Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= E03H4_9
         (1251 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17506483|ref|NP_493152.1| c-type lectin and CUB domain contai...   830   0.0
gi|17509297|ref|NP_493166.1| predicted CDS, tolloid like family ...   505   e-141
gi|17506207|ref|NP_493162.1| c-type lectin and CUB domain contai...   498   e-139
gi|17507929|ref|NP_493197.1| c-type lectin and CUB domain contai...   478   e-133
gi|17507729|ref|NP_493109.1| predicted CDS, c-type lectin and CU...   436   e-121
gi|17552508|ref|NP_498022.1| c-type lectin and CUB domain contai...   420   e-116
gi|2146870|pir||S72579 hypothetical protein C35D10.1 - Caenorhab...   405   e-111
gi|17559516|ref|NP_504865.1| c-type lectin and CUB domain contai...   405   e-111
gi|32564282|ref|NP_493725.2| c-type lectin and CUB domain contai...   402   e-110
gi|39585607|emb|CAE65367.1| Hypothetical protein CBG10312 [Caeno...   401   e-110
gi|17507931|ref|NP_493198.1| c-type lectin family member (1N229)...   398   e-109
gi|39585606|emb|CAE65366.1| Hypothetical protein CBG10311 [Caeno...   386   e-106
gi|7509603|pir||T26655 hypothetical protein Y38E10A.e - Caenorha...   384   e-105
gi|17537005|ref|NP_496688.1| predicted CDS, c-type lectin and CU...   384   e-105
gi|7495300|pir||T32032 hypothetical protein C03H5.1 - Caenorhabd...   380   e-104
gi|17552510|ref|NP_498023.1| predicted CDS, c-type lectin and CU...   374   e-102
gi|17531345|ref|NP_494427.1| predicted CDS, c-type lectin and CU...   369   e-100
gi|32565327|ref|NP_494426.2| c-type lectin and CUB domain contai...   356   6e-97
gi|39585604|emb|CAE65364.1| Hypothetical protein CBG10309 [Caeno...   338   1e-91
gi|34555967|emb|CAB16536.2| Hypothetical protein Y70C5C.2 [Caeno...   336   8e-91
gi|17537003|ref|NP_496687.1| CUB Sushi multiple domains 1 family...   327   5e-88
gi|39585605|emb|CAE65365.1| Hypothetical protein CBG10310 [Caeno...   315   1e-84
gi|39587832|emb|CAE67850.1| Hypothetical protein CBG13437 [Caeno...   283   6e-75
gi|39586019|emb|CAE69095.1| Hypothetical protein CBG15117 [Caeno...   274   4e-72
gi|17536123|ref|NP_494003.1| predicted CDS, CUB sushi multiple d...   261   2e-68
gi|39587016|emb|CAE62951.1| Hypothetical protein CBG07164 [Caeno...   243   9e-63
gi|17566216|ref|NP_507227.1| c-type lectin and CUB domain contai...   233   4e-62
gi|39587833|emb|CAE67851.1| Hypothetical protein CBG13439 [Caeno...   229   1e-58
gi|7497310|pir||T32326 hypothetical protein C41H7.7 - Caenorhabd...   224   3e-57
gi|17536121|ref|NP_494002.1| predicted CDS, tolloid-like family ...   221   4e-56
gi|17557350|ref|NP_506271.1| c-type lectin and CUB domain contai...   214   3e-54
gi|39587015|emb|CAE62950.1| Hypothetical protein CBG07163 [Caeno...   212   2e-53
gi|17559776|ref|NP_507557.1| c-type lectin and CUB domain contai...   210   5e-53
gi|39593191|emb|CAE64660.1| Hypothetical protein CBG09432 [Caeno...   208   2e-52
gi|39587021|emb|CAE62956.1| Hypothetical protein CBG07170 [Caeno...   207   3e-52
gi|17533765|ref|NP_494066.1| c-type lectin family member (2C33) ...   196   7e-49
gi|33300107|emb|CAE17834.1| Hypothetical protein F49A5.9 [Caenor...   184   3e-45
gi|39581281|emb|CAE60027.1| Hypothetical protein CBG03533 [Caeno...   181   3e-44
gi|17535979|ref|NP_494826.1| phospholipase a2 receptor precursor...   180   5e-44
gi|17566360|ref|NP_507256.1| predicted CDS, c-type lectin family...   177   5e-43
gi|34556084|emb|CAA19438.2| Hypothetical protein Y102A5B.2 [Caen...   177   5e-43
gi|39587014|emb|CAE62949.1| Hypothetical protein CBG07162 [Caeno...   177   6e-43
gi|17564688|ref|NP_507233.1| c-type lectin family member (5R214)...   176   8e-43
gi|17564474|ref|NP_507254.1| predicted CDS, c-type lectin family...   172   1e-41
gi|17564682|ref|NP_507236.1| predicted CDS, c-type lectin family...   172   1e-41
gi|34555888|emb|CAB04740.2| Hypothetical protein T20B3.12 [Caeno...   172   1e-41
gi|17561188|ref|NP_507258.1| predicted CDS, c-type lectin family...   172   1e-41
gi|39588702|emb|CAE58226.1| Hypothetical protein CBG01323 [Caeno...   170   6e-41
gi|17564684|ref|NP_507234.1| c-type lectin family member (5R217)...   168   3e-40
gi|39587018|emb|CAE62953.1| Hypothetical protein CBG07167 [Caeno...   163   9e-39
gi|39587013|emb|CAE62948.1| Hypothetical protein CBG07161 [Caeno...   162   2e-38
gi|34555878|emb|CAB04417.2| Hypothetical protein F49A5.5 [Caenor...   162   2e-38
gi|17566358|ref|NP_507257.1| c-type lectin family member (5R335)...   160   6e-38
gi|34555879|emb|CAB04422.2| Hypothetical protein Y102A5B.1 [Caen...   160   6e-38
gi|7508450|pir||T25279 hypothetical protein T25E12.9 - Caenorhab...   160   8e-38
gi|32567058|ref|NP_507235.2| c-type lectin family member (41.9 k...   158   3e-37
gi|39587020|emb|CAE62955.1| Hypothetical protein CBG07169 [Caeno...   155   1e-36
gi|39587019|emb|CAE62954.1| Hypothetical protein CBG07168 [Caeno...   155   2e-36
gi|50507778|emb|CAB04419.2| Hypothetical protein F49A5.7 [Caenor...   153   7e-36
gi|17561198|ref|NP_507262.1| receptor 1 family member (5R344) [C...   153   7e-36
gi|34555889|emb|CAB63316.2| Hypothetical protein T20B3.13 [Caeno...   152   1e-35
gi|17564476|ref|NP_507252.1| c-type lectin family member (5R320)...   152   1e-35
gi|17561192|ref|NP_507260.1| c-type lectin family member (5R341)...   152   2e-35
gi|38176036|gb|AAB66231.2| Hypothetical protein R07C3.1 [Caenorh...   150   8e-35
gi|34556083|emb|CAA19437.2| Hypothetical protein Y102A5B.3 [Caen...   149   1e-34
gi|17535525|ref|NP_493859.1| c-type lectin and CUB domain contai...   149   2e-34
gi|17561194|ref|NP_507261.1| c-type lectin family member (5R343)...   147   4e-34
gi|39585608|emb|CAE65368.1| Hypothetical protein CBG10313 [Caeno...   147   7e-34
gi|39583740|emb|CAE63844.1| Hypothetical protein CBG08400 [Caeno...   145   3e-33
gi|39585600|emb|CAE65360.1| Hypothetical protein CBG10305 [Caeno...   143   7e-33
gi|17566362|ref|NP_507255.1| c-type lectin family member (5R330)...   141   3e-32
gi|39582412|emb|CAE74796.1| Hypothetical protein CBG22627 [Caeno...   139   2e-31
gi|17564472|ref|NP_507253.1| predicted CDS, c-type lectin family...   138   2e-31
gi|39582434|emb|CAE74818.1| Hypothetical protein CBG22654 [Caeno...   135   2e-30
gi|17535547|ref|NP_493851.1| predicted CDS, receptor for egg jel...   133   1e-29
gi|17561190|ref|NP_507259.1| predicted CDS, c-type lectin family...   132   1e-29
gi|39587831|emb|CAE67849.1| Hypothetical protein CBG13436 [Caeno...   119   1e-25
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno...   115   2e-24
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa]           104   5e-21
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;...   103   6e-21
gi|477362|pir||A48925 mannose receptor precursor, macrophage - m...   100   5e-20
gi|6678932|ref|NP_032651.1| mannose receptor, C type 1 [Mus musc...   100   5e-20
gi|34877265|ref|XP_225585.2| similar to macrophage mannose recep...   100   1e-19
gi|17535981|ref|NP_494827.1| deleted in malignant brain tumors 1...    97   8e-19
gi|39587017|emb|CAE62952.1| Hypothetical protein CBG07165 [Caeno...    96   1e-18
gi|39583087|emb|CAE60627.1| Hypothetical protein CBG04270 [Caeno...    94   5e-18
gi|39592788|emb|CAE62402.1| Hypothetical protein CBG06489 [Caeno...    94   9e-18
gi|39593192|emb|CAE64661.1| Hypothetical protein CBG09433 [Caeno...    88   4e-16
gi|17559330|ref|NP_504977.1| c-type lectin precursor family memb...    85   4e-15
gi|17564166|ref|NP_506744.1| low affinity IgE Fc receptor B fami...    81   4e-14
gi|17557348|ref|NP_506270.1| c-type lectin family member (5N612C...    80   1e-13
gi|39588704|emb|CAE58228.1| Hypothetical protein CBG01325 [Caeno...    79   2e-13
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ...    78   5e-13
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma...    78   5e-13
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma...    77   6e-13
gi|50732401|ref|XP_418618.1| PREDICTED: similar to Macrophage ma...    77   6e-13
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n...    73   2e-11
gi|46195838|ref|NP_996866.1| yolk sac IgY receptor [Gallus gallu...    72   2e-11
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f...    72   3e-11
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas...    71   6e-11
gi|26331710|dbj|BAC29585.1| unnamed protein product [Mus musculus]     71   6e-11
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno...    69   2e-10
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ...    69   2e-10
gi|50749889|ref|XP_421801.1| PREDICTED: similar to CRP-ductin-al...    69   3e-10
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep...    69   3e-10
gi|47551177|ref|NP_999773.1| sperm receptor for egg jelly [Stron...    68   5e-10
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s...    67   9e-10
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb...    67   9e-10
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens]            66   2e-09
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu...    66   2e-09
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti...    66   2e-09
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens]    66   2e-09
gi|47217439|emb|CAG10208.1| unnamed protein product [Tetraodon n...    65   3e-09
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb...    65   4e-09
gi|47564066|ref|NP_001001158.1| DEC-205/CD205 protein [Bos tauru...    64   6e-09
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor...    64   7e-09
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]...    64   1e-08
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus]                      64   1e-08
gi|39581873|emb|CAE60767.1| Hypothetical protein CBG04455 [Caeno...    62   2e-08
gi|2695977|emb|CAA70853.1| bone morphogenetic protein 1b [Xenopu...    61   5e-08
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens]                     61   5e-08
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]...    61   5e-08
gi|17559336|ref|NP_504976.1| predicted CDS, tetranectin like pre...    61   5e-08
gi|39590314|emb|CAE66053.1| Hypothetical protein CBG11254 [Caeno...    61   5e-08
gi|16716457|ref|NP_444401.1| CUB and Sushi multiple domains 1 [M...    61   6e-08
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ...    61   6e-08
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le...    61   6e-08
gi|5902808|ref|NP_006119.1| bone morphogenetic protein 1 isoform...    61   6e-08
gi|47218860|emb|CAG02845.1| unnamed protein product [Tetraodon n...    60   1e-07
gi|50749895|ref|XP_421804.1| PREDICTED: similar to CUB and zona ...    60   1e-07
gi|34146972|gb|AAB37037.2| Hypothetical protein F52E1.2 [Caenorh...    60   1e-07
gi|5902811|ref|NP_006121.1| bone morphogenetic protein 1 isoform...    59   2e-07
gi|4519515|dbj|BAA75639.1| procollagen C-proteinase 3 [Rattus no...    59   2e-07
gi|38969915|gb|AAH63079.1| Bmp1 protein [Mus musculus]                 59   2e-07
gi|5453579|ref|NP_006120.1| bone morphogenetic protein 1 isoform...    59   2e-07
gi|7428249|pir||B58788 procollagen C-endopeptidase (EC 3.4.24.19...    59   2e-07
gi|47230595|emb|CAF99788.1| unnamed protein product [Tetraodon n...    59   2e-07
gi|4502421|ref|NP_001190.1| bone morphogenetic protein 1 isoform...    59   2e-07
gi|1345609|sp|P98063|BMP1_MOUSE Bone morphogenetic protein 1 pre...    59   2e-07
gi|42734447|ref|NP_033885.2| bone morphogenetic protein 1 [Mus m...    59   2e-07
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno...    59   2e-07
gi|17551160|ref|NP_509202.1| lithostathine like precursor family...    59   3e-07
gi|50749891|ref|XP_421802.1| PREDICTED: similar to hensin [Gallu...    59   3e-07
gi|22547221|ref|NP_036596.3| tolloid-like 1 [Homo sapiens] >gnl|...    58   4e-07
gi|9247108|gb|AAF86287.1| tolloid-like protein [Homo sapiens]          58   4e-07
gi|50750537|ref|XP_422039.1| PREDICTED: similar to Lymphocyte an...    58   4e-07
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ...    58   5e-07
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ...    58   5e-07
gi|1209014|dbj|BAA11922.1| Xtld protein [Xenopus laevis]               58   5e-07
gi|1345610|sp|P98070|BMP1_XENLA Bone morphogenetic protein 1 pre...    58   5e-07
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno...    57   7e-07
gi|21666355|gb|AAM73675.1| xolloid-like metalloprotease [Xenopus...    57   9e-07
gi|27924019|gb|AAK73475.2| CUB and sushi multiple domains 1 prot...    57   9e-07
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga...    57   9e-07
gi|17565000|ref|NP_503727.1| cubilin precursor (31.6 kD) (5D147)...    57   9e-07
gi|47218722|emb|CAG05694.1| unnamed protein product [Tetraodon n...    57   9e-07
gi|14787181|gb|AAG52948.1| CUB and sushi multiple domains protei...    57   9e-07
gi|50744878|ref|XP_419917.1| PREDICTED: similar to CUB and Sushi...    57   9e-07
gi|41393595|ref|NP_150094.3| CUB and Sushi multiple domains 1 [H...    57   9e-07
gi|38604975|sp|Q96PZ7|CSM1_HUMAN CUB and sushi multiple domains ...    57   9e-07
gi|39580712|emb|CAE64098.1| Hypothetical protein CBG08706 [Caeno...    57   1e-06
gi|34866550|ref|XP_235279.2| similar to CUB and sushi multiple d...    57   1e-06
gi|34878091|ref|XP_224784.2| similar to mammalian tolloid-like p...    57   1e-06
gi|2695979|emb|CAA70854.1| xolloid [Xenopus laevis]                    57   1e-06
gi|39590308|emb|CAE66047.1| Hypothetical protein CBG11247 [Caeno...    57   1e-06
gi|47229455|emb|CAF99443.1| unnamed protein product [Tetraodon n...    57   1e-06
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ...    57   1e-06
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat...    57   1e-06
gi|6678363|ref|NP_033416.1| tolloid-like [Mus musculus] >gnl|BL_...    56   2e-06
gi|47229403|emb|CAF99391.1| unnamed protein product [Tetraodon n...    56   2e-06
gi|37360054|dbj|BAC98005.1| mKIAA0709 protein [Mus musculus]           56   2e-06
gi|27802748|emb|CAD60796.1| SI:bZ1C3.1 (novel protein similar to...    56   2e-06
gi|38077450|ref|XP_139502.3| similar to KIAA1894 protein [Mus mu...    56   2e-06
gi|38604742|sp|Q80T79|CSM3_MOUSE CUB and sushi multiple domains ...    56   2e-06
gi|38045890|ref|NP_937757.1| CUB and Sushi multiple domains 3 is...    56   2e-06
gi|34330133|dbj|BAC82444.1| CSMD3 protein isoform 2 [Homo sapiens]     56   2e-06
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris]    56   2e-06
gi|38045886|ref|NP_443132.2| CUB and Sushi multiple domains 3 is...    56   2e-06
gi|30908445|gb|AAO34702.1| CUB and sushi multiple domains 3 [Hom...    56   2e-06
gi|38604740|sp|Q7Z407|CSM3_HUMAN CUB and sushi multiple domains ...    56   2e-06
gi|34327986|dbj|BAB67787.2| KIAA1894 protein [Homo sapiens]            56   2e-06
gi|34330131|dbj|BAC82443.1| CSMD3 protein isoform 1 [Homo sapiens]     56   2e-06
gi|38045888|ref|NP_937756.1| CUB and Sushi multiple domains 3 is...    56   2e-06
gi|16923223|gb|AAL29940.1| lectin 1 [Girardia tigrina]                 56   2e-06
gi|28981404|gb|AAH48780.1| Similar to phospholipase A2, group IB...    55   3e-06
gi|6912724|ref|NP_036597.1| tolloid-like 2 [Homo sapiens] >gnl|B...    55   3e-06
gi|50749418|ref|XP_421628.1| PREDICTED: similar to tolloid-like ...    55   3e-06
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ...    55   3e-06
gi|20385163|gb|AAM21196.1| C-type mannose-binding lectin [Oncorh...    55   3e-06
gi|47210578|emb|CAF92640.1| unnamed protein product [Tetraodon n...    55   3e-06
gi|34327970|dbj|BAA76776.2| KIAA0932 protein [Homo sapiens]            55   3e-06
gi|50732417|ref|XP_418626.1| PREDICTED: similar to cubilin [Gall...    55   3e-06
gi|38074443|ref|XP_130038.2| cubilin (intrinsic factor-cobalamin...    55   3e-06
gi|47215317|emb|CAG01622.1| unnamed protein product [Tetraodon n...    55   4e-06
gi|50731858|ref|XP_418391.1| PREDICTED: similar to CUB and Sushi...    55   4e-06
gi|50794515|ref|XP_428014.1| PREDICTED: similar to CRP-ductin-al...    54   6e-06
gi|2736071|gb|AAB94048.1| procollagen C-proteinase enhancer prot...    54   6e-06
gi|49522408|gb|AAH75430.1| Unknown (protein for MGC:89196) [Xeno...    54   6e-06
gi|2736072|gb|AAB94049.1| procollagen C-proteinase enhancer prot...    54   6e-06
gi|6755807|ref|NP_036034.1| tolloid-like 2 [Mus musculus] >gnl|B...    54   6e-06
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ...    54   8e-06
gi|47223677|emb|CAF99286.1| unnamed protein product [Tetraodon n...    54   8e-06
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (...    54   8e-06
gi|47203231|emb|CAF92548.1| unnamed protein product [Tetraodon n...    54   1e-05
gi|691755|dbj|BAA06445.1| phospholipase A2 receptor [Rattus sp.]       54   1e-05
gi|4557503|ref|NP_001072.1| cubilin; intrinsic factor-cobalamin ...    53   1e-05
gi|2852121|gb|AAC02259.1| bone morphogenetic protein 1 [Gallus g...    53   1e-05
gi|39586804|emb|CAE65847.1| Hypothetical protein CBG10980 [Caeno...    53   1e-05
gi|14388673|gb|AAK61830.1| intrinsic factor-vitamin B12 receptor...    53   1e-05
gi|38194215|dbj|BAD01492.1| tolloid like [Achaearanea tepidariorum]    53   2e-05
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n...    53   2e-05
gi|34533622|dbj|BAC86754.1| unnamed protein product [Homo sapiens]     53   2e-05
gi|18859499|ref|NP_571085.1| bone morphogenetic protein 1; tollo...    52   2e-05
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8...    52   2e-05
gi|47216316|emb|CAF96612.1| unnamed protein product [Tetraodon n...    52   2e-05
gi|6624920|emb|CAB63941.1| DMBT1 prototype [Homo sapiens]              52   2e-05
gi|5912464|emb|CAB56155.1| DMBT1/8kb.2 protein [Homo sapiens]          52   2e-05
gi|42523126|ref|NP_968506.1| putative RTX family exoprotein [Bde...    52   2e-05
gi|34856588|ref|XP_230325.2| similar to E430002G05Rik protein [R...    52   2e-05
gi|8923740|ref|NP_060049.1| deleted in malignant brain tumors 1 ...    52   2e-05
gi|4758170|ref|NP_004397.1| deleted in malignant brain tumors 1 ...    52   2e-05
gi|4996278|dbj|BAA78577.1| DMBT1 [Homo sapiens]                        52   2e-05
gi|6633801|ref|NP_015568.1| deleted in malignant brain tumors 1 ...    52   2e-05
gi|14715231|emb|CAC44122.1| DMBT1/8kb.2 protein [Homo sapiens]         52   2e-05
gi|33468666|emb|CAE30401.1| SI:zC237L4.5 (novel protein similar ...    52   3e-05
gi|2852123|gb|AAC02260.1| Tolloid [Gallus gallus]                      52   3e-05
gi|39592917|emb|CAE62531.1| Hypothetical protein CBG06640 [Caeno...    52   3e-05
gi|16758040|ref|NP_445784.1| cubilin [Rattus norvegicus] >gnl|BL...    52   3e-05
gi|15620839|dbj|BAB67783.1| KIAA1890 protein [Homo sapiens]            52   4e-05
gi|37181456|gb|AAQ88541.1| CSMD1 [Homo sapiens]                        52   4e-05
gi|47207564|emb|CAF96210.1| unnamed protein product [Tetraodon n...    52   4e-05
gi|47224082|emb|CAG12911.1| unnamed protein product [Tetraodon n...    52   4e-05
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor...    52   4e-05
gi|17561226|ref|NP_505170.1| IgE receptor precursor (5I887) [Cae...    51   5e-05
gi|50759800|ref|XP_417788.1| PREDICTED: similar to CUB and sushi...    51   5e-05
gi|34013700|gb|AAQ56013.1| lectin protein type II [Hippocampus c...    51   5e-05
gi|563144|gb|AAA70057.1| tolloid related-1                             51   6e-05
gi|2133650|pir||S58984 development protein tolkin (EC 3.4.24.-) ...    51   6e-05
gi|17136740|ref|NP_476879.1| CG6863-PA [Drosophila melanogaster]...    51   6e-05
gi|34013698|gb|AAQ56012.1| lectin protein type I [Hippocampus co...    51   6e-05
gi|7959947|gb|AAF71144.1| low-affinity IgE receptor; CD23 [Equus...    51   6e-05
gi|16923225|gb|AAL29932.1| lectin 2a [Girardia tigrina]                51   6e-05
gi|48097714|ref|XP_393866.1| similar to CG6863-PA [Apis mellifera]     51   6e-05
gi|31982080|ref|NP_776110.2| regeneration associated muscle prot...    51   6e-05
gi|26352936|dbj|BAC40098.1| unnamed protein product [Mus musculus]     51   6e-05
gi|290002|gb|AAA49200.1| antifreeze protein >gnl|BL_ORD_ID|11388...    51   6e-05
gi|34003|emb|CAA28465.1| unnamed protein product [Homo sapiens]        50   8e-05
gi|26340010|dbj|BAC33668.1| unnamed protein product [Mus musculus]     50   8e-05
gi|6492289|gb|AAF14258.1| cubilin [Canis familiaris]                   50   8e-05
gi|47212995|emb|CAF96698.1| unnamed protein product [Tetraodon n...    50   8e-05
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co...    50   8e-05
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ...    50   8e-05
gi|45382677|ref|NP_990034.1| colloid protein [Gallus gallus] >gn...    50   8e-05
gi|38373928|gb|AAR19205.1| type II transmembrane C-type lectin [...    50   8e-05
gi|20149533|ref|NP_001993.2| Fc fragment of IgE, low affinity II...    50   1e-04
gi|27596831|gb|AAO20894.1| tolloid protease-like protein [Ilyana...    50   1e-04
gi|7511720|pir||T31069 tolloid-BMP-1 like protein 1 - California...    50   1e-04
gi|13623323|gb|AAH06265.1| PCOLCE2 protein [Homo sapiens]              50   1e-04
gi|39588321|emb|CAE72672.1| Hypothetical protein CBG19888 [Caeno...    50   1e-04
gi|48110771|ref|XP_396277.1| similar to CG9138-PA [Apis mellifera]     50   1e-04
gi|7019483|ref|NP_037495.1| procollagen C-endopeptidase enhancer...    50   1e-04
gi|17542436|ref|NP_500843.1| core protein (4G419) [Caenorhabditi...    50   1e-04
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an...    50   1e-04
gi|1168541|sp|P42662|ASTL_COTJA Astacin like metalloendopeptidas...    50   1e-04
gi|619861|gb|AAC41710.1| bone morphogenetic protein                    49   2e-04
gi|27463046|gb|AAO15690.1| hatching gland-like XheI protein [Xen...    49   2e-04
gi|17565466|ref|NP_507951.1| lithostathine like family member (5...    49   2e-04
gi|50732415|ref|XP_418625.1| PREDICTED: similar to cubilin; intr...    49   3e-04
gi|47187593|emb|CAF88390.1| unnamed protein product [Tetraodon n...    49   3e-04
gi|34879396|ref|XP_225027.2| similar to CSMD1 [Rattus norvegicus]      49   3e-04
gi|5764609|gb|AAD51335.1| CD23 homolog [Ancylostoma ceylanicum]        49   3e-04
gi|48095748|ref|XP_394526.1| similar to ENSANGP00000021200 [Apis...    48   4e-04
gi|17565058|ref|NP_507829.1| versican precursor family member (3...    48   4e-04
gi|50748042|ref|XP_421084.1| PREDICTED: similar to ELGC699 [Gall...    48   4e-04
gi|47224882|emb|CAG06452.1| unnamed protein product [Tetraodon n...    48   4e-04
gi|17553354|ref|NP_497168.1| predicted CDS, C type lectin (3A790...    48   4e-04
gi|50748091|ref|XP_421101.1| PREDICTED: similar to astacin like ...    48   4e-04
gi|32563523|ref|NP_443128.1| CUB and Sushi multiple domains 2 [H...    48   4e-04
gi|34534755|dbj|BAC87101.1| unnamed protein product [Homo sapiens]     48   4e-04
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n...    48   5e-04
gi|50748263|ref|XP_426424.1| PREDICTED: similar to hatching enzy...    48   5e-04
gi|34867472|ref|XP_213668.2| similar to enteropeptidase [Rattus ...    48   5e-04
gi|47207936|emb|CAF91436.1| unnamed protein product [Tetraodon n...    48   5e-04
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe...    47   7e-04
gi|47551107|ref|NP_999728.1| bone morphogenetic protein 1 [Stron...    47   7e-04
gi|32450276|gb|AAH54276.1| Pcolce2-prov protein [Xenopus laevis]       47   7e-04
gi|47522970|ref|NP_999243.1| P-selectin [Sus scrofa] >gnl|BL_ORD...    47   7e-04
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio]                     47   7e-04
gi|34365344|emb|CAE45995.1| hypothetical protein [Homo sapiens]        47   7e-04
gi|691753|dbj|BAA06444.1| phospholipase A2 receptor [Homo sapiens]     47   7e-04
gi|4039157|gb|AAC97514.1| similar to Homo sapiens DMBT1 [Macaca ...    47   7e-04
gi|17557916|ref|NP_507547.1| versican precursor family member (5...    47   0.001
gi|17540462|ref|NP_500454.1| c-type lectin and low density lipop...    47   0.001
gi|47551243|ref|NP_999802.1| receptor for egg jelly 2 protein [S...    47   0.001
gi|33589420|gb|AAQ22477.1| RE25412p [Drosophila melanogaster]          47   0.001
gi|28628338|gb|AAO43606.1| serum lectin isoform 2 precursor [Sal...    47   0.001
gi|45549230|ref|NP_524487.2| CG6868-PA [Drosophila melanogaster]...    47   0.001
gi|135912|sp|P25723|TLD_DROME Dorsal-ventral patterning tolloid ...    47   0.001
gi|50418093|gb|AAH77648.1| Unknown (protein for MGC:86525) [Xeno...    47   0.001
gi|31213165|ref|XP_315526.1| ENSANGP00000021200 [Anopheles gambi...    47   0.001
gi|7716870|gb|AAF68585.1| tolloid [Drosophila simulans]                47   0.001
gi|7716880|gb|AAF68590.1| tolloid [Drosophila simulans]                47   0.001
gi|7716872|gb|AAF68586.1| tolloid [Drosophila simulans]                47   0.001
gi|7716882|gb|AAF68591.1| tolloid [Drosophila simulans]                47   0.001
gi|7716878|gb|AAF68589.1| tolloid [Drosophila simulans]                47   0.001
gi|7716874|gb|AAF68587.1| tolloid [Drosophila simulans]                47   0.001
gi|7716876|gb|AAF68588.1| tolloid [Drosophila simulans]                47   0.001
gi|19424220|ref|NP_598234.1| Fc receptor, IgE, low affinity II, ...    46   0.002
gi|49522356|gb|AAH75353.1| Unknown (protein for MGC:89049) [Xeno...    46   0.002
gi|47225569|emb|CAG12052.1| unnamed protein product [Tetraodon n...    46   0.002
gi|19070849|gb|AAL84004.1| CD23 [Rattus norvegicus]                    46   0.002
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans]        46   0.002
gi|1589367|prf||2211228A enteropeptidase                               46   0.002
gi|34013702|gb|AAQ56014.1| lectin protein type III [Hippocampus ...    46   0.002
gi|48476186|gb|AAT44368.1| REJ1CRD2 [Allocentrotus fragilis]           46   0.002
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n...    46   0.002
gi|34871467|ref|XP_232753.2| similar to CUB and sushi multiple d...    46   0.002
gi|39596329|emb|CAE69967.1| Hypothetical protein CBG16363 [Caeno...    45   0.003
gi|19921688|ref|NP_610207.1| CG8343-PA [Drosophila melanogaster]...    45   0.003
gi|13431313|sp|Q9WU60|ATRN_MOUSE Attractin precursor (Mahogany p...    45   0.003
gi|47208253|emb|CAF93060.1| unnamed protein product [Tetraodon n...    45   0.003
gi|1478015|gb|AAB36402.1| ECLV IX/X-bp beta subunit=Ca(2+)-depen...    45   0.003
gi|48476190|gb|AAT44370.1| REJ1CRD2 [Hemicentrotus pulcherrimus]       45   0.003
gi|6753146|ref|NP_033860.1| attractin [Mus musculus] >gnl|BL_ORD...    45   0.003
gi|39583858|emb|CAE63948.1| Hypothetical protein CBG08530 [Caeno...    45   0.003
gi|38074445|ref|XP_140816.3| similar to cubilin; cubilin (intrin...    45   0.003
gi|26006173|dbj|BAC41429.1| mKIAA0548 protein [Mus musculus]           45   0.003
gi|31212883|ref|XP_312182.1| ENSANGP00000010271 [Anopheles gambi...    45   0.003
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus]        45   0.004
gi|18476520|gb|AAL58516.1| Fc epsilon receptor II subtype b vari...    45   0.004
gi|39581146|emb|CAE71003.1| Hypothetical protein CBG17839 [Caeno...    45   0.004
gi|18476522|gb|AAL58517.1| Fc epsilon receptor II subtype b vari...    45   0.004
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [...    45   0.004
gi|28628340|gb|AAO43607.1| serum lectin isoform 3 precursor [Sal...    45   0.004
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p...    45   0.004
gi|13236929|gb|AAB28791.2| low affinity IgE Fc receptor isoform ...    45   0.004
gi|13236930|gb|AAB28792.2| low affinity IgE Fc receptor isoform ...    45   0.004
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr...    45   0.004
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ...    45   0.004
gi|4585307|gb|AAD25372.1| attractin [Mus musculus]                     45   0.004
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ...    45   0.004
gi|211655|gb|AAA48720.1| proteoglycan core protein                     45   0.004
gi|16769722|gb|AAL29080.1| LP01328p [Drosophila melanogaster]          45   0.004
gi|560482|emb|CAA45532.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m...    45   0.004
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi...    45   0.004
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote...    45   0.004
gi|560484|emb|CAA45533.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m...    45   0.004
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID...    45   0.004
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ...    45   0.004
gi|24582396|ref|NP_609091.2| CG9138-PA [Drosophila melanogaster]...    45   0.004
gi|13236931|gb|AAB28793.2| low affinity IgE Fc receptor isoform ...    45   0.004
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|...    45   0.004
gi|833853|gb|AAA67565.1| versican V2 core protein precursor            45   0.004
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens]        45   0.004
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens]        45   0.004
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ...    45   0.004
gi|47208122|emb|CAF91040.1| unnamed protein product [Tetraodon n...    45   0.004
gi|7305051|ref|NP_038545.1| Fc receptor, IgE, low affinity II, a...    45   0.004
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [...    45   0.004
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus]     45   0.005
gi|7512084|pir||S71352 metalloproteinase (EC 3.4.24.-) 10 precur...    45   0.005
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor...    45   0.005
gi|47230594|emb|CAF99787.1| unnamed protein product [Tetraodon n...    45   0.005
gi|7512178|pir||T30337 polyprotein - African clawed frog >gnl|BL...    45   0.005
gi|26000685|gb|AAN75192.1| C-type lectin [Carassius auratus]           45   0.005
gi|33341214|gb|AAQ15168.1| stejaggregin-A beta chain-2 [Trimeres...    44   0.006
gi|7188780|gb|AAF37867.1| exoskeleton protein RP43 [Riftia pachy...    44   0.006
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr...    44   0.006
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal...    44   0.006
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal...    44   0.006
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal...    44   0.006
gi|2497645|sp|Q28768|LEM1_PAPHA L-selectin precursor (Lymph node...    44   0.006
gi|2497643|sp|Q95198|LEM1_MACMU L-selectin precursor (Lymph node...    44   0.006
gi|26349637|dbj|BAC38458.1| unnamed protein product [Mus musculus]     44   0.006
gi|38078818|ref|XP_355523.1| similar to CUB and sushi multiple d...    44   0.006
gi|19401623|gb|AAL87637.1| CD69 [Rattus norvegicus]                    44   0.006
gi|47551233|ref|NP_999801.1| receptor for egg jelly 3 [Strongylo...    44   0.006
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus]                 44   0.008
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B...    44   0.008
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic...    44   0.008
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (...    44   0.008
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr...    44   0.008
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus]                       44   0.008
gi|181168|gb|AAA35726.1| proteoglycan core protein                     44   0.008
gi|34856500|ref|XP_230054.2| similar to eosinophil major basic p...    44   0.008
gi|34364726|emb|CAE45808.1| hypothetical protein [Homo sapiens]        44   0.008
gi|14042814|dbj|BAB55404.1| unnamed protein product [Homo sapiens]     44   0.008
gi|50659098|ref|NP_056245.2| regeneration associated muscle prot...    44   0.008
gi|50659100|ref|NP_001001991.1| regeneration associated muscle p...    44   0.008
gi|50752188|ref|XP_426680.1| PREDICTED: similar to procollagen C...    44   0.008
gi|11993941|ref|NP_032437.2| CUB and zona pellucida-like domains...    44   0.008
gi|13898378|gb|AAK48711.1| E-selectin [Ovis aries]                     44   0.010
gi|22095011|ref|NP_083896.1| procollagen C-endopeptidase enhance...    44   0.010
gi|19070657|gb|AAL83947.1| procollagen COOH-terminal proteinase ...    44   0.010
gi|41080624|gb|AAR99506.1| soluble neuropilin 1b [Danio rerio]         44   0.010
gi|38146361|gb|AAR11553.1| neuropilin 1b [Danio rerio]                 44   0.010
gi|40748260|gb|AAR89616.1| neuropilin 1b [Danio rerio]                 44   0.010
gi|45387759|ref|NP_991237.1| neuropilin 1 b; neuropilin 1b [Dani...    44   0.010
gi|47204841|emb|CAF88849.1| unnamed protein product [Tetraodon n...    44   0.010
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec...    44   0.010
gi|32264366|gb|AAP78681.1| MBCTL2 [Monosiga brevicollis]               44   0.010
gi|33341216|gb|AAQ15169.1| stejaggregin-A beta chain-3 [Trimeres...    43   0.014
gi|1168684|sp|P42674|BP10_PARLI Blastula protease-10 precursor >...    43   0.014
gi|33341196|gb|AAQ15159.1| stejaggregin-B beta chain-2 [Trimeres...    43   0.014
gi|47219400|emb|CAG01563.1| unnamed protein product [Tetraodon n...    43   0.014
gi|34866475|ref|XP_235273.2| similar to CUB and sushi multiple d...    43   0.014
gi|32264364|gb|AAP78680.1| MBCTL1 [Monosiga brevicollis]               43   0.014
gi|26332511|dbj|BAC29973.1| unnamed protein product [Mus musculus]     43   0.014
gi|48476194|gb|AAT44372.1| REJ1CRD2 [Strongylocentrotus droebach...    43   0.014
gi|6679489|ref|NP_032967.1| protease, serine, 7 (enterokinase); ...    43   0.014
gi|18157520|dbj|BAB83835.1| supported by GENSCAN and partially h...    43   0.014
gi|7674107|sp|Q9YGP1|LECG_TRIST Galactose-binding lectin precurs...    43   0.014
gi|7804476|dbj|BAA95671.1| C-type lectin [Cyprinus carpio]             43   0.014
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA...    43   0.014
gi|39586117|emb|CAE69193.1| Hypothetical protein CBG15230 [Caeno...    43   0.014
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr...    43   0.014
gi|30578425|ref|NP_849186.1| protease, serine, 7 (enterokinase);...    43   0.014
gi|13786196|ref|NP_112641.1| attractin [Rattus norvegicus] >gnl|...    43   0.018
gi|33341194|gb|AAQ15158.1| stejaggregin-B beta chain-1 [Trimeres...    43   0.018
gi|47223073|emb|CAG07160.1| unnamed protein product [Tetraodon n...    43   0.018
gi|3023231|sp|P81113|ABA3_TRIAB Alboaggregin A subunit 3               43   0.018
gi|10432394|emb|CAC10284.1| dJ947L8.1.7 (novel CUB domain protei...    43   0.018
gi|47220817|emb|CAG00024.1| unnamed protein product [Tetraodon n...    43   0.018
gi|12275312|dbj|BAB21018.1| attractin [Rattus norvegicus]              43   0.018
gi|47217067|emb|CAG02378.1| unnamed protein product [Tetraodon n...    42   0.023
gi|85534|pir||JH0626 antifreeze protein II precursor - rainbow s...    42   0.023
gi|47216046|emb|CAG11377.1| unnamed protein product [Tetraodon n...    42   0.023
gi|31879371|dbj|BAC77707.1| EMS16 B chain [Echis multisquamatus]       42   0.023
gi|34858510|ref|XP_232418.2| CD69 antigen [Rattus norvegicus]          42   0.023
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb...    42   0.023
gi|85699|pir||JQ0948 A5 antigen precursor - African clawed frog ...    42   0.023
gi|47208698|emb|CAF89942.1| unnamed protein product [Tetraodon n...    42   0.023
gi|112932|sp|P28824|NRP1_XENLA Neuropilin-1 precursor (A5 protei...    42   0.023
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_...    42   0.023
gi|47213476|emb|CAF91133.1| unnamed protein product [Tetraodon n...    42   0.023
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno...    42   0.023
gi|47225069|emb|CAF97484.1| unnamed protein product [Tetraodon n...    42   0.023
gi|7705290|ref|NP_036635.1| asialoglycoprotein receptor 1 (hepat...    42   0.030
gi|4456459|emb|CAB37431.1| hypothetical protein [Homo sapiens]         42   0.030
gi|37181935|gb|AAQ88771.1| SEZ6L [Homo sapiens]                        42   0.030
gi|202988|gb|AAA40764.1| asialoglycoprotein receptor                   42   0.030
gi|32261332|ref|NP_066938.2| seizure related 6 homolog (mouse)-l...    42   0.030
gi|6941612|emb|CAB72345.1| dJ268D13.1.1 (shares domains with BMP...    42   0.030
gi|6941614|emb|CAB72347.1| dJ268D13.1.3 (shares domains with BMP...    42   0.030
gi|4886439|emb|CAB43355.1| hypothetical protein [Homo sapiens]         42   0.030
gi|14133225|dbj|BAA76771.2| KIAA0927 protein [Homo sapiens]            42   0.030
gi|6729952|pdb|2AFP|A Chain A, The Solution Structure Of Type Ii...    42   0.030
gi|47678679|emb|CAG30460.1| SEZ6L [Homo sapiens]                       42   0.030
gi|47225543|emb|CAG12026.1| unnamed protein product [Tetraodon n...    42   0.030
gi|6941613|emb|CAB72346.1| dJ268D13.1.2 (shares domains with BMP...    42   0.030
gi|113926|sp|P05140|ANP_HEMAM Type II antifreeze protein precurs...    42   0.030
gi|213876|gb|AAA49618.1| antifreeze protein                            42   0.030
gi|47211657|emb|CAF94910.1| unnamed protein product [Tetraodon n...    42   0.030
gi|213874|gb|AAA49617.1| antifreeze polypeptide (AFP) precursor        42   0.030
gi|20562941|gb|AAM22788.1| C-type lectin [Deinagkistrodon acutus]      42   0.030
gi|20562939|gb|AAM22787.1| C-type lectin [Deinagkistrodon acutus...    42   0.039
gi|27372091|gb|AAN87893.1| LECAM-1 [Sigmodon hispidus]                 42   0.039
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo...    42   0.039
gi|25148729|ref|NP_503500.2| asialoglycoprotein receptor family ...    42   0.039
gi|39588559|emb|CAE58082.1| Hypothetical protein CBG01163 [Caeno...    42   0.039
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno...    41   0.051
gi|399040|sp|Q01758|ANP_OSMMO Type II antifreeze protein precurs...    41   0.051
gi|6679221|ref|NP_032814.1| procollagen C-proteinase enhancer pr...    41   0.051
gi|13899255|ref|NP_113621.1| membrane frizzled-related protein; ...    41   0.051
gi|2134176|pir||I51569 UVS.2 protein - African clawed frog (frag...    41   0.051
gi|6707084|gb|AAF25588.1| low-affinity IgE receptor [Bos taurus]       41   0.051
gi|2828509|sp|P42664|UVS2_XENLA Embryonic protein UVS.2 precurso...    41   0.051
gi|16930101|dbj|BAB72012.1| attractin [Mesocricetus auratus]           41   0.051
gi|46048318|ref|NP_705726.2| C lectin-related protein A [Mus mus...    41   0.051
gi|3913579|sp|P81448|EMBP_CRIGR Eosinophil granule major basic p...    41   0.051
gi|15826254|pdb|1H8U|A Chain A, Crystal Structure Of The Eosinop...    41   0.051
gi|400414|emb|CAA81207.1| eosinophil granule major basic pre-pro...    41   0.051
gi|187415|gb|AAA36203.1| major basic protein precursor                 41   0.051
gi|119239|sp|P13727|EMBP_HUMAN Eosinophil granule major basic pr...    41   0.051
gi|37619835|emb|CAB01145.2| Hypothetical protein F08H9.8 [Caenor...    41   0.051
gi|2146997|pir||JC4892 L-selectin precursor - rabbit >gnl|BL_ORD...    41   0.051
gi|34863203|ref|XP_236179.2| similar to membrane-type frizzled-r...    41   0.051
gi|9506953|ref|NP_062110.1| procollagen C-proteinase enhancer pr...    41   0.051
gi|6919942|sp|Q61398|PCO1_MOUSE Procollagen C-proteinase enhance...    41   0.051
gi|27901801|ref|NP_776607.1| selectin L [lymphocyte adhesion mol...    41   0.067
gi|1091923|prf||2022211A asialoglycoprotein receptor                   41   0.067
gi|16549794|dbj|BAB70859.1| unnamed protein product [Homo sapiens]     41   0.067
gi|38078816|ref|XP_131674.2| similar to CUB and Sushi multiple d...    41   0.067
gi|3108091|gb|AAC15766.1| neurocan [Rattus norvegicus]                 41   0.067
gi|2073142|dbj|BAA19861.1| Incilarin A [Incilaria fruhstorferi]        41   0.067
gi|33341184|gb|AAQ15153.1| factor IX/X binding protein alpha cha...    41   0.067
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh...    41   0.067
gi|10432398|emb|CAC10288.1| dJ947L8.1.3 (novel CUB domain protei...    41   0.067
gi|38493056|pdb|1UKM|B Chain B, Crystal Structure Of Ems16, An A...    41   0.067
gi|31377817|ref|NP_852474.1| neuropilin 1 a [Danio rerio] >gnl|B...    41   0.067
gi|27372291|dbj|BAC53657.1| neuropilin-1 [Danio rerio]                 41   0.067
gi|38146359|gb|AAR11552.1| neuropilin 1a [Danio rerio]                 41   0.067
gi|18777739|ref|NP_570975.1| Cd209e antigen [Mus musculus] >gnl|...    41   0.067
gi|47223422|emb|CAG04283.1| unnamed protein product [Tetraodon n...    41   0.067
gi|6753126|ref|NP_033844.1| asialoglycoprotein receptor 1 [Mus m...    40   0.088
gi|3041697|sp|P34927|LECH_MOUSE Asialoglycoprotein receptor 1 (H...    40   0.088
gi|4469126|emb|CAB38429.1| lipopolysaccharide binding protein [B...    40   0.088
gi|6755454|ref|NP_035476.1| selectin, lymphocyte [Mus musculus] ...    40   0.088
gi|4502681|ref|NP_001772.1| CD69 antigen (p60, early T-cell acti...    40   0.088
gi|6919941|sp|Q15113|PCO1_HUMAN Procollagen C-proteinase enhance...    40   0.088


>gi|17506483|ref|NP_493152.1| c-type lectin and CUB domain containing
            protein family member (45.8 kD) (1N22) [Caenorhabditis
            elegans]
 gi|7498352|pir||T20448 hypothetical protein E03H4.10 - Caenorhabditis
            elegans
 gi|3875497|emb|CAB04034.1| Hypothetical protein E03H4.10
            [Caenorhabditis elegans]
          Length = 416

 Score =  830 bits (2145), Expect = 0.0
 Identities = 405/416 (97%), Positives = 405/416 (97%)
 Frame = -1

Query: 1251 MQLRFALLLLIICFKACLNSPLICTNGFTLLNKKCLKLFDTKVNHTSAESSCNSFGATLV 1072
            MQLRFALLLLIICFKACLNSPLICTNGFTLLNKKCLKLFDTKVNHTSAESSCNSFGATLV
Sbjct: 1    MQLRFALLLLIICFKACLNSPLICTNGFTLLNKKCLKLFDTKVNHTSAESSCNSFGATLV 60

Query: 1071 TVKNVNDEQAIATVVAASSARLIWLGLYCFDSDPAKCLWDDNSGSAQSYDNFSIDFPLVD 892
            TVKNVNDEQAIATVVAASSARLIWLGLYCFDSDPAKCLWDDNSGSAQSYDNFSIDFPLVD
Sbjct: 61   TVKNVNDEQAIATVVAASSARLIWLGLYCFDSDPAKCLWDDNSGSAQSYDNFSIDFPLVD 120

Query: 891  AGHCVYLSTLGALAGKWISEDCESKLMSYICELPTTHADDCTYNYNGYCYTFSSTAEPFI 712
            AGHCVYLSTLGALAGKWISEDCESKLMSYICELPTTHADDCTYNYNGYCYTFSSTAEPFI
Sbjct: 121  AGHCVYLSTLGALAGKWISEDCESKLMSYICELPTTHADDCTYNYNGYCYTFSSTAEPFI 180

Query: 711  IAQTKCAETYGDLVSIHSSNENRYIETFAAQDYYLIGAVWKLDNSLYWLDKSKWDYNNTD 532
            IAQTKCAETYGDLVSIHSSNENRYIETFAAQDYYLIGAVWKLDNSLYWLDKSKWDYNNTD
Sbjct: 181  IAQTKCAETYGDLVSIHSSNENRYIETFAAQDYYLIGAVWKLDNSLYWLDKSKWDYNNTD 240

Query: 531  PENSYRGDYCVAMSTVISSPIPSGFWFSTNCTRPAKYICKRPAGVQSTTASPVTVAPSPA 352
            PENSYRGDYCVAMSTVISSPIPSGFWFSTNCTRPAKYICKRPAGVQSTTASPVTVAPSPA
Sbjct: 241  PENSYRGDYCVAMSTVISSPIPSGFWFSTNCTRPAKYICKRPAGVQSTTASPVTVAPSPA 300

Query: 351  NPSNCNAGLLMSPGVITSXXXXXXXXXXXNCTYQLSTLGAYKIALRFASFSTEANDVVTV 172
            NPSNCNAGLLMSPGVITS           NCTYQLSTLGAYKIALRFASFSTEANDVVTV
Sbjct: 301  NPSNCNAGLLMSPGVITSPNYPENYFNNENCTYQLSTLGAYKIALRFASFSTEANDVVTV 360

Query: 171  YDGLTTDSPCLRRCSGTQRPFALTSSGNTMLVTFTSDSKGISSGFYARFSSIVYRR 4
            YDGLTTDSPCLRRCSGTQRPFALTSSGNTMLVTFTSDSKGISSGFYARFSSIVYRR
Sbjct: 361  YDGLTTDSPCLRRCSGTQRPFALTSSGNTMLVTFTSDSKGISSGFYARFSSIVYRR 416




[DB home][top]