824752|ref|ZP_00286091.1| COG0101: Pseudouridylate synthase... 61 6e-08
gi|49235658|ref|ZP_00329725.1| COG0101: Pseudouridylate synthase... 60 1e-07
gi|22297651|ref|NP_680898.1| tRNA-pseudouridine synthase I [Ther... 59 2e-07
gi|48831949|ref|ZP_00288996.1| COG0101: Pseudouridylate synthase... 59 2e-07
gi|18394855|ref|NP_564112.1| tRNA pseudouridine synthase family ... 59 2e-07
gi|30248700|ref|NP_840770.1| tRNA pseudouridine synthase [Nitros... 59 2e-07
gi|50254505|gb|EAL17254.1| hypothetical protein CNBN0810 [Crypto... 59 2e-07
gi|15644322|ref|NP_229374.1| pseudouridylate synthase I [Thermot... 59 2e-07
gi|16801808|ref|NP_472076.1| highly similar to pseudouridylate s... 59 2e-07
gi|15616818|ref|NP_240030.1| pseudouridylate synthase I [Buchner... 59 2e-07
gi|45520476|ref|ZP_00172006.1| COG0101: Pseudouridylate synthase... 59 3e-07
gi|19704921|ref|NP_602416.1| tRNA pseudouridine synthase A [Fuso... 59 3e-07
gi|47570254|ref|ZP_00240905.1| tRNA pseudouridine synthase A [Ba... 58 4e-07
gi|39997968|ref|NP_953919.1| tRNA pseudouridine synthase A [Geob... 58 5e-07
gi|46908770|ref|YP_015159.1| tRNA pseudouridine synthase A [List... 58 5e-07
gi|21243447|ref|NP_643029.1| tRNA pseudouridine synthase A [Xant... 57 7e-07
gi|42559801|sp|Q83WJ5|TRUA_BURML tRNA pseudouridine synthase A (... 57 7e-07
gi|49183176|ref|YP_026428.1| tRNA pseudouridine synthase A [Baci... 57 7e-07
gi|16804636|ref|NP_466121.1| highly similar to pseudouridylate s... 57 7e-07
gi|17565126|ref|NP_507242.1| PseudoUridine Synthase family (pus-... 57 7e-07
gi|21398100|ref|NP_654085.1| PseudoU_synth_1, tRNA pseudouridine... 57 7e-07
gi|42779223|ref|NP_976470.1| tRNA pseudouridine synthase A [Baci... 57 9e-07
gi|30018411|ref|NP_830042.1| tRNA pseudouridine synthase A [Baci... 57 9e-07
gi|24113690|ref|NP_708200.1| pseudouridylate synthase I [Shigell... 57 1e-06
gi|15802865|ref|NP_288892.1| pseudouridylate synthase I [Escheri... 57 1e-06
gi|23119897|ref|ZP_00102785.1| COG0101: Pseudouridylate synthase... 57 1e-06
gi|50251324|dbj|BAD28300.1| putative pseudouridine synthase 1 [O... 57 1e-06
gi|46445962|ref|YP_007327.1| putative tRNA pseudouridylate synth... 57 1e-06
gi|46323104|ref|ZP_00223470.1| COG0101: Pseudouridylate synthase... 56 1e-06
gi|23472932|ref|ZP_00128252.1| COG0101: Pseudouridylate synthase... 56 2e-06
gi|16130253|ref|NP_416821.1| pseudouridylate synthase I [Escheri... 56 2e-06
gi|24215440|ref|NP_712921.1| tRNA pseudouridine synthase A [Lept... 56 2e-06
gi|8569326|pdb|1DJ0|A Chain A, The Crystal Structure Of E. Coli ... 56 2e-06
gi|34762680|ref|ZP_00143671.1| tRNA pseudouridine synthase A [Fu... 56 2e-06
gi|15610591|ref|NP_217972.1| truA [Mycobacterium tuberculosis H3... 56 2e-06
gi|20808627|ref|NP_623798.1| Pseudouridylate synthase (tRNA psi5... 56 2e-06
gi|15843050|ref|NP_338087.1| tRNA pseudouridine synthase A [Myco... 56 2e-06
gi|34498219|ref|NP_902434.1| pseudouridylate synthase A [Chromo... 55 3e-06
gi|16761293|ref|NP_456910.1| tRNA pseudouridine synthase A [Salm... 55 3e-06
gi|16765695|ref|NP_461310.1| pseudouridylate synthase I [Salmone... 55 3e-06
gi|21223110|ref|NP_628889.1| putative pseudouridylate synthase [... 55 3e-06
gi|16122970|ref|NP_406283.1| tRNA pseudouridine synthase A [Yers... 55 3e-06
gi|18411027|ref|NP_565126.1| tRNA pseudouridine synthase family ... 55 3e-06
gi|11464733|gb|AAG35307.1| pseudouridine synthase 1 [Mus musculus] 55 3e-06
gi|22125494|ref|NP_668917.1| pseudouridylate synthase I [Yersini... 55 3e-06
gi|42572123|ref|NP_974152.1| tRNA pseudouridine synthase family ... 55 3e-06
gi|48731839|ref|ZP_00265583.1| COG0101: Pseudouridylate synthase... 55 4e-06
gi|32491058|ref|NP_871312.1| truA [Wigglesworthia glossinidia en... 55 4e-06
gi|15672468|ref|NP_266642.1| tRNA pseudouridine synthase A [Lact... 55 4e-06
gi|41410333|ref|NP_963169.1| TruA [Mycobacterium avium subsp. pa... 55 4e-06
gi|15837974|ref|NP_298662.1| tRNA pseudouridine synthase A [Xyle... 54 6e-06
gi|39579710|emb|CAE56256.1| Hypothetical protein CBG23897 [Caeno... 54 6e-06
gi|46308351|ref|ZP_00210544.1| COG0101: Pseudouridylate synthase... 54 7e-06
gi|46914251|emb|CAG21031.1| Putative tRNA pseudouridine synthase... 54 1e-05
gi|46130369|ref|ZP_00165202.2| COG0101: Pseudouridylate synthase... 54 1e-05
gi|32130280|sp|Q87DS1|TRUA_XYLFT tRNA pseudouridine synthase A (... 54 1e-05
gi|22997033|ref|ZP_00041272.1| COG0101: Pseudouridylate synthase... 54 1e-05
gi|28198519|ref|NP_778833.1| pseudouridylate synthase [Xylella f... 54 1e-05
gi|22994342|ref|ZP_00038849.1| COG0101: Pseudouridylate synthase... 54 1e-05
gi|21673806|ref|NP_661871.1| tRNA pseudouridine synthase A [Chlo... 54 1e-05
gi|46164047|ref|ZP_00136478.2| COG0101: Pseudouridylate synthase... 54 1e-05
gi|15598310|ref|NP_251804.1| tRNA-pseudouridine synthase I [Pseu... 54 1e-05
gi|21231977|ref|NP_637894.1| tRNA pseudouridine synthase A [Xant... 53 1e-05
gi|37527059|ref|NP_930403.1| tRNA pseudouridine synthase A (Pseu... 53 1e-05
gi|48826346|ref|ZP_00287556.1| COG0101: Pseudouridylate synthase... 53 1e-05
gi|27365335|ref|NP_760863.1| tRNA pseudouridine synthase A [Vibr... 53 1e-05
gi|13474062|ref|NP_105630.1| tRNA-pseudouridine synthase (EC 5.4... 53 1e-05
gi|49083216|gb|AAT50973.1| PA3114 [synthetic construct] 53 1e-05
gi|42559741|sp|Q7MB17|TRUA_PHOLL tRNA pseudouridine synthase A (... 53 2e-05
gi|50121981|ref|YP_051148.1| tRNA pseudouridine synthase A [Erwi... 53 2e-05
gi|15675714|ref|NP_269888.1| putative tRNA pseudouridine synthas... 52 2e-05
gi|46143880|ref|ZP_00204588.1| COG0101: Pseudouridylate synthase... 52 2e-05
gi|33862089|ref|NP_893650.1| tRNA pseudouridine synthase A [Proc... 52 2e-05
gi|50548607|ref|XP_501773.1| hypothetical protein [Yarrowia lipo... 52 2e-05
gi|42518460|ref|NP_964390.1| tRNA pseudouridine synthase A [Lact... 52 2e-05
gi|17231681|ref|NP_488229.1| tRNA-pseudouridine synthase I [Nost... 52 3e-05
gi|21911175|ref|NP_665443.1| putative tRNA pseudouridine synthas... 52 4e-05
gi|42520874|ref|NP_966789.1| tRNA pseudouridine synthase A [Wolb... 52 4e-05
gi|47575236|ref|ZP_00245271.1| COG0101: Pseudouridylate synthase... 51 5e-05
gi|28898964|ref|NP_798569.1| tRNA pseudouridine synthase A [Vibr... 51 5e-05
gi|16329915|ref|NP_440643.1| pseudouridine synthase 1 [Synechocy... 51 5e-05
gi|45525106|ref|ZP_00176354.1| COG0101: Pseudouridylate synthase... 51 5e-05
gi|13358100|ref|NP_078374.1| pseudouridylate synthase I [Ureapla... 51 6e-05
gi|15901439|ref|NP_346043.1| tRNA pseudouridine synthase A [Stre... 51 6e-05
gi|15828057|ref|NP_302320.1| probable pseudouridylate synthase [... 51 6e-05
gi|24212680|sp|Q9X796|TRUA_MYCLE tRNA pseudouridine synthase A (... 51 6e-05
gi|33866624|ref|NP_898183.1| tRNA pseudouridine synthase A [Syne... 50 8e-05
gi|42522098|ref|NP_967478.1| pseudouridylate synthase I [Bdellov... 50 8e-05
gi|20094324|ref|NP_614171.1| Pseudouridylate synthase of the Tru... 50 8e-05
gi|15227735|ref|NP_180591.1| tRNA pseudouridine synthase family ... 50 1e-04
gi|46199569|ref|YP_005236.1| tRNA pseudouridine synthase A [Ther... 50 1e-04
gi|23467218|ref|ZP_00122802.1| COG0101: Pseudouridylate synthase... 50 1e-04
gi|32030346|ref|ZP_00133213.1| COG0101: Pseudouridylate synthase... 50 1e-04
gi|32472096|ref|NP_865090.1| tRNA pseudouridine synthase A [Pire... 50 1e-04
gi|17988610|ref|NP_541243.1| TRNA PSEUDOURIDINE SYNTHASE A [Bruc... 50 1e-04
gi|15807281|ref|NP_296011.1| pseudouridylate synthase I [Deinoco... 49 2e-04
gi|45914329|ref|ZP_00192720.2| COG0101: Pseudouridylate synthase... 49 2e-04
gi|15602502|ref|NP_245574.1| TruA [Pasteurella multocida Pm70] >... 49 2e-04
gi|42559739|sp|Q7M9U3|TRUA_WOLSU tRNA pseudouridine synthase A (... 49 2e-04
gi|34557089|ref|NP_906904.1| TRNA PSEUDOURIDINE SYNTHASE [Woline... 49 2e-04
gi|32414669|ref|XP_327814.1| hypothetical protein [Neurospora cr... 49 2e-04
gi|23003456|ref|ZP_00047118.1| COG0101: Pseudouridylate synthase... 49 2e-04
gi|13507935|ref|NP_109884.1| pseudouridylate synthase I [Mycopla... 49 2e-04
gi|50591022|ref|ZP_00332355.1| COG0101: Pseudouridylate synthase... 49 3e-04
gi|21398437|ref|NP_654422.1| PseudoU_synth_1, tRNA pseudouridine... 49 3e-04
gi|48764048|ref|ZP_00268601.1| COG0101: Pseudouridylate synthase... 49 3e-04
gi|48864991|ref|ZP_00318859.1| COG0101: Pseudouridylate synthase... 49 3e-04
gi|49078584|ref|XP_403031.1| hypothetical protein UM05416.1 [Ust... 48 4e-04
gi|33152228|ref|NP_873581.1| tRNA pseudouridine synthase A; pseu... 48 4e-04
gi|23124103|ref|ZP_00106114.1| COG0101: Pseudouridylate synthase... 48 4e-04
gi|23016535|ref|ZP_00056290.1| COG0101: Pseudouridylate synthase... 48 4e-04
gi|49115069|gb|AAH72895.1| Unknown (protein for MGC:80334) [Xeno... 48 5e-04
gi|50303379|ref|XP_451631.1| unnamed protein product [Kluyveromy... 48 5e-04
gi|29349645|ref|NP_813148.1| tRNA pseudouridine synthase A [Bact... 48 5e-04
gi|33519947|ref|NP_878779.1| tRNA pseudouridine synthase A [Cand... 48 5e-04
gi|39938715|ref|NP_950481.1| pseudouridylate synthase [Onion yel... 48 5e-04
gi|23473971|ref|ZP_00129266.1| COG0101: Pseudouridylate synthase... 47 7e-04
gi|23103825|ref|ZP_00090299.1| COG0101: Pseudouridylate synthase... 47 7e-04
gi|23024296|ref|ZP_00063512.1| COG0101: Pseudouridylate synthase... 47 7e-04
gi|15903494|ref|NP_359044.1| tRNA pseudouridine synthase A [Stre... 47 9e-04
gi|48374280|gb|AAT41969.1| putative t-RNA pseudouridine synthase... 47 9e-04
gi|31544780|ref|NP_853358.1| TruA [Mycoplasma gallisepticum R] >... 47 0.001
gi|50364970|ref|YP_053395.1| tRNA pseudouridine synthase I [Meso... 47 0.001
gi|18312431|ref|NP_559098.1| tRNA pseudouridine synthase A [Pyro... 47 0.001
gi|7670391|dbj|BAA95047.1| unnamed protein product [Mus musculus] 46 0.002
gi|25010174|ref|NP_734569.1| Unknown [Streptococcus agalactiae N... 46 0.002
gi|42527777|ref|NP_972875.1| tRNA pseudouridine synthase A [Trep... 46 0.002
gi|15604687|ref|NP_221205.1| PSEUDOURIDYLATE SYNTHASE I (truA) [... 46 0.002
gi|24212681|sp|Q9ZCA3|TRUA_RICPR tRNA pseudouridine synthase A (... 46 0.002
gi|22536285|ref|NP_687136.1| tRNA pseudouridine synthase A [Stre... 46 0.002
gi|49473750|ref|YP_031792.1| tRNA pseudouridine synthase A [Bart... 46 0.002
gi|45198416|ref|NP_985445.1| AFL105Cp [Eremothecium gossypii] >g... 46 0.002
gi|24378608|ref|NP_720563.1| putative tRNA pseudouridine synthas... 45 0.003
gi|37523138|ref|NP_926515.1| tRNA-pseudouridine synthase A [Gloe... 45 0.003
gi|23466158|ref|NP_696761.1| tRNA pseudouridine synthase A [Bifi... 45 0.004
gi|10640247|emb|CAC12061.1| tRNA-pseudouridine synthase I relate... 45 0.004
gi|16082568|ref|NP_394390.1| Pseudouridylate synthase (tRNA psi5... 45 0.004
gi|15887719|ref|NP_353400.1| AGR_C_644p [Agrobacterium tumefacie... 45 0.004
gi|23503259|ref|NP_699170.1| hypothetical protein FLJ90811 [Homo... 44 0.006
gi|46124417|ref|XP_386762.1| hypothetical protein FG06586.1 [Gib... 44 0.006
gi|42561241|ref|NP_975692.1| pseudouridylate synthase I [Mycopla... 44 0.006
gi|42454362|ref|ZP_00154269.1| hypothetical protein Rick125901 [... 44 0.008
gi|15893251|ref|NP_360965.1| pseudouridylate synthase I [EC:4.2.... 44 0.008
gi|34581081|ref|ZP_00142561.1| pseudouridylate synthase I [Ricke... 44 0.010
gi|12045035|ref|NP_072845.1| pseudouridylate synthase I (hisT) [... 43 0.013
gi|19075946|ref|NP_588446.1| pseudouridylate synthase [Schizosac... 43 0.013
gi|6325044|ref|NP_015112.1| Involved in tRNA biogenesis; Pus1p [... 43 0.013
gi|48852453|ref|ZP_00306639.1| COG0101: Pseudouridylate synthase... 43 0.017
gi|49474896|ref|YP_032937.1| tRNA pseudouridine synthase A [Bart... 43 0.017
gi|50287019|ref|XP_445939.1| unnamed protein product [Candida gl... 43 0.017
gi|39933700|ref|NP_945976.1| putative tRNA-pseudouridine synthas... 42 0.022
gi|46226500|gb|EAK87494.1| Pus1p-like type II pseudousynthas Tru... 42 0.022
gi|22957777|ref|ZP_00005466.1| COG0101: Pseudouridylate synthase... 42 0.038
gi|48477852|ref|YP_023558.1| tRNA pseudouridine synthase A [Picr... 42 0.038
gi|47206562|emb|CAF94488.1| unnamed protein product [Tetraodon n... 42 0.038
gi|49097684|ref|XP_410302.1| hypothetical protein AN6165.2 [Aspe... 41 0.049
gi|23481212|gb|EAA17558.1| hypothetical protein [Plasmodium yoel... 41 0.049
gi|30913419|sp|Q9REQ0|TRUA_ZYMMO tRNA pseudouridine synthase A (... 41 0.049
gi|33241136|ref|NP_876078.1| Pseudouridylate synthase [Prochloro... 41 0.064
gi|38107174|gb|EAA53386.1| hypothetical protein MG07663.4 [Magna... 40 0.11
gi|48849100|ref|ZP_00303344.1| COG0101: Pseudouridylate synthase... 40 0.11
gi|50843266|ref|YP_056493.1| tRNA pseudouridine synthase A [Prop... 40 0.14
gi|15964174|ref|NP_384527.1| PROBABLE TRNA PSEUDOURIDINE SYNTHAS... 40 0.14
gi|27383218|ref|NP_774747.1| tRNA pseudouridine synthase I [Brad... 40 0.14
gi|42559808|sp|Q89BP1|TRUA_BRAJA tRNA pseudouridine synthase A (... 39 0.19
gi|46106837|ref|ZP_00200187.1| COG0101: Pseudouridylate synthase... 39 0.32
gi|33864024|ref|NP_895584.1| tRNA pseudouridine synthase A [Proc... 39 0.32
gi|50083718|ref|YP_045228.1| tRNA-pseudouridine synthase I [Acin... 39 0.32
gi|6321375|ref|NP_011452.1| pseudouridine synthase 2; Pus2p [Sac... 39 0.32
gi|3123265|sp|P53167|PUS2_YEAST Pseudouridylate synthase 2 (Pseu... 39 0.32
gi|42559721|sp|P60353|TRUA_SPIKU tRNA pseudouridine synthase A (... 38 0.55
gi|26554422|ref|NP_758356.1| tRNA pseudouridine synthase [Mycopl... 37 0.71
gi|48855916|ref|ZP_00310074.1| COG0101: Pseudouridylate synthase... 37 0.71
gi|46579324|ref|YP_010132.1| tRNA pseudouridine synthase A [Desu... 37 0.71
gi|23613185|ref|NP_703507.1| hypothetical protein [Plasmodium fa... 37 0.71
gi|16124533|ref|NP_419097.1| tRNA pseudouridine synthase [Caulob... 37 0.93
gi|46364464|ref|ZP_00227079.1| COG0101: Pseudouridylate synthase... 37 0.93
gi|41615123|ref|NP_963621.1| NEQ333 [Nanoarchaeum equitans Kin4-... 36 1.6
gi|41689449|ref|ZP_00145982.1| COG0101: Pseudouridylate synthase... 36 1.6
gi|50794396|ref|XP_423689.1| PREDICTED: similar to Gem-interacti... 36 1.6
gi|42561874|ref|NP_172451.2| tRNA pseudouridine synthase family ... 36 1.6
gi|46931324|gb|AAT06466.1| At1g09800 [Arabidopsis thaliana] 36 1.6
gi|46433909|gb|EAK93335.1| hypothetical protein CaO19.3477 [Cand... 36 2.1
gi|22974036|ref|ZP_00020432.1| hypothetical protein [Chloroflexu... 36 2.1
gi|15639816|ref|NP_219266.1| pseudouridylate synthase (hisT) [Tr... 35 4.6
gi|23612962|ref|NP_704501.1| hypothetical protein [Plasmodium fa... 35 4.6
gi|31205097|ref|XP_311497.1| ENSANGP00000013687 [Anopheles gambi... 35 4.6
gi|32266100|ref|NP_860132.1| tRNA pseudouridine synthase [Helico... 34 6.0
gi|23491305|gb|EAA22875.1| tRNA-pseudouridine synthase I [Plasmo... 34 7.9
gi|48104750|ref|XP_392970.1| similar to CG8798-PA [Apis mellifera] 34 7.9
>gi|1353139|sp|Q09524|YQN3_CAEEL Probable pseudouridylate synthase
E02H1.3 (Pseudouridine synthase)
gi|7498308|pir||T20413 hypothetical protein E02H1.3 - Caenorhabditis
elegans
gi|3875428|emb|CAA87378.1| Hypothetical protein E02H1.3
[Caenorhabditis elegans]
Length = 402
Score = 783 bits (2021), Expect = 0.0
Identities = 383/402 (95%), Positives = 383/402 (95%)
Frame = +1
Query: 1 MGSKRVCPDANNSVKSKKAKTLDFLAHPRRKIAIQFFYLGWEHDGLVQQPHTQNTVENHI 180
MGSKRVCPDANNSVKSKKAKTLDFLAHPRRKIAIQFFYLGWEHDGLVQQPHTQNTVENHI
Sbjct: 1 MGSKRVCPDANNSVKSKKAKTLDFLAHPRRKIAIQFFYLGWEHDGLVQQPHTQNTVENHI 60
Query: 181 MQALIKTHLIEDWTKCDFSRCGRTDKGVSAFKQTAAMVVRSLCPGDSGVFWSDSTQEHQK 360
MQALIKTHLIEDWTKCDFSRCGRTDKGVSAFKQTAAMVVRSLCPGDSGVFWSDSTQEHQK
Sbjct: 61 MQALIKTHLIEDWTKCDFSRCGRTDKGVSAFKQTAAMVVRSLCPGDSGVFWSDSTQEHQK 120
Query: 361 VDYKASGEELPYVKMLNGVLPKTIRVFAWAPVAQTFNARFDCNRRTYKYSFAKADLNLEK 540
VDYKASGEELPYVKMLNGVLPKTIRVFAWAPVAQTFNARFDCNRRTYKYSFAKADLNLEK
Sbjct: 121 VDYKASGEELPYVKMLNGVLPKTIRVFAWAPVAQTFNARFDCNRRTYKYSFAKADLNLEK 180
Query: 541 MRQGAELLVGEHDFSNFCQIDMNEKRLLQSYVRKVYEVKVEQVSTHPENDMYSMVELTVS 720
MRQGAELLVGEHDFSNFCQIDMNEKRLLQSYVRKVYEVKVEQVSTHPENDMYSMVELTVS
Sbjct: 181 MRQGAELLVGEHDFSNFCQIDMNEKRLLQSYVRKVYEVKVEQVSTHPENDMYSMVELTVS 240
Query: 721 GSGFLWHMIRYIVTILQEIGRENEQPSLISQLLDLKKYPSRPQYTLASDTPLCLFDCGYK 900
GSGFLWHMIRYIVTILQEIGRENEQPSLISQLLDLKKYPSRPQYTLASDTPLCLFDCGYK
Sbjct: 241 GSGFLWHMIRYIVTILQEIGRENEQPSLISQLLDLKKYPSRPQYTLASDTPLCLFDCGYK 300
Query: 901 SEDVEWKVHDYTLKSTVTGLQKTWATYQARSRMMENMLGELTGMAEFSSGDANKGLHEFV 1080
SEDVEWKVHDYTLKSTVTGLQKTWATYQARSRMMENMLGELTGMAEFSSGDANKGLHEFV
Sbjct: 301 SEDVEWKVHDYTLKSTVTGLQKTWATYQARSRMMENMLGELTGMAEFSSGDANKGLHEFV 360
Query: 1081 QDRPIPSNYIRFENRKMCXXXXXXXXXXXXXXXXXXXSSDKL 1206
QDRPIPSNYIRFENRKMC SSDKL
Sbjct: 361 QDRPIPSNYIRFENRKMCESLESKKEKMAEKKKNGEESSDKL 402