Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= E03H4_9
(1251 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17506483|ref|NP_493152.1| c-type lectin and CUB domain contai... 830 0.0
gi|17509297|ref|NP_493166.1| predicted CDS, tolloid like family ... 505 e-141
gi|17506207|ref|NP_493162.1| c-type lectin and CUB domain contai... 498 e-139
gi|17507929|ref|NP_493197.1| c-type lectin and CUB domain contai... 478 e-133
gi|17507729|ref|NP_493109.1| predicted CDS, c-type lectin and CU... 436 e-121
gi|17552508|ref|NP_498022.1| c-type lectin and CUB domain contai... 420 e-116
gi|2146870|pir||S72579 hypothetical protein C35D10.1 - Caenorhab... 405 e-111
gi|17559516|ref|NP_504865.1| c-type lectin and CUB domain contai... 405 e-111
gi|32564282|ref|NP_493725.2| c-type lectin and CUB domain contai... 402 e-110
gi|39585607|emb|CAE65367.1| Hypothetical protein CBG10312 [Caeno... 401 e-110
gi|17507931|ref|NP_493198.1| c-type lectin family member (1N229)... 398 e-109
gi|39585606|emb|CAE65366.1| Hypothetical protein CBG10311 [Caeno... 386 e-106
gi|7509603|pir||T26655 hypothetical protein Y38E10A.e - Caenorha... 384 e-105
gi|17537005|ref|NP_496688.1| predicted CDS, c-type lectin and CU... 384 e-105
gi|7495300|pir||T32032 hypothetical protein C03H5.1 - Caenorhabd... 380 e-104
gi|17552510|ref|NP_498023.1| predicted CDS, c-type lectin and CU... 374 e-102
gi|17531345|ref|NP_494427.1| predicted CDS, c-type lectin and CU... 369 e-100
gi|32565327|ref|NP_494426.2| c-type lectin and CUB domain contai... 356 6e-97
gi|39585604|emb|CAE65364.1| Hypothetical protein CBG10309 [Caeno... 338 1e-91
gi|34555967|emb|CAB16536.2| Hypothetical protein Y70C5C.2 [Caeno... 336 8e-91
gi|17537003|ref|NP_496687.1| CUB Sushi multiple domains 1 family... 327 5e-88
gi|39585605|emb|CAE65365.1| Hypothetical protein CBG10310 [Caeno... 315 1e-84
gi|39587832|emb|CAE67850.1| Hypothetical protein CBG13437 [Caeno... 283 6e-75
gi|39586019|emb|CAE69095.1| Hypothetical protein CBG15117 [Caeno... 274 4e-72
gi|17536123|ref|NP_494003.1| predicted CDS, CUB sushi multiple d... 261 2e-68
gi|39587016|emb|CAE62951.1| Hypothetical protein CBG07164 [Caeno... 243 9e-63
gi|17566216|ref|NP_507227.1| c-type lectin and CUB domain contai... 233 4e-62
gi|39587833|emb|CAE67851.1| Hypothetical protein CBG13439 [Caeno... 229 1e-58
gi|7497310|pir||T32326 hypothetical protein C41H7.7 - Caenorhabd... 224 3e-57
gi|17536121|ref|NP_494002.1| predicted CDS, tolloid-like family ... 221 4e-56
gi|17557350|ref|NP_506271.1| c-type lectin and CUB domain contai... 214 3e-54
gi|39587015|emb|CAE62950.1| Hypothetical protein CBG07163 [Caeno... 212 2e-53
gi|17559776|ref|NP_507557.1| c-type lectin and CUB domain contai... 210 5e-53
gi|39593191|emb|CAE64660.1| Hypothetical protein CBG09432 [Caeno... 208 2e-52
gi|39587021|emb|CAE62956.1| Hypothetical protein CBG07170 [Caeno... 207 3e-52
gi|17533765|ref|NP_494066.1| c-type lectin family member (2C33) ... 196 7e-49
gi|33300107|emb|CAE17834.1| Hypothetical protein F49A5.9 [Caenor... 184 3e-45
gi|39581281|emb|CAE60027.1| Hypothetical protein CBG03533 [Caeno... 181 3e-44
gi|17535979|ref|NP_494826.1| phospholipase a2 receptor precursor... 180 5e-44
gi|17566360|ref|NP_507256.1| predicted CDS, c-type lectin family... 177 5e-43
gi|34556084|emb|CAA19438.2| Hypothetical protein Y102A5B.2 [Caen... 177 5e-43
gi|39587014|emb|CAE62949.1| Hypothetical protein CBG07162 [Caeno... 177 6e-43
gi|17564688|ref|NP_507233.1| c-type lectin family member (5R214)... 176 8e-43
gi|17564474|ref|NP_507254.1| predicted CDS, c-type lectin family... 172 1e-41
gi|17564682|ref|NP_507236.1| predicted CDS, c-type lectin family... 172 1e-41
gi|34555888|emb|CAB04740.2| Hypothetical protein T20B3.12 [Caeno... 172 1e-41
gi|17561188|ref|NP_507258.1| predicted CDS, c-type lectin family... 172 1e-41
gi|39588702|emb|CAE58226.1| Hypothetical protein CBG01323 [Caeno... 170 6e-41
gi|17564684|ref|NP_507234.1| c-type lectin family member (5R217)... 168 3e-40
gi|39587018|emb|CAE62953.1| Hypothetical protein CBG07167 [Caeno... 163 9e-39
gi|39587013|emb|CAE62948.1| Hypothetical protein CBG07161 [Caeno... 162 2e-38
gi|34555878|emb|CAB04417.2| Hypothetical protein F49A5.5 [Caenor... 162 2e-38
gi|17566358|ref|NP_507257.1| c-type lectin family member (5R335)... 160 6e-38
gi|34555879|emb|CAB04422.2| Hypothetical protein Y102A5B.1 [Caen... 160 6e-38
gi|7508450|pir||T25279 hypothetical protein T25E12.9 - Caenorhab... 160 8e-38
gi|32567058|ref|NP_507235.2| c-type lectin family member (41.9 k... 158 3e-37
gi|39587020|emb|CAE62955.1| Hypothetical protein CBG07169 [Caeno... 155 1e-36
gi|39587019|emb|CAE62954.1| Hypothetical protein CBG07168 [Caeno... 155 2e-36
gi|50507778|emb|CAB04419.2| Hypothetical protein F49A5.7 [Caenor... 153 7e-36
gi|17561198|ref|NP_507262.1| receptor 1 family member (5R344) [C... 153 7e-36
gi|34555889|emb|CAB63316.2| Hypothetical protein T20B3.13 [Caeno... 152 1e-35
gi|17564476|ref|NP_507252.1| c-type lectin family member (5R320)... 152 1e-35
gi|17561192|ref|NP_507260.1| c-type lectin family member (5R341)... 152 2e-35
gi|38176036|gb|AAB66231.2| Hypothetical protein R07C3.1 [Caenorh... 150 8e-35
gi|34556083|emb|CAA19437.2| Hypothetical protein Y102A5B.3 [Caen... 149 1e-34
gi|17535525|ref|NP_493859.1| c-type lectin and CUB domain contai... 149 2e-34
gi|17561194|ref|NP_507261.1| c-type lectin family member (5R343)... 147 4e-34
gi|39585608|emb|CAE65368.1| Hypothetical protein CBG10313 [Caeno... 147 7e-34
gi|39583740|emb|CAE63844.1| Hypothetical protein CBG08400 [Caeno... 145 3e-33
gi|39585600|emb|CAE65360.1| Hypothetical protein CBG10305 [Caeno... 143 7e-33
gi|17566362|ref|NP_507255.1| c-type lectin family member (5R330)... 141 3e-32
gi|39582412|emb|CAE74796.1| Hypothetical protein CBG22627 [Caeno... 139 2e-31
gi|17564472|ref|NP_507253.1| predicted CDS, c-type lectin family... 138 2e-31
gi|39582434|emb|CAE74818.1| Hypothetical protein CBG22654 [Caeno... 135 2e-30
gi|17535547|ref|NP_493851.1| predicted CDS, receptor for egg jel... 133 1e-29
gi|17561190|ref|NP_507259.1| predicted CDS, c-type lectin family... 132 1e-29
gi|39587831|emb|CAE67849.1| Hypothetical protein CBG13436 [Caeno... 119 1e-25
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno... 115 2e-24
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa] 104 5e-21
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;... 103 6e-21
gi|477362|pir||A48925 mannose receptor precursor, macrophage - m... 100 5e-20
gi|6678932|ref|NP_032651.1| mannose receptor, C type 1 [Mus musc... 100 5e-20
gi|34877265|ref|XP_225585.2| similar to macrophage mannose recep... 100 1e-19
gi|17535981|ref|NP_494827.1| deleted in malignant brain tumors 1... 97 8e-19
gi|39587017|emb|CAE62952.1| Hypothetical protein CBG07165 [Caeno... 96 1e-18
gi|39583087|emb|CAE60627.1| Hypothetical protein CBG04270 [Caeno... 94 5e-18
gi|39592788|emb|CAE62402.1| Hypothetical protein CBG06489 [Caeno... 94 9e-18
gi|39593192|emb|CAE64661.1| Hypothetical protein CBG09433 [Caeno... 88 4e-16
gi|17559330|ref|NP_504977.1| c-type lectin precursor family memb... 85 4e-15
gi|17564166|ref|NP_506744.1| low affinity IgE Fc receptor B fami... 81 4e-14
gi|17557348|ref|NP_506270.1| c-type lectin family member (5N612C... 80 1e-13
gi|39588704|emb|CAE58228.1| Hypothetical protein CBG01325 [Caeno... 79 2e-13
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ... 78 5e-13
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma... 78 5e-13
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma... 77 6e-13
gi|50732401|ref|XP_418618.1| PREDICTED: similar to Macrophage ma... 77 6e-13
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n... 73 2e-11
gi|46195838|ref|NP_996866.1| yolk sac IgY receptor [Gallus gallu... 72 2e-11
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f... 72 3e-11
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas... 71 6e-11
gi|26331710|dbj|BAC29585.1| unnamed protein product [Mus musculus] 71 6e-11
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno... 69 2e-10
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ... 69 2e-10
gi|50749889|ref|XP_421801.1| PREDICTED: similar to CRP-ductin-al... 69 3e-10
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep... 69 3e-10
gi|47551177|ref|NP_999773.1| sperm receptor for egg jelly [Stron... 68 5e-10
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s... 67 9e-10
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 67 9e-10
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens] 66 2e-09
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu... 66 2e-09
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti... 66 2e-09
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens] 66 2e-09
gi|47217439|emb|CAG10208.1| unnamed protein product [Tetraodon n... 65 3e-09
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb... 65 4e-09
gi|47564066|ref|NP_001001158.1| DEC-205/CD205 protein [Bos tauru... 64 6e-09
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor... 64 7e-09
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]... 64 1e-08
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus] 64 1e-08
gi|39581873|emb|CAE60767.1| Hypothetical protein CBG04455 [Caeno... 62 2e-08
gi|2695977|emb|CAA70853.1| bone morphogenetic protein 1b [Xenopu... 61 5e-08
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens] 61 5e-08
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]... 61 5e-08
gi|17559336|ref|NP_504976.1| predicted CDS, tetranectin like pre... 61 5e-08
gi|39590314|emb|CAE66053.1| Hypothetical protein CBG11254 [Caeno... 61 5e-08
gi|16716457|ref|NP_444401.1| CUB and Sushi multiple domains 1 [M... 61 6e-08
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ... 61 6e-08
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le... 61 6e-08
gi|5902808|ref|NP_006119.1| bone morphogenetic protein 1 isoform... 61 6e-08
gi|47218860|emb|CAG02845.1| unnamed protein product [Tetraodon n... 60 1e-07
gi|50749895|ref|XP_421804.1| PREDICTED: similar to CUB and zona ... 60 1e-07
gi|34146972|gb|AAB37037.2| Hypothetical protein F52E1.2 [Caenorh... 60 1e-07
gi|5902811|ref|NP_006121.1| bone morphogenetic protein 1 isoform... 59 2e-07
gi|4519515|dbj|BAA75639.1| procollagen C-proteinase 3 [Rattus no... 59 2e-07
gi|38969915|gb|AAH63079.1| Bmp1 protein [Mus musculus] 59 2e-07
gi|5453579|ref|NP_006120.1| bone morphogenetic protein 1 isoform... 59 2e-07
gi|7428249|pir||B58788 procollagen C-endopeptidase (EC 3.4.24.19... 59 2e-07
gi|47230595|emb|CAF99788.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|4502421|ref|NP_001190.1| bone morphogenetic protein 1 isoform... 59 2e-07
gi|1345609|sp|P98063|BMP1_MOUSE Bone morphogenetic protein 1 pre... 59 2e-07
gi|42734447|ref|NP_033885.2| bone morphogenetic protein 1 [Mus m... 59 2e-07
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno... 59 2e-07
gi|17551160|ref|NP_509202.1| lithostathine like precursor family... 59 3e-07
gi|50749891|ref|XP_421802.1| PREDICTED: similar to hensin [Gallu... 59 3e-07
gi|22547221|ref|NP_036596.3| tolloid-like 1 [Homo sapiens] >gnl|... 58 4e-07
gi|9247108|gb|AAF86287.1| tolloid-like protein [Homo sapiens] 58 4e-07
gi|50750537|ref|XP_422039.1| PREDICTED: similar to Lymphocyte an... 58 4e-07
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ... 58 5e-07
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ... 58 5e-07
gi|1209014|dbj|BAA11922.1| Xtld protein [Xenopus laevis] 58 5e-07
gi|1345610|sp|P98070|BMP1_XENLA Bone morphogenetic protein 1 pre... 58 5e-07
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno... 57 7e-07
gi|21666355|gb|AAM73675.1| xolloid-like metalloprotease [Xenopus... 57 9e-07
gi|27924019|gb|AAK73475.2| CUB and sushi multiple domains 1 prot... 57 9e-07
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga... 57 9e-07
gi|17565000|ref|NP_503727.1| cubilin precursor (31.6 kD) (5D147)... 57 9e-07
gi|47218722|emb|CAG05694.1| unnamed protein product [Tetraodon n... 57 9e-07
gi|14787181|gb|AAG52948.1| CUB and sushi multiple domains protei... 57 9e-07
gi|50744878|ref|XP_419917.1| PREDICTED: similar to CUB and Sushi... 57 9e-07
gi|41393595|ref|NP_150094.3| CUB and Sushi multiple domains 1 [H... 57 9e-07
gi|38604975|sp|Q96PZ7|CSM1_HUMAN CUB and sushi multiple domains ... 57 9e-07
gi|39580712|emb|CAE64098.1| Hypothetical protein CBG08706 [Caeno... 57 1e-06
gi|34866550|ref|XP_235279.2| similar to CUB and sushi multiple d... 57 1e-06
gi|34878091|ref|XP_224784.2| similar to mammalian tolloid-like p... 57 1e-06
gi|2695979|emb|CAA70854.1| xolloid [Xenopus laevis] 57 1e-06
gi|39590308|emb|CAE66047.1| Hypothetical protein CBG11247 [Caeno... 57 1e-06
gi|47229455|emb|CAF99443.1| unnamed protein product [Tetraodon n... 57 1e-06
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ... 57 1e-06
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat... 57 1e-06
gi|6678363|ref|NP_033416.1| tolloid-like [Mus musculus] >gnl|BL_... 56 2e-06
gi|47229403|emb|CAF99391.1| unnamed protein product [Tetraodon n... 56 2e-06
gi|37360054|dbj|BAC98005.1| mKIAA0709 protein [Mus musculus] 56 2e-06
gi|27802748|emb|CAD60796.1| SI:bZ1C3.1 (novel protein similar to... 56 2e-06
gi|38077450|ref|XP_139502.3| similar to KIAA1894 protein [Mus mu... 56 2e-06
gi|38604742|sp|Q80T79|CSM3_MOUSE CUB and sushi multiple domains ... 56 2e-06
gi|38045890|ref|NP_937757.1| CUB and Sushi multiple domains 3 is... 56 2e-06
gi|34330133|dbj|BAC82444.1| CSMD3 protein isoform 2 [Homo sapiens] 56 2e-06
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris] 56 2e-06
gi|38045886|ref|NP_443132.2| CUB and Sushi multiple domains 3 is... 56 2e-06
gi|30908445|gb|AAO34702.1| CUB and sushi multiple domains 3 [Hom... 56 2e-06
gi|38604740|sp|Q7Z407|CSM3_HUMAN CUB and sushi multiple domains ... 56 2e-06
gi|34327986|dbj|BAB67787.2| KIAA1894 protein [Homo sapiens] 56 2e-06
gi|34330131|dbj|BAC82443.1| CSMD3 protein isoform 1 [Homo sapiens] 56 2e-06
gi|38045888|ref|NP_937756.1| CUB and Sushi multiple domains 3 is... 56 2e-06
gi|16923223|gb|AAL29940.1| lectin 1 [Girardia tigrina] 56 2e-06
gi|28981404|gb|AAH48780.1| Similar to phospholipase A2, group IB... 55 3e-06
gi|6912724|ref|NP_036597.1| tolloid-like 2 [Homo sapiens] >gnl|B... 55 3e-06
gi|50749418|ref|XP_421628.1| PREDICTED: similar to tolloid-like ... 55 3e-06
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ... 55 3e-06
gi|20385163|gb|AAM21196.1| C-type mannose-binding lectin [Oncorh... 55 3e-06
gi|47210578|emb|CAF92640.1| unnamed protein product [Tetraodon n... 55 3e-06
gi|34327970|dbj|BAA76776.2| KIAA0932 protein [Homo sapiens] 55 3e-06
gi|50732417|ref|XP_418626.1| PREDICTED: similar to cubilin [Gall... 55 3e-06
gi|38074443|ref|XP_130038.2| cubilin (intrinsic factor-cobalamin... 55 3e-06
gi|47215317|emb|CAG01622.1| unnamed protein product [Tetraodon n... 55 4e-06
gi|50731858|ref|XP_418391.1| PREDICTED: similar to CUB and Sushi... 55 4e-06
gi|50794515|ref|XP_428014.1| PREDICTED: similar to CRP-ductin-al... 54 6e-06
gi|2736071|gb|AAB94048.1| procollagen C-proteinase enhancer prot... 54 6e-06
gi|49522408|gb|AAH75430.1| Unknown (protein for MGC:89196) [Xeno... 54 6e-06
gi|2736072|gb|AAB94049.1| procollagen C-proteinase enhancer prot... 54 6e-06
gi|6755807|ref|NP_036034.1| tolloid-like 2 [Mus musculus] >gnl|B... 54 6e-06
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ... 54 8e-06
gi|47223677|emb|CAF99286.1| unnamed protein product [Tetraodon n... 54 8e-06
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (... 54 8e-06
gi|47203231|emb|CAF92548.1| unnamed protein product [Tetraodon n... 54 1e-05
gi|691755|dbj|BAA06445.1| phospholipase A2 receptor [Rattus sp.] 54 1e-05
gi|4557503|ref|NP_001072.1| cubilin; intrinsic factor-cobalamin ... 53 1e-05
gi|2852121|gb|AAC02259.1| bone morphogenetic protein 1 [Gallus g... 53 1e-05
gi|39586804|emb|CAE65847.1| Hypothetical protein CBG10980 [Caeno... 53 1e-05
gi|14388673|gb|AAK61830.1| intrinsic factor-vitamin B12 receptor... 53 1e-05
gi|38194215|dbj|BAD01492.1| tolloid like [Achaearanea tepidariorum] 53 2e-05
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n... 53 2e-05
gi|34533622|dbj|BAC86754.1| unnamed protein product [Homo sapiens] 53 2e-05
gi|18859499|ref|NP_571085.1| bone morphogenetic protein 1; tollo... 52 2e-05
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8... 52 2e-05
gi|47216316|emb|CAF96612.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|6624920|emb|CAB63941.1| DMBT1 prototype [Homo sapiens] 52 2e-05
gi|5912464|emb|CAB56155.1| DMBT1/8kb.2 protein [Homo sapiens] 52 2e-05
gi|42523126|ref|NP_968506.1| putative RTX family exoprotein [Bde... 52 2e-05
gi|34856588|ref|XP_230325.2| similar to E430002G05Rik protein [R... 52 2e-05
gi|8923740|ref|NP_060049.1| deleted in malignant brain tumors 1 ... 52 2e-05
gi|4758170|ref|NP_004397.1| deleted in malignant brain tumors 1 ... 52 2e-05
gi|4996278|dbj|BAA78577.1| DMBT1 [Homo sapiens] 52 2e-05
gi|6633801|ref|NP_015568.1| deleted in malignant brain tumors 1 ... 52 2e-05
gi|14715231|emb|CAC44122.1| DMBT1/8kb.2 protein [Homo sapiens] 52 2e-05
gi|33468666|emb|CAE30401.1| SI:zC237L4.5 (novel protein similar ... 52 3e-05
gi|2852123|gb|AAC02260.1| Tolloid [Gallus gallus] 52 3e-05
gi|39592917|emb|CAE62531.1| Hypothetical protein CBG06640 [Caeno... 52 3e-05
gi|16758040|ref|NP_445784.1| cubilin [Rattus norvegicus] >gnl|BL... 52 3e-05
gi|15620839|dbj|BAB67783.1| KIAA1890 protein [Homo sapiens] 52 4e-05
gi|37181456|gb|AAQ88541.1| CSMD1 [Homo sapiens] 52 4e-05
gi|47207564|emb|CAF96210.1| unnamed protein product [Tetraodon n... 52 4e-05
gi|47224082|emb|CAG12911.1| unnamed protein product [Tetraodon n... 52 4e-05
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor... 52 4e-05
gi|17561226|ref|NP_505170.1| IgE receptor precursor (5I887) [Cae... 51 5e-05
gi|50759800|ref|XP_417788.1| PREDICTED: similar to CUB and sushi... 51 5e-05
gi|34013700|gb|AAQ56013.1| lectin protein type II [Hippocampus c... 51 5e-05
gi|563144|gb|AAA70057.1| tolloid related-1 51 6e-05
gi|2133650|pir||S58984 development protein tolkin (EC 3.4.24.-) ... 51 6e-05
gi|17136740|ref|NP_476879.1| CG6863-PA [Drosophila melanogaster]... 51 6e-05
gi|34013698|gb|AAQ56012.1| lectin protein type I [Hippocampus co... 51 6e-05
gi|7959947|gb|AAF71144.1| low-affinity IgE receptor; CD23 [Equus... 51 6e-05
gi|16923225|gb|AAL29932.1| lectin 2a [Girardia tigrina] 51 6e-05
gi|48097714|ref|XP_393866.1| similar to CG6863-PA [Apis mellifera] 51 6e-05
gi|31982080|ref|NP_776110.2| regeneration associated muscle prot... 51 6e-05
gi|26352936|dbj|BAC40098.1| unnamed protein product [Mus musculus] 51 6e-05
gi|290002|gb|AAA49200.1| antifreeze protein >gnl|BL_ORD_ID|11388... 51 6e-05
gi|34003|emb|CAA28465.1| unnamed protein product [Homo sapiens] 50 8e-05
gi|26340010|dbj|BAC33668.1| unnamed protein product [Mus musculus] 50 8e-05
gi|6492289|gb|AAF14258.1| cubilin [Canis familiaris] 50 8e-05
gi|47212995|emb|CAF96698.1| unnamed protein product [Tetraodon n... 50 8e-05
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co... 50 8e-05
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ... 50 8e-05
gi|45382677|ref|NP_990034.1| colloid protein [Gallus gallus] >gn... 50 8e-05
gi|38373928|gb|AAR19205.1| type II transmembrane C-type lectin [... 50 8e-05
gi|20149533|ref|NP_001993.2| Fc fragment of IgE, low affinity II... 50 1e-04
gi|27596831|gb|AAO20894.1| tolloid protease-like protein [Ilyana... 50 1e-04
gi|7511720|pir||T31069 tolloid-BMP-1 like protein 1 - California... 50 1e-04
gi|13623323|gb|AAH06265.1| PCOLCE2 protein [Homo sapiens] 50 1e-04
gi|39588321|emb|CAE72672.1| Hypothetical protein CBG19888 [Caeno... 50 1e-04
gi|48110771|ref|XP_396277.1| similar to CG9138-PA [Apis mellifera] 50 1e-04
gi|7019483|ref|NP_037495.1| procollagen C-endopeptidase enhancer... 50 1e-04
gi|17542436|ref|NP_500843.1| core protein (4G419) [Caenorhabditi... 50 1e-04
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an... 50 1e-04
gi|1168541|sp|P42662|ASTL_COTJA Astacin like metalloendopeptidas... 50 1e-04
gi|619861|gb|AAC41710.1| bone morphogenetic protein 49 2e-04
gi|27463046|gb|AAO15690.1| hatching gland-like XheI protein [Xen... 49 2e-04
gi|17565466|ref|NP_507951.1| lithostathine like family member (5... 49 2e-04
gi|50732415|ref|XP_418625.1| PREDICTED: similar to cubilin; intr... 49 3e-04
gi|47187593|emb|CAF88390.1| unnamed protein product [Tetraodon n... 49 3e-04
gi|34879396|ref|XP_225027.2| similar to CSMD1 [Rattus norvegicus] 49 3e-04
gi|5764609|gb|AAD51335.1| CD23 homolog [Ancylostoma ceylanicum] 49 3e-04
gi|48095748|ref|XP_394526.1| similar to ENSANGP00000021200 [Apis... 48 4e-04
gi|17565058|ref|NP_507829.1| versican precursor family member (3... 48 4e-04
gi|50748042|ref|XP_421084.1| PREDICTED: similar to ELGC699 [Gall... 48 4e-04
gi|47224882|emb|CAG06452.1| unnamed protein product [Tetraodon n... 48 4e-04
gi|17553354|ref|NP_497168.1| predicted CDS, C type lectin (3A790... 48 4e-04
gi|50748091|ref|XP_421101.1| PREDICTED: similar to astacin like ... 48 4e-04
gi|32563523|ref|NP_443128.1| CUB and Sushi multiple domains 2 [H... 48 4e-04
gi|34534755|dbj|BAC87101.1| unnamed protein product [Homo sapiens] 48 4e-04
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n... 48 5e-04
gi|50748263|ref|XP_426424.1| PREDICTED: similar to hatching enzy... 48 5e-04
gi|34867472|ref|XP_213668.2| similar to enteropeptidase [Rattus ... 48 5e-04
gi|47207936|emb|CAF91436.1| unnamed protein product [Tetraodon n... 48 5e-04
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe... 47 7e-04
gi|47551107|ref|NP_999728.1| bone morphogenetic protein 1 [Stron... 47 7e-04
gi|32450276|gb|AAH54276.1| Pcolce2-prov protein [Xenopus laevis] 47 7e-04
gi|47522970|ref|NP_999243.1| P-selectin [Sus scrofa] >gnl|BL_ORD... 47 7e-04
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio] 47 7e-04
gi|34365344|emb|CAE45995.1| hypothetical protein [Homo sapiens] 47 7e-04
gi|691753|dbj|BAA06444.1| phospholipase A2 receptor [Homo sapiens] 47 7e-04
gi|4039157|gb|AAC97514.1| similar to Homo sapiens DMBT1 [Macaca ... 47 7e-04
gi|17557916|ref|NP_507547.1| versican precursor family member (5... 47 0.001
gi|17540462|ref|NP_500454.1| c-type lectin and low density lipop... 47 0.001
gi|47551243|ref|NP_999802.1| receptor for egg jelly 2 protein [S... 47 0.001
gi|33589420|gb|AAQ22477.1| RE25412p [Drosophila melanogaster] 47 0.001
gi|28628338|gb|AAO43606.1| serum lectin isoform 2 precursor [Sal... 47 0.001
gi|45549230|ref|NP_524487.2| CG6868-PA [Drosophila melanogaster]... 47 0.001
gi|135912|sp|P25723|TLD_DROME Dorsal-ventral patterning tolloid ... 47 0.001
gi|50418093|gb|AAH77648.1| Unknown (protein for MGC:86525) [Xeno... 47 0.001
gi|31213165|ref|XP_315526.1| ENSANGP00000021200 [Anopheles gambi... 47 0.001
gi|7716870|gb|AAF68585.1| tolloid [Drosophila simulans] 47 0.001
gi|7716880|gb|AAF68590.1| tolloid [Drosophila simulans] 47 0.001
gi|7716872|gb|AAF68586.1| tolloid [Drosophila simulans] 47 0.001
gi|7716882|gb|AAF68591.1| tolloid [Drosophila simulans] 47 0.001
gi|7716878|gb|AAF68589.1| tolloid [Drosophila simulans] 47 0.001
gi|7716874|gb|AAF68587.1| tolloid [Drosophila simulans] 47 0.001
gi|7716876|gb|AAF68588.1| tolloid [Drosophila simulans] 47 0.001
gi|19424220|ref|NP_598234.1| Fc receptor, IgE, low affinity II, ... 46 0.002
gi|49522356|gb|AAH75353.1| Unknown (protein for MGC:89049) [Xeno... 46 0.002
gi|47225569|emb|CAG12052.1| unnamed protein product [Tetraodon n... 46 0.002
gi|19070849|gb|AAL84004.1| CD23 [Rattus norvegicus] 46 0.002
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans] 46 0.002
gi|1589367|prf||2211228A enteropeptidase 46 0.002
gi|34013702|gb|AAQ56014.1| lectin protein type III [Hippocampus ... 46 0.002
gi|48476186|gb|AAT44368.1| REJ1CRD2 [Allocentrotus fragilis] 46 0.002
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n... 46 0.002
gi|34871467|ref|XP_232753.2| similar to CUB and sushi multiple d... 46 0.002
gi|39596329|emb|CAE69967.1| Hypothetical protein CBG16363 [Caeno... 45 0.003
gi|19921688|ref|NP_610207.1| CG8343-PA [Drosophila melanogaster]... 45 0.003
gi|13431313|sp|Q9WU60|ATRN_MOUSE Attractin precursor (Mahogany p... 45 0.003
gi|47208253|emb|CAF93060.1| unnamed protein product [Tetraodon n... 45 0.003
gi|1478015|gb|AAB36402.1| ECLV IX/X-bp beta subunit=Ca(2+)-depen... 45 0.003
gi|48476190|gb|AAT44370.1| REJ1CRD2 [Hemicentrotus pulcherrimus] 45 0.003
gi|6753146|ref|NP_033860.1| attractin [Mus musculus] >gnl|BL_ORD... 45 0.003
gi|39583858|emb|CAE63948.1| Hypothetical protein CBG08530 [Caeno... 45 0.003
gi|38074445|ref|XP_140816.3| similar to cubilin; cubilin (intrin... 45 0.003
gi|26006173|dbj|BAC41429.1| mKIAA0548 protein [Mus musculus] 45 0.003
gi|31212883|ref|XP_312182.1| ENSANGP00000010271 [Anopheles gambi... 45 0.003
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus] 45 0.004
gi|18476520|gb|AAL58516.1| Fc epsilon receptor II subtype b vari... 45 0.004
gi|39581146|emb|CAE71003.1| Hypothetical protein CBG17839 [Caeno... 45 0.004
gi|18476522|gb|AAL58517.1| Fc epsilon receptor II subtype b vari... 45 0.004
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [... 45 0.004
gi|28628340|gb|AAO43607.1| serum lectin isoform 3 precursor [Sal... 45 0.004
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p... 45 0.004
gi|13236929|gb|AAB28791.2| low affinity IgE Fc receptor isoform ... 45 0.004
gi|13236930|gb|AAB28792.2| low affinity IgE Fc receptor isoform ... 45 0.004
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr... 45 0.004
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ... 45 0.004
gi|4585307|gb|AAD25372.1| attractin [Mus musculus] 45 0.004
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ... 45 0.004
gi|211655|gb|AAA48720.1| proteoglycan core protein 45 0.004
gi|16769722|gb|AAL29080.1| LP01328p [Drosophila melanogaster] 45 0.004
gi|560482|emb|CAA45532.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m... 45 0.004
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi... 45 0.004
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote... 45 0.004
gi|560484|emb|CAA45533.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m... 45 0.004
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID... 45 0.004
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ... 45 0.004
gi|24582396|ref|NP_609091.2| CG9138-PA [Drosophila melanogaster]... 45 0.004
gi|13236931|gb|AAB28793.2| low affinity IgE Fc receptor isoform ... 45 0.004
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|... 45 0.004
gi|833853|gb|AAA67565.1| versican V2 core protein precursor 45 0.004
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens] 45 0.004
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens] 45 0.004
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ... 45 0.004
gi|47208122|emb|CAF91040.1| unnamed protein product [Tetraodon n... 45 0.004
gi|7305051|ref|NP_038545.1| Fc receptor, IgE, low affinity II, a... 45 0.004
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [... 45 0.004
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus] 45 0.005
gi|7512084|pir||S71352 metalloproteinase (EC 3.4.24.-) 10 precur... 45 0.005
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor... 45 0.005
gi|47230594|emb|CAF99787.1| unnamed protein product [Tetraodon n... 45 0.005
gi|7512178|pir||T30337 polyprotein - African clawed frog >gnl|BL... 45 0.005
gi|26000685|gb|AAN75192.1| C-type lectin [Carassius auratus] 45 0.005
gi|33341214|gb|AAQ15168.1| stejaggregin-A beta chain-2 [Trimeres... 44 0.006
gi|7188780|gb|AAF37867.1| exoskeleton protein RP43 [Riftia pachy... 44 0.006
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr... 44 0.006
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal... 44 0.006
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal... 44 0.006
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal... 44 0.006
gi|2497645|sp|Q28768|LEM1_PAPHA L-selectin precursor (Lymph node... 44 0.006
gi|2497643|sp|Q95198|LEM1_MACMU L-selectin precursor (Lymph node... 44 0.006
gi|26349637|dbj|BAC38458.1| unnamed protein product [Mus musculus] 44 0.006
gi|38078818|ref|XP_355523.1| similar to CUB and sushi multiple d... 44 0.006
gi|19401623|gb|AAL87637.1| CD69 [Rattus norvegicus] 44 0.006
gi|47551233|ref|NP_999801.1| receptor for egg jelly 3 [Strongylo... 44 0.006
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus] 44 0.008
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B... 44 0.008
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic... 44 0.008
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (... 44 0.008
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr... 44 0.008
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 44 0.008
gi|181168|gb|AAA35726.1| proteoglycan core protein 44 0.008
gi|34856500|ref|XP_230054.2| similar to eosinophil major basic p... 44 0.008
gi|34364726|emb|CAE45808.1| hypothetical protein [Homo sapiens] 44 0.008
gi|14042814|dbj|BAB55404.1| unnamed protein product [Homo sapiens] 44 0.008
gi|50659098|ref|NP_056245.2| regeneration associated muscle prot... 44 0.008
gi|50659100|ref|NP_001001991.1| regeneration associated muscle p... 44 0.008
gi|50752188|ref|XP_426680.1| PREDICTED: similar to procollagen C... 44 0.008
gi|11993941|ref|NP_032437.2| CUB and zona pellucida-like domains... 44 0.008
gi|13898378|gb|AAK48711.1| E-selectin [Ovis aries] 44 0.010
gi|22095011|ref|NP_083896.1| procollagen C-endopeptidase enhance... 44 0.010
gi|19070657|gb|AAL83947.1| procollagen COOH-terminal proteinase ... 44 0.010
gi|41080624|gb|AAR99506.1| soluble neuropilin 1b [Danio rerio] 44 0.010
gi|38146361|gb|AAR11553.1| neuropilin 1b [Danio rerio] 44 0.010
gi|40748260|gb|AAR89616.1| neuropilin 1b [Danio rerio] 44 0.010
gi|45387759|ref|NP_991237.1| neuropilin 1 b; neuropilin 1b [Dani... 44 0.010
gi|47204841|emb|CAF88849.1| unnamed protein product [Tetraodon n... 44 0.010
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec... 44 0.010
gi|32264366|gb|AAP78681.1| MBCTL2 [Monosiga brevicollis] 44 0.010
gi|33341216|gb|AAQ15169.1| stejaggregin-A beta chain-3 [Trimeres... 43 0.014
gi|1168684|sp|P42674|BP10_PARLI Blastula protease-10 precursor >... 43 0.014
gi|33341196|gb|AAQ15159.1| stejaggregin-B beta chain-2 [Trimeres... 43 0.014
gi|47219400|emb|CAG01563.1| unnamed protein product [Tetraodon n... 43 0.014
gi|34866475|ref|XP_235273.2| similar to CUB and sushi multiple d... 43 0.014
gi|32264364|gb|AAP78680.1| MBCTL1 [Monosiga brevicollis] 43 0.014
gi|26332511|dbj|BAC29973.1| unnamed protein product [Mus musculus] 43 0.014
gi|48476194|gb|AAT44372.1| REJ1CRD2 [Strongylocentrotus droebach... 43 0.014
gi|6679489|ref|NP_032967.1| protease, serine, 7 (enterokinase); ... 43 0.014
gi|18157520|dbj|BAB83835.1| supported by GENSCAN and partially h... 43 0.014
gi|7674107|sp|Q9YGP1|LECG_TRIST Galactose-binding lectin precurs... 43 0.014
gi|7804476|dbj|BAA95671.1| C-type lectin [Cyprinus carpio] 43 0.014
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA... 43 0.014
gi|39586117|emb|CAE69193.1| Hypothetical protein CBG15230 [Caeno... 43 0.014
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr... 43 0.014
gi|30578425|ref|NP_849186.1| protease, serine, 7 (enterokinase);... 43 0.014
gi|13786196|ref|NP_112641.1| attractin [Rattus norvegicus] >gnl|... 43 0.018
gi|33341194|gb|AAQ15158.1| stejaggregin-B beta chain-1 [Trimeres... 43 0.018
gi|47223073|emb|CAG07160.1| unnamed protein product [Tetraodon n... 43 0.018
gi|3023231|sp|P81113|ABA3_TRIAB Alboaggregin A subunit 3 43 0.018
gi|10432394|emb|CAC10284.1| dJ947L8.1.7 (novel CUB domain protei... 43 0.018
gi|47220817|emb|CAG00024.1| unnamed protein product [Tetraodon n... 43 0.018
gi|12275312|dbj|BAB21018.1| attractin [Rattus norvegicus] 43 0.018
gi|47217067|emb|CAG02378.1| unnamed protein product [Tetraodon n... 42 0.023
gi|85534|pir||JH0626 antifreeze protein II precursor - rainbow s... 42 0.023
gi|47216046|emb|CAG11377.1| unnamed protein product [Tetraodon n... 42 0.023
gi|31879371|dbj|BAC77707.1| EMS16 B chain [Echis multisquamatus] 42 0.023
gi|34858510|ref|XP_232418.2| CD69 antigen [Rattus norvegicus] 42 0.023
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb... 42 0.023
gi|85699|pir||JQ0948 A5 antigen precursor - African clawed frog ... 42 0.023
gi|47208698|emb|CAF89942.1| unnamed protein product [Tetraodon n... 42 0.023
gi|112932|sp|P28824|NRP1_XENLA Neuropilin-1 precursor (A5 protei... 42 0.023
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_... 42 0.023
gi|47213476|emb|CAF91133.1| unnamed protein product [Tetraodon n... 42 0.023
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno... 42 0.023
gi|47225069|emb|CAF97484.1| unnamed protein product [Tetraodon n... 42 0.023
gi|7705290|ref|NP_036635.1| asialoglycoprotein receptor 1 (hepat... 42 0.030
gi|4456459|emb|CAB37431.1| hypothetical protein [Homo sapiens] 42 0.030
gi|37181935|gb|AAQ88771.1| SEZ6L [Homo sapiens] 42 0.030
gi|202988|gb|AAA40764.1| asialoglycoprotein receptor 42 0.030
gi|32261332|ref|NP_066938.2| seizure related 6 homolog (mouse)-l... 42 0.030
gi|6941612|emb|CAB72345.1| dJ268D13.1.1 (shares domains with BMP... 42 0.030
gi|6941614|emb|CAB72347.1| dJ268D13.1.3 (shares domains with BMP... 42 0.030
gi|4886439|emb|CAB43355.1| hypothetical protein [Homo sapiens] 42 0.030
gi|14133225|dbj|BAA76771.2| KIAA0927 protein [Homo sapiens] 42 0.030
gi|6729952|pdb|2AFP|A Chain A, The Solution Structure Of Type Ii... 42 0.030
gi|47678679|emb|CAG30460.1| SEZ6L [Homo sapiens] 42 0.030
gi|47225543|emb|CAG12026.1| unnamed protein product [Tetraodon n... 42 0.030
gi|6941613|emb|CAB72346.1| dJ268D13.1.2 (shares domains with BMP... 42 0.030
gi|113926|sp|P05140|ANP_HEMAM Type II antifreeze protein precurs... 42 0.030
gi|213876|gb|AAA49618.1| antifreeze protein 42 0.030
gi|47211657|emb|CAF94910.1| unnamed protein product [Tetraodon n... 42 0.030
gi|213874|gb|AAA49617.1| antifreeze polypeptide (AFP) precursor 42 0.030
gi|20562941|gb|AAM22788.1| C-type lectin [Deinagkistrodon acutus] 42 0.030
gi|20562939|gb|AAM22787.1| C-type lectin [Deinagkistrodon acutus... 42 0.039
gi|27372091|gb|AAN87893.1| LECAM-1 [Sigmodon hispidus] 42 0.039
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo... 42 0.039
gi|25148729|ref|NP_503500.2| asialoglycoprotein receptor family ... 42 0.039
gi|39588559|emb|CAE58082.1| Hypothetical protein CBG01163 [Caeno... 42 0.039
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno... 41 0.051
gi|399040|sp|Q01758|ANP_OSMMO Type II antifreeze protein precurs... 41 0.051
gi|6679221|ref|NP_032814.1| procollagen C-proteinase enhancer pr... 41 0.051
gi|13899255|ref|NP_113621.1| membrane frizzled-related protein; ... 41 0.051
gi|2134176|pir||I51569 UVS.2 protein - African clawed frog (frag... 41 0.051
gi|6707084|gb|AAF25588.1| low-affinity IgE receptor [Bos taurus] 41 0.051
gi|2828509|sp|P42664|UVS2_XENLA Embryonic protein UVS.2 precurso... 41 0.051
gi|16930101|dbj|BAB72012.1| attractin [Mesocricetus auratus] 41 0.051
gi|46048318|ref|NP_705726.2| C lectin-related protein A [Mus mus... 41 0.051
gi|3913579|sp|P81448|EMBP_CRIGR Eosinophil granule major basic p... 41 0.051
gi|15826254|pdb|1H8U|A Chain A, Crystal Structure Of The Eosinop... 41 0.051
gi|400414|emb|CAA81207.1| eosinophil granule major basic pre-pro... 41 0.051
gi|187415|gb|AAA36203.1| major basic protein precursor 41 0.051
gi|119239|sp|P13727|EMBP_HUMAN Eosinophil granule major basic pr... 41 0.051
gi|37619835|emb|CAB01145.2| Hypothetical protein F08H9.8 [Caenor... 41 0.051
gi|2146997|pir||JC4892 L-selectin precursor - rabbit >gnl|BL_ORD... 41 0.051
gi|34863203|ref|XP_236179.2| similar to membrane-type frizzled-r... 41 0.051
gi|9506953|ref|NP_062110.1| procollagen C-proteinase enhancer pr... 41 0.051
gi|6919942|sp|Q61398|PCO1_MOUSE Procollagen C-proteinase enhance... 41 0.051
gi|27901801|ref|NP_776607.1| selectin L [lymphocyte adhesion mol... 41 0.067
gi|1091923|prf||2022211A asialoglycoprotein receptor 41 0.067
gi|16549794|dbj|BAB70859.1| unnamed protein product [Homo sapiens] 41 0.067
gi|38078816|ref|XP_131674.2| similar to CUB and Sushi multiple d... 41 0.067
gi|3108091|gb|AAC15766.1| neurocan [Rattus norvegicus] 41 0.067
gi|2073142|dbj|BAA19861.1| Incilarin A [Incilaria fruhstorferi] 41 0.067
gi|33341184|gb|AAQ15153.1| factor IX/X binding protein alpha cha... 41 0.067
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh... 41 0.067
gi|10432398|emb|CAC10288.1| dJ947L8.1.3 (novel CUB domain protei... 41 0.067
gi|38493056|pdb|1UKM|B Chain B, Crystal Structure Of Ems16, An A... 41 0.067
gi|31377817|ref|NP_852474.1| neuropilin 1 a [Danio rerio] >gnl|B... 41 0.067
gi|27372291|dbj|BAC53657.1| neuropilin-1 [Danio rerio] 41 0.067
gi|38146359|gb|AAR11552.1| neuropilin 1a [Danio rerio] 41 0.067
gi|18777739|ref|NP_570975.1| Cd209e antigen [Mus musculus] >gnl|... 41 0.067
gi|47223422|emb|CAG04283.1| unnamed protein product [Tetraodon n... 41 0.067
gi|6753126|ref|NP_033844.1| asialoglycoprotein receptor 1 [Mus m... 40 0.088
gi|3041697|sp|P34927|LECH_MOUSE Asialoglycoprotein receptor 1 (H... 40 0.088
gi|4469126|emb|CAB38429.1| lipopolysaccharide binding protein [B... 40 0.088
gi|6755454|ref|NP_035476.1| selectin, lymphocyte [Mus musculus] ... 40 0.088
gi|4502681|ref|NP_001772.1| CD69 antigen (p60, early T-cell acti... 40 0.088
gi|6919941|sp|Q15113|PCO1_HUMAN Procollagen C-proteinase enhance... 40 0.088
>gi|17506483|ref|NP_493152.1| c-type lectin and CUB domain containing
protein family member (45.8 kD) (1N22) [Caenorhabditis
elegans]
gi|7498352|pir||T20448 hypothetical protein E03H4.10 - Caenorhabditis
elegans
gi|3875497|emb|CAB04034.1| Hypothetical protein E03H4.10
[Caenorhabditis elegans]
Length = 416
Score = 830 bits (2145), Expect = 0.0
Identities = 405/416 (97%), Positives = 405/416 (97%)
Frame = -1
Query: 1251 MQLRFALLLLIICFKACLNSPLICTNGFTLLNKKCLKLFDTKVNHTSAESSCNSFGATLV 1072
MQLRFALLLLIICFKACLNSPLICTNGFTLLNKKCLKLFDTKVNHTSAESSCNSFGATLV
Sbjct: 1 MQLRFALLLLIICFKACLNSPLICTNGFTLLNKKCLKLFDTKVNHTSAESSCNSFGATLV 60
Query: 1071 TVKNVNDEQAIATVVAASSARLIWLGLYCFDSDPAKCLWDDNSGSAQSYDNFSIDFPLVD 892
TVKNVNDEQAIATVVAASSARLIWLGLYCFDSDPAKCLWDDNSGSAQSYDNFSIDFPLVD
Sbjct: 61 TVKNVNDEQAIATVVAASSARLIWLGLYCFDSDPAKCLWDDNSGSAQSYDNFSIDFPLVD 120
Query: 891 AGHCVYLSTLGALAGKWISEDCESKLMSYICELPTTHADDCTYNYNGYCYTFSSTAEPFI 712
AGHCVYLSTLGALAGKWISEDCESKLMSYICELPTTHADDCTYNYNGYCYTFSSTAEPFI
Sbjct: 121 AGHCVYLSTLGALAGKWISEDCESKLMSYICELPTTHADDCTYNYNGYCYTFSSTAEPFI 180
Query: 711 IAQTKCAETYGDLVSIHSSNENRYIETFAAQDYYLIGAVWKLDNSLYWLDKSKWDYNNTD 532
IAQTKCAETYGDLVSIHSSNENRYIETFAAQDYYLIGAVWKLDNSLYWLDKSKWDYNNTD
Sbjct: 181 IAQTKCAETYGDLVSIHSSNENRYIETFAAQDYYLIGAVWKLDNSLYWLDKSKWDYNNTD 240
Query: 531 PENSYRGDYCVAMSTVISSPIPSGFWFSTNCTRPAKYICKRPAGVQSTTASPVTVAPSPA 352
PENSYRGDYCVAMSTVISSPIPSGFWFSTNCTRPAKYICKRPAGVQSTTASPVTVAPSPA
Sbjct: 241 PENSYRGDYCVAMSTVISSPIPSGFWFSTNCTRPAKYICKRPAGVQSTTASPVTVAPSPA 300
Query: 351 NPSNCNAGLLMSPGVITSXXXXXXXXXXXNCTYQLSTLGAYKIALRFASFSTEANDVVTV 172
NPSNCNAGLLMSPGVITS NCTYQLSTLGAYKIALRFASFSTEANDVVTV
Sbjct: 301 NPSNCNAGLLMSPGVITSPNYPENYFNNENCTYQLSTLGAYKIALRFASFSTEANDVVTV 360
Query: 171 YDGLTTDSPCLRRCSGTQRPFALTSSGNTMLVTFTSDSKGISSGFYARFSSIVYRR 4
YDGLTTDSPCLRRCSGTQRPFALTSSGNTMLVTFTSDSKGISSGFYARFSSIVYRR
Sbjct: 361 YDGLTTDSPCLRRCSGTQRPFALTSSGNTMLVTFTSDSKGISSGFYARFSSIVYRR 416