Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= EEED8_2
(591 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532819|ref|NP_495014.1| serine/aRginine rich pre-mRNA SPlic... 180 2e-44
gi|17532817|ref|NP_495013.1| serine/aRginine rich pre-mRNA SPlic... 180 2e-44
gi|39596864|emb|CAE59091.1| Hypothetical protein CBG02383 [Caeno... 178 8e-44
gi|48135454|ref|XP_393352.1| similar to ENSANGP00000010223 [Apis... 128 7e-29
gi|21358099|ref|NP_652612.1| CG5442-PB [Drosophila melanogaster]... 127 1e-28
gi|31233152|ref|XP_318826.1| ENSANGP00000010223 [Anopheles gambi... 127 2e-28
gi|47087067|ref|NP_998547.1| zgc:56283 [Danio rerio] >gnl|BL_ORD... 126 3e-28
gi|41946787|gb|AAH65971.1| Unknown (protein for MGC:77420) [Dani... 125 4e-28
gi|41054475|ref|NP_955945.1| splicing factor, arginine/serine-ri... 125 4e-28
gi|26345390|dbj|BAC36346.1| unnamed protein product [Mus musculus] 125 6e-28
gi|1405747|emb|CAA67134.1| PR264/SC35 [Mus musculus] 125 6e-28
gi|47604918|ref|NP_001001305.1| arginine/serine-rich2 splicing f... 125 6e-28
gi|6755478|ref|NP_035488.1| splicing factor, arginine/serine-ric... 125 6e-28
gi|28175397|gb|AAH45229.1| Sfrs2-prov protein [Xenopus laevis] 125 8e-28
gi|45361503|ref|NP_989328.1| hypothetical protein MGC75633 [Xeno... 125 8e-28
gi|21751099|dbj|BAC03903.1| unnamed protein product [Homo sapiens] 122 4e-27
gi|266992|sp|Q01130|SFR2_HUMAN Splicing factor, arginine/serine-... 122 5e-27
gi|9837439|gb|AAG00575.1| splicing factor arginine/serine rich 2... 116 3e-25
gi|34784708|gb|AAH57783.1| SRP46 protein [Homo sapiens] 108 1e-22
gi|15055543|ref|NP_115285.1| Splicing factor, arginine/serine-ri... 108 1e-22
gi|21752539|dbj|BAC04206.1| unnamed protein product [Homo sapiens] 106 4e-22
gi|44890463|gb|AAH66958.1| SFRS2 protein [Homo sapiens] 106 4e-22
gi|3892187|gb|AAC78303.1| RNA-binding protein [Schistosoma japon... 103 2e-21
gi|41147872|ref|XP_374607.1| similar to Splicing factor, arginin... 102 7e-21
gi|42659784|ref|XP_372429.2| similar to FLJ10251 protein [Homo s... 102 7e-21
gi|14141216|gb|AAK54351.1| SRp46 splicing factor [Homo sapiens] 102 7e-21
gi|29735276|ref|XP_294247.1| similar to Splicing factor, arginin... 102 7e-21
gi|33146621|dbj|BAC79909.1| putative splicing factor, arginine/s... 87 3e-16
gi|42408182|dbj|BAD09319.1| putative splicing factor, arginine/s... 85 9e-16
gi|7446336|pir||T09704 probable arginine/serine-rich splicing fa... 84 1e-15
gi|9843653|emb|CAC03600.1| splicing factor SC35 [Arabidopsis tha... 84 3e-15
gi|15237641|ref|NP_201225.1| arginine/serine-rich splicing facto... 84 3e-15
gi|46229752|gb|EAK90570.1| splicing factor RRM domain containing... 84 3e-15
gi|423485|pir||A46241 interferon response element-binding factor... 80 3e-14
gi|23489341|gb|EAA21552.1| dentin phosphoryn [Plasmodium yoelii ... 79 8e-14
gi|50582745|gb|AAT78815.1| putative splicing factor (having alte... 79 8e-14
gi|41151621|ref|XP_373341.1| similar to PR264/SC35 [Homo sapiens] 77 2e-13
gi|27734114|ref|NP_775611.1| hypothetical protein 4930595M18 [Mu... 76 5e-13
gi|41055271|ref|NP_956827.1| hypothetical protein MGC65772 [Dani... 76 5e-13
gi|34880632|ref|XP_229063.2| similar to hypothetical protein 493... 75 1e-12
gi|34867118|ref|XP_216364.2| similar to SRrp35 [Rattus norvegicus] 74 2e-12
gi|23613056|ref|NP_703378.1| Ser/Arg-rich splicing factor, putat... 74 2e-12
gi|47606193|sp|Q8WXF0|SR35_HUMAN 35 kDa SR repressor protein (SR... 73 3e-12
gi|30687014|ref|NP_197382.3| SC35-like splicing factor, 28 kD (S... 73 3e-12
gi|26452521|dbj|BAC43345.1| putative Serine/arginine rich protei... 73 3e-12
gi|23508470|ref|NP_701139.1| hypothetical protein [Plasmodium fa... 73 4e-12
gi|31249706|gb|AAP46199.1| putative splicing factor [Oryza sativ... 73 4e-12
gi|33146902|dbj|BAC79901.1| putative SC35-like splicing factor S... 73 4e-12
gi|9843661|emb|CAC03604.1| SC35-like splicing factor SCL30a, 30a... 73 4e-12
gi|15231285|ref|NP_187966.1| SC35-like splicing factor, 30a kD (... 73 4e-12
gi|34913294|ref|NP_917994.1| putative serine/arginine-rich prote... 73 4e-12
gi|47209886|emb|CAF94406.1| unnamed protein product [Tetraodon n... 72 6e-12
gi|15293081|gb|AAK93651.1| unknown protein [Arabidopsis thaliana] 72 8e-12
gi|50759902|ref|XP_417837.1| PREDICTED: similar to neural specif... 72 8e-12
gi|5730079|ref|NP_006616.1| FUS interacting protein (serine-argi... 72 8e-12
gi|4001722|dbj|BAA35093.1| neural specific sr protein NSSR 2 [Mu... 72 8e-12
gi|11358835|pir||T50647 serine/arginine-rich protein [imported] ... 72 8e-12
gi|18405316|ref|NP_564685.1| SC35-like splicing factor, 33 kD (S... 72 8e-12
gi|22902265|gb|AAH37591.1| Fusip1 protein [Mus musculus] 72 8e-12
gi|16265859|gb|AAL16666.1| TLS-associated protein TASR-2 [Homo s... 72 8e-12
gi|16905517|ref|NP_473357.1| FUS interacting protein (serine-arg... 72 8e-12
gi|4001720|dbj|BAA35092.1| neural specific sr protein NSSR 1 [Mu... 72 8e-12
gi|14603220|gb|AAH10074.1| FUSIP1 protein [Homo sapiens] 72 8e-12
gi|32398853|emb|CAD98563.1| splicing factor, possible [Cryptospo... 70 2e-11
gi|46229295|gb|EAK90144.1| RRM domain containing protein; T22E16... 70 2e-11
gi|21361783|ref|NP_542781.2| serine-arginine repressor protein (... 70 2e-11
gi|9843655|emb|CAC03601.1| SC35-like splicing factor SCL28, 28 k... 70 2e-11
gi|28302303|gb|AAH46695.1| MGC53149 protein [Xenopus laevis] 69 6e-11
gi|452936|gb|AAB28794.1| 60 kda non-pathogenic specific antigen ... 68 1e-10
gi|7428647|pir||S58472 lysine-rich surface antigen - Entamoeba h... 68 1e-10
gi|48123509|ref|XP_393252.1| similar to SD14970p [Apis mellifera] 67 2e-10
gi|45382747|ref|NP_990009.1| transformer-2 beta [Gallus gallus] ... 67 2e-10
gi|38076498|ref|XP_124054.2| similar to splicing factor, arginin... 67 3e-10
gi|21758154|dbj|BAC05256.1| unnamed protein product [Homo sapiens] 67 3e-10
gi|27881815|gb|AAH44695.1| LOC398448 protein [Xenopus laevis] 67 3e-10
gi|4377849|gb|AAD19278.1| transformer-2-beta isoform 3 [Homo sap... 67 3e-10
gi|4759098|ref|NP_004584.1| splicing factor, arginine/serine-ric... 67 3e-10
gi|49903569|gb|AAH77018.1| Unknown (protein for MGC:89770) [Xeno... 67 3e-10
gi|38086358|ref|XP_284704.2| similar to splicing factor, arginin... 66 5e-10
gi|49258180|gb|AAH72952.1| Unknown (protein for IMAGE:4930396) [... 66 5e-10
gi|47229936|emb|CAG10350.1| unnamed protein product [Tetraodon n... 66 5e-10
gi|41055184|ref|NP_957491.1| similar to splicing factor, arginin... 65 7e-10
gi|20975278|dbj|BAB92956.1| cold inducible RNA-binding protein b... 65 9e-10
gi|20975276|dbj|BAB92955.1| cold inducible RNA-binding protein a... 65 9e-10
gi|41055454|ref|NP_956710.1| hypothetical protein MGC64175 [Dani... 65 1e-09
gi|9843657|emb|CAC03602.1| SC35-like splicing factor SCL30, 30 k... 65 1e-09
gi|45544646|ref|NP_956311.1| cold inducible RNA binding protein ... 65 1e-09
gi|34906972|ref|NP_914833.1| putative glycine-rich RNA-binding p... 65 1e-09
gi|49204538|dbj|BAD24701.1| transformer-2b2 [Oryzias latipes] 64 2e-09
gi|49204567|dbj|BAD24706.1| transformer-2b7 [Oryzias latipes] 64 2e-09
gi|49204555|dbj|BAD24704.1| transformer-2b5 [Oryzias latipes] 64 2e-09
gi|49204551|dbj|BAD24703.1| transformer-2b4 [Oryzias latipes] 64 2e-09
gi|22022315|dbj|BAC06514.1| transformer-2b [Oryzias latipes] 64 2e-09
gi|11358671|pir||T47685 probable RNA binding protein - Arabidops... 64 2e-09
gi|18410283|ref|NP_567021.1| SC35-like splicing factor, 30 kD (S... 64 2e-09
gi|49204543|dbj|BAD24702.1| transformer-2b3 [Oryzias latipes] 64 2e-09
gi|49204563|dbj|BAD24705.1| transformer-2b6 [Oryzias latipes] 64 2e-09
gi|2129944|pir||JC4817 RNA-binding protein RZ-1 - wood tobacco >... 64 3e-09
gi|11761319|dbj|BAB19129.1| cold-inducible RNA binding protein 2... 63 4e-09
gi|9558733|ref|NP_037425.1| transformer-2 alpha; htra-2 alpha; p... 63 4e-09
gi|50786879|ref|XP_423502.1| PREDICTED: similar to cold inducibl... 63 4e-09
gi|37674216|ref|NP_932770.1| RIKEN cDNA G430041M01 [Mus musculus... 63 4e-09
gi|34785785|gb|AAH57481.1| Cirbp protein [Danio rerio] 63 4e-09
gi|23479883|gb|EAA16595.1| PR264 [Plasmodium yoelii yoelii] 63 4e-09
gi|22022313|dbj|BAC06513.1| transformer-2a [Oryzias latipes] >gn... 63 5e-09
gi|46139099|ref|XP_391240.1| hypothetical protein FG11064.1 [Gib... 63 5e-09
gi|3342756|gb|AAC41383.1| RNA-binding protein AxRNBP [Ambystoma ... 63 5e-09
gi|22328599|ref|NP_193122.2| glycine-rich RNA-binding protein, p... 63 5e-09
gi|30585341|gb|AAP36943.1| Homo sapiens cold inducible RNA bindi... 63 5e-09
gi|4502847|ref|NP_001271.1| cold inducible RNA binding protein; ... 63 5e-09
gi|49204524|dbj|BAD24698.1| transformer-2a2 [Oryzias latipes] >g... 63 5e-09
gi|18482476|gb|AAL68857.1| transformer-2 beta [Macaca mulatta] 62 6e-09
gi|24214620|ref|NP_712101.1| RNA-binding protein [Leptospira int... 62 8e-09
gi|15231311|ref|NP_190188.1| RNA-binding protein, putative [Arab... 62 8e-09
gi|47271546|ref|NP_112409.2| cold inducible RNA-binding protein ... 62 8e-09
gi|6680946|ref|NP_031731.1| cold inducible RNA binding protein; ... 62 8e-09
gi|47497118|dbj|BAD19168.1| putative pre-mRNA splicing factor [O... 62 1e-08
gi|12002297|gb|AAG43284.1| unknown [Oryza sativa] 62 1e-08
gi|27735413|gb|AAH41204.1| Cirbp-prov protein [Xenopus laevis] 61 1e-08
gi|6682989|dbj|BAA88978.1| BFCIRP [Rana catesbeiana] 61 1e-08
gi|5921787|sp|O93235|CIRP_XENLA Cold-inducible RNA-binding prote... 61 1e-08
gi|34878113|ref|XP_212748.2| similar to splicing factor, arginin... 61 1e-08
gi|9964085|gb|AAG09816.1| cold-inducible RNA binding protein XCI... 61 2e-08
gi|32476441|ref|NP_869435.1| RNA-binding protein [Pirellula sp. ... 61 2e-08
gi|49118619|gb|AAH73641.1| Unknown (protein for MGC:82977) [Xeno... 60 2e-08
gi|32352198|dbj|BAC78592.1| pre-mRNA splicing factor [Oryza sati... 60 2e-08
gi|50732688|ref|XP_418717.1| PREDICTED: similar to RIKEN cDNA G4... 60 2e-08
gi|22298986|ref|NP_682233.1| RNA binding protein [Thermosynechoc... 60 2e-08
gi|23125104|ref|ZP_00107052.1| COG0724: RNA-binding proteins (RR... 60 3e-08
gi|40714682|gb|AAR88588.1| putative RNA binding protein [Oryza s... 60 3e-08
gi|41054740|ref|NP_957426.1| similar to TIA1 cytotoxic granule-a... 60 4e-08
gi|27924195|gb|AAH44990.1| Tra2a-prov protein [Xenopus laevis] 60 4e-08
gi|30692256|ref|NP_849524.1| glycine-rich RNA-binding protein 8 ... 60 4e-08
gi|15235002|ref|NP_195637.1| glycine-rich RNA-binding protein 8 ... 60 4e-08
gi|15239676|ref|NP_200269.1| RNA recognition motif (RRM)-contain... 60 4e-08
gi|30692254|ref|NP_849523.1| glycine-rich RNA-binding protein 8 ... 60 4e-08
gi|15231912|ref|NP_187457.1| RNA-binding protein, putative [Arab... 59 5e-08
gi|23507832|ref|NP_700502.1| hypothetical protein, conserved [Pl... 59 5e-08
gi|15219486|ref|NP_177494.1| RNA recognition motif (RRM)-contain... 59 5e-08
gi|49671136|gb|AAH75189.1| Unknown (protein for MGC:82154) [Xeno... 59 5e-08
gi|15228279|ref|NP_187651.1| RNA recognition motif (RRM)-contain... 59 5e-08
gi|23481068|gb|EAA17458.1| putative splicing factor [Plasmodium ... 59 5e-08
gi|23619166|ref|NP_705128.1| splicing factor, putative [Plasmodi... 59 7e-08
gi|47086779|ref|NP_997793.1| TIA1 cytotoxic granule-associated R... 59 7e-08
gi|46115998|ref|XP_384017.1| hypothetical protein FG03841.1 [Gib... 59 7e-08
gi|7488314|pir||T05255 RNA-binding protein homolog F18A5.250 - A... 59 7e-08
gi|11863161|ref|NP_071320.1| TIA1 protein isoform 1; TIA1 cytoto... 59 9e-08
gi|16215602|emb|CAC95017.1| TIAR protein [Xenopus laevis] 59 9e-08
gi|49250512|gb|AAH74599.1| Unknown (protein for MGC:69468) [Xeno... 59 9e-08
gi|11863163|ref|NP_071505.1| TIA1 protein isoform 2; TIA1 cytoto... 59 9e-08
gi|6094480|sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 (RNA-binding p... 59 9e-08
gi|48894880|ref|ZP_00327989.1| COG0724: RNA-binding proteins (RR... 59 9e-08
gi|1666299|emb|CAA63557.1| RNA-binding protein [Anabaena variabi... 59 9e-08
gi|4507499|ref|NP_003243.1| TIA1 cytotoxic granule-associated RN... 58 1e-07
gi|14714709|gb|AAH10496.1| Tial1 protein [Mus musculus] 58 1e-07
gi|45383446|ref|NP_989687.1| TIA1 cytotoxic granule-associated R... 58 1e-07
gi|7439995|pir||T15047 RNA binding protein 3 - wood tobacco >gnl... 58 1e-07
gi|6678349|ref|NP_033409.1| Tial1 cytotoxic granule-associated R... 58 1e-07
gi|34859375|ref|XP_341938.1| similar to RNA binding protein TIAR... 58 1e-07
gi|16330189|ref|NP_440917.1| RNA-binding protein [Synechocystis ... 58 1e-07
gi|23475018|ref|ZP_00130308.1| COG0724: RNA-binding proteins (RR... 58 1e-07
gi|13435394|ref|NP_071728.1| TIA1 cytotoxic granule-associated R... 58 1e-07
gi|27924240|gb|AAH45086.1| Tia1 protein [Xenopus laevis] 58 1e-07
gi|15229825|ref|NP_190636.1| U1 small nuclear ribonucleoprotein ... 58 1e-07
gi|28173040|gb|AAO32675.1| hyperosmotic glycine rich protein [Sa... 58 1e-07
gi|337445|gb|AAA36573.1| ribonucleoprotein antigen 58 1e-07
gi|29568103|ref|NP_003080.2| U1 small nuclear ribonucleoprotein ... 58 1e-07
gi|26374708|dbj|BAB27701.2| unnamed protein product [Mus musculu... 58 1e-07
gi|13633918|sp|Q62376|RU17_MOUSE U1 small nuclear ribonucleoprot... 58 1e-07
gi|88959|pir||A25707 U1 snRNP 70K protein - human >gnl|BL_ORD_ID... 58 1e-07
gi|34856077|ref|XP_341858.1| similar to U1 small nuclear ribonuc... 58 1e-07
gi|602021|emb|CAA29961.1| unnamed protein product [Homo sapiens] 58 1e-07
gi|39996426|ref|NP_952377.1| RNA-binding protein [Geobacter sulf... 58 1e-07
gi|46446527|ref|YP_007892.1| probable nucleic acid-binding prote... 58 1e-07
gi|16198525|gb|AAH15944.1| TIA1 protein [Homo sapiens] 57 2e-07
gi|47228429|emb|CAG05249.1| unnamed protein product [Tetraodon n... 57 2e-07
gi|49097388|ref|XP_410154.1| hypothetical protein AN6017.2 [Aspe... 57 2e-07
gi|28883273|gb|AAO49720.1| TIA-1 [Gallus gallus] 57 2e-07
gi|7489099|pir||T16961 RNA-binding protein RGP-3 - wood tobacco ... 57 2e-07
gi|26390405|dbj|BAC25892.1| unnamed protein product [Mus musculus] 57 2e-07
gi|28386187|gb|AAH46812.1| Tia1 protein [Mus musculus] 57 2e-07
gi|6755783|ref|NP_035715.1| cytotoxic granule-associated RNA bin... 57 2e-07
gi|34856361|ref|XP_232139.2| similar to Tia1 protein [Rattus nor... 57 2e-07
gi|48894879|ref|ZP_00327988.1| COG0724: RNA-binding proteins (RR... 57 2e-07
gi|45525449|ref|ZP_00176683.1| COG0724: RNA-binding proteins (RR... 57 2e-07
gi|24216457|ref|NP_713938.1| RNA-binding protein [Leptospira int... 57 2e-07
gi|21672973|ref|NP_661038.1| RNA-binding protein [Chlorobium tep... 57 2e-07
gi|23271442|gb|AAH23813.1| Tia1 protein [Mus musculus] 57 2e-07
gi|15231350|ref|NP_187353.1| RNA recognition motif (RRM)-contain... 57 3e-07
gi|49071476|ref|XP_400027.1| hypothetical protein UM02412.1 [Ust... 57 3e-07
gi|21388662|dbj|BAC00787.1| glycine-rich RNA-binding protein [Ph... 57 3e-07
gi|15822703|gb|AAL07518.1| RNA-binding protein precursor [Nicoti... 57 3e-07
gi|45361397|ref|NP_989276.1| hypothetical protein MGC75625 [Xeno... 57 3e-07
gi|47217530|emb|CAG02457.1| unnamed protein product [Tetraodon n... 57 3e-07
gi|24661759|ref|NP_648337.1| CG3335-PA [Drosophila melanogaster]... 57 3e-07
gi|21064855|gb|AAM29657.1| SD14970p [Drosophila melanogaster] 57 3e-07
gi|17232175|ref|NP_488723.1| RNA-binding protein [Nostoc sp. PCC... 57 3e-07
gi|17508585|ref|NP_493022.1| small nucleic-acid-binding protein,... 57 3e-07
gi|2126566|pir||S58673 RNA-binding protein RbpC - Anabaena varia... 57 3e-07
gi|17508587|ref|NP_493023.1| small nucleic-acid-binding protein;... 57 3e-07
gi|45506488|ref|ZP_00158842.1| COG0724: RNA-binding proteins (RR... 57 3e-07
gi|13279134|gb|AAH04289.1| RBM19 protein [Homo sapiens] >gnl|BL_... 57 3e-07
gi|7705365|ref|NP_057280.1| RNA binding motif protein 19 [Homo s... 57 3e-07
gi|13124658|sp|Q9Y4C8|K682_HUMAN Probable RNA-binding protein KI... 57 3e-07
gi|49080620|ref|XP_403808.1| hypothetical protein UM06193.1 [Ust... 57 3e-07
gi|50725127|dbj|BAD33744.1| putative MADP-1 protein [Oryza sativ... 57 3e-07
gi|40788328|dbj|BAA31657.2| KIAA0682 protein [Homo sapiens] 57 3e-07
gi|48856822|ref|ZP_00310979.1| COG0724: RNA-binding proteins (RR... 57 3e-07
gi|22299798|ref|NP_683045.1| RNA-binding protein [Thermosynechoc... 57 3e-07
gi|49091330|ref|XP_407126.1| hypothetical protein AN2989.2 [Aspe... 57 3e-07
gi|48847034|ref|ZP_00301292.1| COG0724: RNA-binding proteins (RR... 57 3e-07
gi|544416|sp|Q05966|GR10_BRANA Glycine-rich RNA-binding protein ... 57 3e-07
gi|49084774|ref|XP_404558.1| hypothetical protein AN0421.2 [Aspe... 57 3e-07
gi|15236359|ref|NP_193121.1| glycine-rich RNA-binding protein (G... 56 4e-07
gi|30682622|ref|NP_849377.1| glycine-rich RNA-binding protein (G... 56 4e-07
gi|50417136|gb|AAH77089.1| Unknown (protein for IMAGE:7147833) [... 56 4e-07
gi|7439981|pir||S71779 glycine-rich RNA-binding protein GRP1 - w... 56 4e-07
gi|37681959|gb|AAQ97857.1| TIA1 cytotoxic granule-associated RNA... 56 4e-07
gi|50545625|ref|XP_500351.1| hypothetical protein [Yarrowia lipo... 56 4e-07
gi|2826811|emb|CAA05727.1| AtGRP2 [Arabidopsis thaliana] 56 4e-07
gi|49619089|gb|AAT68129.1| U1 small ribonucleoprotein 70kd [Dani... 56 4e-07
gi|322514|pir||S31443 glycine-rich RNA-binding protein (clone A8... 56 4e-07
gi|17228236|ref|NP_484784.1| RNA-binding protein [Nostoc sp. PCC... 56 4e-07
gi|12659074|gb|AAK01176.1| RNA-binding protein [Triticum aestivum] 56 4e-07
gi|19115334|ref|NP_594422.1| putative splicing factor [Schizosac... 56 6e-07
gi|47222076|emb|CAG12102.1| unnamed protein product [Tetraodon n... 56 6e-07
gi|9757907|dbj|BAB08354.1| unnamed protein product [Arabidopsis ... 56 6e-07
gi|47497762|dbj|BAD19862.1| putative initiation factor 3g [Oryza... 56 6e-07
gi|12835985|dbj|BAB23448.1| unnamed protein product [Mus musculus] 55 7e-07
gi|49099895|ref|XP_410813.1| hypothetical protein AN6676.2 [Aspe... 55 7e-07
gi|16215606|emb|CAC95018.1| TIA-1 protein [Xenopus laevis] 55 7e-07
gi|30583983|gb|AAP36240.1| Homo sapiens eukaryotic translation i... 55 7e-07
gi|15822705|gb|AAL07519.1| RNA-binding protein precursor [Solanu... 55 7e-07
gi|26343509|dbj|BAC35411.1| unnamed protein product [Mus musculus] 55 7e-07
gi|50416510|gb|AAH77169.1| Unknown (protein for MGC:78766) [Xeno... 55 7e-07
gi|49670432|gb|AAH75190.1| Unknown (protein for MGC:83369) [Xeno... 55 7e-07
gi|15231557|ref|NP_189273.1| glycine-rich RNA-binding protein [A... 55 7e-07
gi|15229525|ref|NP_189025.1| glycine-rich RNA-binding protein, p... 55 7e-07
gi|21553972|gb|AAM63053.1| glycine-rich RNA binding protein, put... 55 7e-07
gi|30794154|ref|NP_083038.1| RIKEN cDNA 1200009A02 [Mus musculus... 55 7e-07
gi|21483526|gb|AAM52738.1| RE25373p [Drosophila melanogaster] 55 7e-07
gi|18415425|ref|NP_567594.1| RNA recognition motif (RRM)-contain... 55 7e-07
gi|4097873|gb|AAD00176.1| eIF3-p44 [Mus musculus] 55 7e-07
gi|49472822|ref|NP_003746.2| eukaryotic translation initiation f... 55 7e-07
gi|48146385|emb|CAG33415.1| EIF3S4 [Homo sapiens] 55 7e-07
gi|31980808|ref|NP_058572.2| eukaryotic translation initiation f... 55 7e-07
gi|39580200|emb|CAE71707.1| Hypothetical protein CBG18684 [Caeno... 55 7e-07
gi|45524744|ref|ZP_00176010.1| COG0724: RNA-binding proteins (RR... 55 7e-07
gi|45528450|ref|ZP_00179649.1| COG0724: RNA-binding proteins (RR... 55 7e-07
gi|15639347|ref|NP_218796.1| RNA-binding protein, putative [Trep... 55 7e-07
gi|48893520|ref|ZP_00326756.1| COG0724: RNA-binding proteins (RR... 55 7e-07
gi|49619137|gb|AAT68153.1| eukaryotic translation initiation fac... 55 7e-07
gi|34872583|ref|XP_222200.2| similar to RIKEN cDNA 1200009A02 [R... 55 7e-07
gi|15982739|gb|AAL09710.1| AT3g26420/F20C19_14 [Arabidopsis thal... 55 7e-07
gi|46227164|gb|EAK88114.1| SPAC25G10.01-like RRM domain containi... 55 1e-06
gi|19112519|ref|NP_595727.1| eukaryotic translation initiation f... 55 1e-06
gi|1749496|dbj|BAA13806.1| similar to Saccharomyces cerevisiae n... 55 1e-06
gi|45872602|gb|AAH68194.1| Tial1 protein [Mus musculus] 55 1e-06
gi|41055734|ref|NP_956476.1| TIA1 cytotoxic granule-associated R... 55 1e-06
gi|2951777|dbj|BAA25105.1| translation initiation factor 3 [Schi... 55 1e-06
gi|38107608|gb|EAA53755.1| hypothetical protein MG09505.4 [Magna... 55 1e-06
gi|21554348|gb|AAM63455.1| unknown [Arabidopsis thaliana] 55 1e-06
gi|17231514|ref|NP_488062.1| RNA-binding protein [Nostoc sp. PCC... 55 1e-06
gi|50552081|ref|XP_503515.1| hypothetical protein [Yarrowia lipo... 55 1e-06
gi|134091|sp|P09406|RU17_XENLA U1 small nuclear ribonucleoprotei... 55 1e-06
gi|49114954|gb|AAH72812.1| Seb4-A-prov protein [Xenopus laevis] 55 1e-06
gi|46443655|gb|EAL02935.1| hypothetical protein CaO19.1646 [Cand... 55 1e-06
gi|46949206|gb|AAT07459.1| cap-binding protein [Mirabilis jalapa] 55 1e-06
gi|46436241|gb|EAK95607.1| hypothetical protein CaO19.8967 [Cand... 55 1e-06
gi|46436140|gb|EAK95508.1| hypothetical protein CaO19.1389 [Cand... 55 1e-06
gi|32399047|emb|CAD98287.1| RNA-binding domain protein [Cryptosp... 55 1e-06
gi|8920429|emb|CAB96420.1| hypothetical protein [Xenopus laevis]... 55 1e-06
gi|46443527|gb|EAL02808.1| hypothetical protein CaO19.9215 [Cand... 55 1e-06
gi|50733646|ref|XP_418935.1| PREDICTED: similar to Hypothetical ... 55 1e-06
gi|50256481|gb|EAL19206.1| hypothetical protein CNBH3050 [Crypto... 55 1e-06
gi|8895698|gb|AAF81070.1| RRM-containing protein SEB-4 [Xenopus ... 55 1e-06
gi|45360685|ref|NP_989016.1| hypothetical protein MGC75808 [Xeno... 55 1e-06
gi|15232729|ref|NP_190296.1| RNA recognition motif (RRM)-contain... 55 1e-06
gi|47220039|emb|CAG12187.1| unnamed protein product [Tetraodon n... 55 1e-06
gi|48142250|ref|XP_397316.1| similar to CG12357-PA [Apis mellifera] 54 2e-06
gi|49117866|gb|AAH72792.1| LOC398603 protein [Xenopus laevis] 54 2e-06
gi|31087962|gb|AAP42281.1| RRM-type RNA-binding protein XSEB4R [... 54 2e-06
gi|47225499|emb|CAG11982.1| unnamed protein product [Tetraodon n... 54 2e-06
gi|31206851|ref|XP_312392.1| ENSANGP00000012757 [Anopheles gambi... 54 2e-06
gi|24662231|ref|NP_729614.1| CG32062-PD [Drosophila melanogaster... 54 2e-06
gi|33589520|gb|AAQ22527.1| LD15974p [Drosophila melanogaster] 54 2e-06
gi|50256835|gb|EAL19553.1| hypothetical protein CNBG1820 [Crypto... 54 2e-06
gi|24664592|ref|NP_648764.1| CG7804-PA [Drosophila melanogaster]... 54 2e-06
gi|17531965|ref|NP_495121.1| tia-1 family member (45.2 kD) (2G2)... 54 2e-06
gi|50552784|ref|XP_503802.1| hypothetical protein [Yarrowia lipo... 54 2e-06
gi|47211119|emb|CAF95305.1| unnamed protein product [Tetraodon n... 54 2e-06
gi|32564506|ref|NP_871980.1| tia-1 (32.6 kD) (2G2) [Caenorhabdit... 54 2e-06
gi|32564504|ref|NP_495123.2| RNA-binding region RNP-1 family mem... 54 2e-06
gi|30683419|ref|NP_563931.2| RNA recognition motif (RRM)-contain... 54 2e-06
gi|50546647|ref|XP_500793.1| hypothetical protein [Yarrowia lipo... 54 2e-06
gi|7446337|pir||T15542 hypothetical protein C18A3.5 - Caenorhabd... 54 2e-06
gi|24662235|ref|NP_729615.1| CG32062-PB [Drosophila melanogaster... 54 2e-06
gi|17531963|ref|NP_495120.1| RNA-binding region RNP-1 family mem... 54 2e-06
gi|17230269|ref|NP_486817.1| RNA binding protein [Nostoc sp. PCC... 54 2e-06
gi|21429720|gb|AAM50538.1| AT08247p [Drosophila melanogaster] 54 2e-06
gi|253181|gb|AAB22809.1| NSR1=nucleolin homolog [Saccharomyces c... 54 2e-06
gi|17647301|ref|NP_523773.1| CG4886-PA [Drosophila melanogaster]... 54 2e-06
gi|39591095|emb|CAE58875.1| Hypothetical protein CBG02108 [Caeno... 54 2e-06
gi|34897348|ref|NP_910020.1| putative small nuclear ribonucleopr... 54 2e-06
gi|481240|pir||S38382 SEB4D protein - human (fragment) 54 2e-06
gi|35902819|ref|NP_919356.1| RNA-binding region containing prote... 54 2e-06
gi|31216001|ref|XP_316146.1| ENSANGP00000020435 [Anopheles gambi... 54 2e-06
gi|21314767|ref|NP_149105.2| MADP-1 protein; U11/U12 snRNP 31K [... 54 2e-06
gi|1076731|pir||S53050 RNA binding protein - barley >gnl|BL_ORD_... 54 2e-06
gi|14211667|dbj|BAB56132.1| MADP-1 protein [Homo sapiens] >gnl|B... 54 2e-06
gi|49523027|gb|AAH75431.1| Unknown (protein for MGC:89204) [Xeno... 54 2e-06
gi|13560783|gb|AAK30205.1| poly(A)-binding protein [Daucus carota] 54 2e-06
gi|407421|emb|CAA53064.1| SEB4B [Homo sapiens] 54 2e-06
gi|49079182|ref|XP_403265.1| hypothetical protein UM05650.1 [Ust... 54 2e-06
gi|6321599|ref|NP_011675.1| Nucleolar protein that binds nuclear... 54 2e-06
gi|4704605|gb|AAD28176.1| glycine-rich RNA-binding protein [Pice... 54 2e-06
gi|34577107|ref|NP_059965.2| RNA-binding region containing prote... 54 2e-06
gi|50414059|ref|XP_457358.1| unnamed protein product [Debaryomyc... 54 2e-06
gi|407419|emb|CAA53063.1| SEB4D [Homo sapiens] 54 2e-06
gi|481241|pir||S38383 SEB4B protein - human (fragment) 54 2e-06
gi|33873902|gb|AAH10177.1| MADP-1 protein [Homo sapiens] 54 2e-06
gi|541310|pir||S41505 12RNP2 protein - Synechococcus sp. (PCC 63... 54 2e-06
gi|1086229|pir||S44023 RNA-binding protein - Chlorogloeopsis sp ... 54 2e-06
gi|45524039|ref|ZP_00175351.1| COG0724: RNA-binding proteins (RR... 54 2e-06
gi|17229579|ref|NP_486127.1| RNA-binding protein RbpA2 [Nostoc s... 54 2e-06
gi|1075643|pir||S44024 RNA-binding protein - Anabaena sp >gnl|BL... 54 2e-06
gi|50728210|ref|XP_416034.1| PREDICTED: similar to MADP-1 protei... 54 2e-06
gi|28201883|sp|Q9H0Z9|RNP1_HUMAN RNA-binding region containing p... 54 2e-06
gi|13122236|emb|CAC32281.1| dJ800J21.2.3 (ssDNA binding protein ... 54 2e-06
gi|15229743|ref|NP_187747.1| eukaryotic translation initiation f... 54 2e-06
gi|12407751|gb|AAG53636.1| initiation factor 3g [Arabidopsis tha... 54 2e-06
gi|38344030|emb|CAE01512.2| OJ991214_12.1 [Oryza sativa (japonic... 54 2e-06
gi|34577105|ref|NP_906270.1| RNA-binding region containing prote... 54 2e-06
gi|21667634|gb|AAM74138.1| U-rich RNA-binding protein UBP-2 [Try... 54 3e-06
gi|31074960|gb|AAP42138.1| RNA-binding protein UBP-2 [Trypanosom... 54 3e-06
gi|19112391|ref|NP_595599.1| RNA binding protein; 5 rrm RNA reco... 54 3e-06
gi|13548328|emb|CAC35875.1| putative protein [Arabidopsis thaliana] 54 3e-06
gi|6474847|dbj|BAA87307.1| Hypothetical protein YPR112c [Schizos... 54 3e-06
gi|7507370|pir||T16825 hypothetical protein T07D1.4 - Caenorhabd... 54 3e-06
gi|21430646|gb|AAM51001.1| RE44625p [Drosophila melanogaster] 54 3e-06
gi|50260937|gb|EAL23587.1| hypothetical protein CNBA2340 [Crypto... 54 3e-06
gi|38074506|ref|XP_354752.1| similar to dJ259A10.1 (ssDNA bindin... 54 3e-06
gi|10177573|dbj|BAB10805.1| eukaryotic translation initiation fa... 54 3e-06
gi|49074938|ref|XP_401567.1| hypothetical protein UM03952.1 [Ust... 54 3e-06
gi|46128087|ref|XP_388597.1| hypothetical protein FG08421.1 [Gib... 54 3e-06
gi|29150367|gb|AAO72376.1| putative RNA binding ribonucleoprotei... 54 3e-06
gi|969095|gb|AAA84417.1| no-on transient A-like protein 54 3e-06
gi|47225325|emb|CAG09825.1| unnamed protein product [Tetraodon n... 54 3e-06
gi|39581905|emb|CAE72867.1| Hypothetical protein CBG20166 [Caeno... 54 3e-06
gi|15241430|ref|NP_199233.1| nuclear cap-binding protein, putati... 54 3e-06
gi|18402803|ref|NP_566672.1| RNA recognition motif (RRM)-contain... 54 3e-06
gi|42561780|ref|NP_563787.2| transformer serine/arginine-rich ri... 54 3e-06
gi|17568353|ref|NP_508446.1| feminizing gene On X FOX-1, ribonuc... 54 3e-06
gi|30681225|ref|NP_196219.2| eukaryotic translation initiation f... 54 3e-06
gi|608464|gb|AAA67723.1| ribonucleoprotein 54 3e-06
gi|16332012|ref|NP_442740.1| RNA binding protein [Synechocystis ... 54 3e-06
gi|17981735|ref|NP_536740.1| CG10328-PA [Drosophila melanogaster... 54 3e-06
gi|45513450|ref|ZP_00165016.1| COG0724: RNA-binding proteins (RR... 54 3e-06
gi|862465|dbj|BAA04177.1| ss-DNA binding protein 12RNP2 precurso... 54 3e-06
gi|2126567|pir||S58674 RNA-binding protein RbpD - Anabaena varia... 54 3e-06
gi|4850347|dbj|BAA77714.1| RNA-binding protein [Anabaena variabi... 54 3e-06
gi|27683811|ref|XP_214446.1| similar to dJ259A10.1 (ssDNA bindin... 54 3e-06
gi|23129197|ref|ZP_00111030.1| COG0724: RNA-binding proteins (RR... 54 3e-06
gi|1161278|gb|AAA85382.1| RNA-binding protein 54 3e-06
gi|3264859|gb|AAC78728.1| translation initiation factor eIF3 p44... 54 3e-06
gi|50745700|ref|XP_420205.1| PREDICTED: similar to nuclear cap b... 54 3e-06
gi|15292733|gb|AAK92735.1| putative transformer-SR ribonucleopro... 54 3e-06
gi|18398260|ref|NP_565399.1| RNA recognition motif (RRM)-contain... 53 4e-06
gi|17738031|ref|NP_524396.1| CG12357-PA [Drosophila melanogaster... 53 4e-06
gi|7024451|dbj|BAA92156.1| glycine-rich RNA-binding protein [Cit... 53 4e-06
gi|50260672|gb|EAL23325.1| hypothetical protein CNBA4410 [Crypto... 53 4e-06
gi|20466772|gb|AAM20703.1| putative splicing factor [Arabidopsis... 53 4e-06
gi|31200081|ref|XP_308988.1| ENSANGP00000020311 [Anopheles gambi... 53 4e-06
gi|39585450|emb|CAE70533.1| Hypothetical protein CBG17168 [Caeno... 53 4e-06
gi|47226530|emb|CAG08546.1| unnamed protein product [Tetraodon n... 53 4e-06
gi|31210395|ref|XP_314164.1| ENSANGP00000003826 [Anopheles gambi... 53 4e-06
gi|46110044|ref|XP_382080.1| hypothetical protein FG01904.1 [Gib... 53 4e-06
gi|14091677|gb|AAK53819.1| RNA-binding protein UBP1 [Trypanosoma... 53 4e-06
gi|42661056|ref|XP_290734.4| similar to ataxin 2 binding protein... 53 4e-06
gi|31240329|ref|XP_320578.1| ENSANGP00000015329 [Anopheles gambi... 53 4e-06
gi|21553746|gb|AAM62839.1| putative splicing factor [Arabidopsis... 53 4e-06
gi|26347765|dbj|BAC37531.1| unnamed protein product [Mus musculus] 53 4e-06
gi|12641792|emb|CAC27531.1| eukaryotic translation initiation fa... 53 4e-06
gi|38107003|gb|EAA53234.1| hypothetical protein MG07511.4 [Magna... 53 4e-06
gi|34875578|ref|XP_213535.2| similar to ataxin 2-binding protein... 53 4e-06
gi|7439994|pir||T06796 glycine-rich RNA-binding protein - garden... 53 4e-06
gi|41055906|ref|NP_957293.1| similar to eukaryotic translation i... 53 4e-06
gi|38636774|dbj|BAD03017.1| putative RNA recognition motif (RRM)... 53 4e-06
gi|34897382|ref|NP_910037.1| putative RNA-binding protein [Oryza... 53 5e-06
gi|17569937|ref|NP_508674.1| RNA recognition motif -containing p... 53 5e-06
gi|7446359|pir||T05727 nucleic acid-binding protein - barley >gn... 53 5e-06
gi|34860882|ref|XP_345478.1| similar to SEB4 [Rattus norvegicus] 53 5e-06
gi|9507075|ref|NP_062420.1| seb4 mRNA; seb4 protein; seb4-like (... 53 5e-06
gi|47217953|emb|CAG02236.1| unnamed protein product [Tetraodon n... 53 5e-06
gi|42407940|dbj|BAD09079.1| nucleic acid-binding protein-like [O... 53 5e-06
gi|42407939|dbj|BAD09078.1| putative nucleic acid-binding protei... 53 5e-06
gi|17230420|ref|NP_486968.1| RNA-binding protein [Nostoc sp. PCC... 53 5e-06
gi|21553602|gb|AAM62695.1| glycine-rich RNA-binding protein-like... 53 5e-06
gi|18420085|ref|NP_568388.1| RNA recognition motif (RRM)-contain... 53 5e-06
gi|48095342|ref|XP_392279.1| similar to CG32062-PD [Apis mellifera] 53 5e-06
gi|544426|sp|Q03878|GRP_DAUCA Glycine-rich RNA-binding protein >... 53 5e-06
gi|30524926|ref|NP_444334.2| RNA binding motif protein 9; fox-1 ... 52 6e-06
gi|45198625|ref|NP_985654.1| AFR107Wp [Eremothecium gossypii] >g... 52 6e-06
gi|37748130|gb|AAH59002.1| Ataxin 2 binding protein 1, isoform g... 52 6e-06
gi|10946878|ref|NP_067452.1| ataxin 2 binding protein 1 isoform ... 52 6e-06
gi|34147248|ref|NP_899011.1| ataxin 2 binding protein 1 isoform ... 52 6e-06
gi|30524922|ref|NP_780596.1| RNA binding motif protein 9; fox-1 ... 52 6e-06
gi|34866893|ref|XP_343282.1| similar to RNA-binding protein 9 (R... 52 6e-06
gi|30680096|ref|NP_849605.1| transformer serine/arginine-rich ri... 52 6e-06
gi|6572237|emb|CAB63054.1| dJ41P2.2.1 (RNA binding motif protein... 52 6e-06
gi|18104579|gb|AAL59602.1| paraspeckle protein 1 beta isoform [H... 52 6e-06
gi|1084415|pir||S46286 RNA-binding protein - wood tobacco >gnl|B... 52 6e-06
gi|7657504|ref|NP_055124.1| RNA binding motif protein 9; hexarib... 52 6e-06
gi|26336927|dbj|BAC32147.1| unnamed protein product [Mus musculus] 52 6e-06
gi|30911059|gb|AAP41925.1| ataxin 2-binding protein variant 1 [H... 52 6e-06
gi|29841102|gb|AAP06115.1| similar to NM_080743 serine-arginine ... 52 6e-06
gi|49085942|ref|XP_405054.1| hypothetical protein AN0917.2 [Aspe... 52 6e-06
gi|22538409|ref|NP_665900.1| ataxin 2-binding protein 1 isoform ... 52 6e-06
gi|39592368|emb|CAE63445.1| Hypothetical protein CBG07904 [Caeno... 52 6e-06
gi|38111130|gb|EAA56754.1| hypothetical protein MG07109.4 [Magna... 52 6e-06
gi|29840825|sp|O43251|RBM9_HUMAN RNA-binding protein 9 (RNA bind... 52 6e-06
gi|47222887|emb|CAF96554.1| unnamed protein product [Tetraodon n... 52 6e-06
gi|49250885|gb|AAH74585.1| Unknown (protein for MGC:69387) [Xeno... 52 6e-06
gi|22538407|ref|NP_665899.1| ataxin 2-binding protein 1 isoform ... 52 6e-06
gi|20891681|ref|XP_147994.1| ataxin 2 binding protein 1 [Mus mus... 52 6e-06
gi|8671586|gb|AAF78291.1| ataxin 2-binding protein [Homo sapiens] 52 6e-06
gi|18461363|gb|AAL71902.1| hexaribonucleotide binding protein 2 ... 52 6e-06
gi|14495356|gb|AAK64287.1| putative RNA-binding protein fxh [Mus... 52 6e-06
gi|19584416|emb|CAD28499.1| hypothetical protein [Homo sapiens] 52 6e-06
gi|47678649|emb|CAG30445.1| RBM9 [Homo sapiens] 52 6e-06
gi|14488165|emb|CAC42098.1| RBD protein [Chironomus tentans] 52 6e-06
gi|13874511|dbj|BAB46877.1| hypothetical protein [Macaca fascicu... 52 6e-06
gi|39596949|emb|CAE59176.1| Hypothetical protein CBG02484 [Caeno... 52 6e-06
gi|50755926|ref|XP_414942.1| PREDICTED: similar to Ataxin 2-bind... 52 6e-06
gi|50728804|ref|XP_416291.1| PREDICTED: similar to putative RNA-... 52 6e-06
gi|18461369|gb|AAL71905.1| hexaribonucleotide binding protein 2 ... 52 6e-06
gi|8922789|ref|NP_060752.1| paraspeckle protein 1 [Homo sapiens]... 52 6e-06
gi|15239505|ref|NP_200911.1| RNA-binding protein, putative [Arab... 52 6e-06
gi|22538405|ref|NP_665898.1| ataxin 2-binding protein 1 isoform ... 52 6e-06
gi|34874199|ref|XP_224234.2| similar to RIKEN cDNA 5730470C09 [R... 52 6e-06
gi|32422983|ref|XP_331935.1| predicted protein [Neurospora crass... 52 6e-06
gi|18104577|gb|AAL59601.1| paraspeckle protein 1 alpha isoform [... 52 6e-06
gi|34896798|ref|NP_909743.1| putative peptidyl-prolyl cis-trans ... 52 6e-06
gi|34868593|ref|XP_220155.2| similar to hypothetical protein [Ra... 52 6e-06
gi|20071204|gb|AAH26772.1| Paraspeckle protein 1 [Mus musculus] ... 52 6e-06
gi|27228986|ref|NP_079958.2| paraspeckle protein 1; paraspeckle ... 52 6e-06
gi|16549891|dbj|BAB70875.1| unnamed protein product [Homo sapiens] 52 6e-06
gi|23123859|ref|ZP_00105894.1| COG0724: RNA-binding proteins (RR... 52 6e-06
gi|29654486|ref|NP_820178.1| nucleic acid binding domain protein... 52 6e-06
gi|39580201|emb|CAE71708.1| Hypothetical protein CBG18685 [Caeno... 52 6e-06
gi|7485727|pir||T04887 hypothetical protein F18F4.130 - Arabidop... 52 6e-06
gi|12643820|sp|Q9NWB1|A2BP_HUMAN Ataxin 2-binding protein 1 >gnl... 52 6e-06
gi|22538403|ref|NP_061193.2| ataxin 2-binding protein 1 isoform ... 52 6e-06
gi|6572238|emb|CAB63055.1| dJ41P2.2.2 (supported by GENSCAN) [Ho... 52 6e-06
gi|15239958|ref|NP_196239.1| RNA-binding protein, putative [Arab... 52 6e-06
gi|34913270|ref|NP_917982.1| putative 29 kDa ribonucleoprotein A... 52 6e-06
gi|50290711|ref|XP_447788.1| unnamed protein product [Candida gl... 52 6e-06
gi|48112272|ref|XP_393147.1| similar to CG5427-PA [Apis mellifera] 52 6e-06
gi|50258379|gb|EAL21068.1| hypothetical protein CNBD4440 [Crypto... 52 8e-06
gi|19114691|ref|NP_593779.1| putative U1 small nuclear ribonucle... 52 8e-06
gi|19923387|ref|NP_031388.2| nuclear cap binding protein subunit... 52 8e-06
gi|13386056|ref|NP_080830.1| nuclear cap binding protein subunit... 52 8e-06
gi|6911144|gb|AAF31403.1| putative glycine-rich RNA binding prot... 52 8e-06
gi|45239008|gb|AAS55633.1| unknown [Homo sapiens] 52 8e-06
gi|13624461|emb|CAC36889.1| dJ259A10.1 (ssDNA binding protein (S... 52 8e-06
gi|21313088|ref|NP_080301.1| MADP-1 protein [Mus musculus] >gnl|... 52 8e-06
gi|38707995|ref|NP_944597.1| nil per os [Danio rerio] >gnl|BL_OR... 52 8e-06
gi|34867757|ref|XP_343321.1| similar to MADP-1 protein [Rattus n... 52 8e-06
gi|2134152|pir||I51675 ribonucleoprotein - African clawed frog >... 52 8e-06
gi|47086303|ref|NP_998030.1| RNA binding motif protein 24; RNA b... 52 8e-06
gi|103057|pir||A36311 70K U1 small nuclear ribonucleoprotein - f... 52 8e-06
gi|17137278|ref|NP_477205.1| CG8749-PA [Drosophila melanogaster]... 52 8e-06
gi|50409715|ref|XP_456900.1| unnamed protein product [Debaryomyc... 52 8e-06
gi|50881454|gb|AAT85299.1| glycine-rich RNA-binding protein, put... 52 8e-06
gi|41202654|ref|XP_018399.3| similar to Heterogeneous nuclear ri... 52 8e-06
gi|24650782|ref|NP_651609.1| CG12870-PA [Drosophila melanogaster... 52 8e-06
gi|30583899|gb|AAP36198.1| Homo sapiens nuclear cap binding prot... 52 8e-06
gi|47229392|emb|CAF99380.1| unnamed protein product [Tetraodon n... 52 8e-06
gi|17229803|ref|NP_486351.1| RNA-binding protein [Nostoc sp. PCC... 52 8e-06
gi|45509494|ref|ZP_00161828.1| COG0724: RNA-binding proteins (RR... 52 8e-06
gi|21754197|dbj|BAC04474.1| unnamed protein product [Homo sapiens] 52 8e-06
gi|47497761|dbj|BAD19861.1| putative initiation factor 3g [Oryza... 52 8e-06
gi|38104500|gb|EAA51056.1| hypothetical protein MG04816.4 [Magna... 52 1e-05
gi|29654256|ref|NP_819948.1| RNA-binding protein [Coxiella burne... 52 1e-05
gi|8918490|dbj|BAA97656.1| RNA-binding protein [Candida boidinii] 52 1e-05
gi|34783857|gb|AAH56844.1| MGC64376 protein [Xenopus laevis] 52 1e-05
gi|39583312|emb|CAE60104.1| Hypothetical protein CBG03639 [Caeno... 52 1e-05
gi|6325369|ref|NP_015437.1| Essential conserved protein that ass... 52 1e-05
gi|38075240|ref|XP_355363.1| similar to embryonic poly(A) bindin... 52 1e-05
gi|38076982|ref|XP_122812.2| similar to Heterogeneous nuclear ri... 52 1e-05
gi|34854812|ref|XP_212982.2| similar to Heterogeneous nuclear ri... 52 1e-05
gi|15227815|ref|NP_179916.1| polyadenylate-binding protein, puta... 52 1e-05
gi|13430610|gb|AAK25927.1| putative poly(A) binding protein [Ara... 52 1e-05
gi|46121573|ref|XP_385341.1| hypothetical protein FG05165.1 [Gib... 52 1e-05
gi|31240455|ref|XP_320641.1| ENSANGP00000021189 [Anopheles gambi... 52 1e-05
gi|17944383|gb|AAL48083.1| RE71384p [Drosophila melanogaster] 52 1e-05
gi|24649519|ref|NP_732945.1| CG5422-PD [Drosophila melanogaster]... 52 1e-05
gi|37531112|ref|NP_919858.1| putative RNA-binding protein [Oryza... 52 1e-05
gi|15982706|gb|AAL09839.1| RNA binding protein [Bacteroides frag... 52 1e-05
gi|50260599|gb|EAL23252.1| hypothetical protein CNBA3680 [Crypto... 52 1e-05
>gi|17532819|ref|NP_495014.1| serine/aRginine rich pre-mRNA SPlicing
factor, Serpin (rsp-4) [Caenorhabditis elegans]
gi|14574034|gb|AAK68298.1| Sr protein (splicing factor) protein 4,
isoform b [Caenorhabditis elegans]
Length = 126
Score = 180 bits (457), Expect = 2e-44
Identities = 90/97 (92%), Positives = 90/97 (92%)
Frame = -1
Query: 591 MSXXXXXXXRAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSK 412
MS RAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSK
Sbjct: 1 MSRGGGGDRRAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSK 60
Query: 411 GFGFVRFYERRDAEHALDRTDGKLVDGRELRVTLAKY 301
GFGFVRFYERRDAEHALDRTDGKLVDGRELRVTLAKY
Sbjct: 61 GFGFVRFYERRDAEHALDRTDGKLVDGRELRVTLAKY 97
>gi|17532817|ref|NP_495013.1| serine/aRginine rich pre-mRNA SPlicing
factor, Serpin (22.6 kD) (rsp-4) [Caenorhabditis
elegans]
gi|3929375|sp|Q09511|SFR2_CAEEL Putative splicing factor,
arginine/serine-rich 2 (Splicing factor SC35) (SC-35)
(Splicing component, 35 kDa)
gi|7439997|pir||T15917 hypothetical protein EEED8.7 -
Caenorhabditis elegans
gi|733604|gb|AAC46767.1| Sr protein (splicing factor) protein 4,
isoform a [Caenorhabditis elegans]
Length = 196
Score = 180 bits (457), Expect = 2e-44
Identities = 90/97 (92%), Positives = 90/97 (92%)
Frame = -1
Query: 591 MSXXXXXXXRAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSK 412
MS RAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSK
Sbjct: 1 MSRGGGGDRRAAPDINGLTSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSK 60
Query: 411 GFGFVRFYERRDAEHALDRTDGKLVDGRELRVTLAKY 301
GFGFVRFYERRDAEHALDRTDGKLVDGRELRVTLAKY
Sbjct: 61 GFGFVRFYERRDAEHALDRTDGKLVDGRELRVTLAKY 97