Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= EEED8_8
         (3603 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17535281|ref|NP_495019.1| sex determination DEAH box protein,...  1912   0.0
gi|39596868|emb|CAE59095.1| Hypothetical protein CBG02387 [Caeno...  1849   0.0
gi|31199251|ref|XP_308573.1| ENSANGP00000015955 [Anopheles gambi...  1333   0.0
gi|20129977|ref|NP_610928.1| CG8241-PA [Drosophila melanogaster]...  1318   0.0
gi|21428730|gb|AAM50025.1| SD07467p [Drosophila melanogaster]        1317   0.0
gi|34873791|ref|XP_213460.2| similar to ATP-dependent helicase D...  1302   0.0
gi|4826690|ref|NP_004932.1| DEAH (Asp-Glu-Ala-His) box polypepti...  1302   0.0
gi|27882034|gb|AAH44586.1| DHX8 protein [Homo sapiens]               1301   0.0
gi|28704113|gb|AAH47327.1| DHX8 protein [Homo sapiens]               1299   0.0
gi|37654286|gb|AAQ96248.1| LRRGT00035 [Rattus norvegicus]            1286   0.0
gi|47207907|emb|CAF89868.1| unnamed protein product [Tetraodon n...  1163   0.0
gi|49074900|ref|XP_401551.1| hypothetical protein UM03936.1 [Ust...  1151   0.0
gi|48716672|dbj|BAD23339.1| putative RNA helicase [Oryza sativa ...  1146   0.0
gi|49094794|ref|XP_408858.1| hypothetical protein AN4721.2 [Aspe...  1138   0.0
gi|32411385|ref|XP_326173.1| hypothetical protein [Neurospora cr...  1134   0.0
gi|15231574|ref|NP_189288.1| ATP-dependent RNA helicase, putativ...  1133   0.0
gi|1402875|emb|CAA66825.1| RNA helicase [Arabidopsis thaliana] >...  1133   0.0
gi|50258475|gb|EAL21164.1| hypothetical protein CNBD5400 [Crypto...  1130   0.0
gi|38104766|gb|EAA51285.1| hypothetical protein MG08807.4 [Magna...  1120   0.0
gi|50760719|ref|XP_418105.1| PREDICTED: similar to ATP-dependent...  1119   0.0
gi|46121247|ref|XP_385178.1| hypothetical protein FG05002.1 [Gib...  1118   0.0
gi|19114165|ref|NP_593253.1| putative pre-mRNA splicing factor A...  1050   0.0
gi|50421073|ref|XP_459081.1| unnamed protein product [Debaryomyc...  1017   0.0
gi|50546573|ref|XP_500756.1| hypothetical protein [Yarrowia lipo...   998   0.0
gi|46443884|gb|EAL03163.1| hypothetical protein CaO19.4033 [Cand...   932   0.0
gi|50304197|ref|XP_452048.1| unnamed protein product [Kluyveromy...   932   0.0
gi|6320850|ref|NP_010929.1| RNA-dependent ATPase/ATP-dependent R...   931   0.0
gi|227517|prf||1705293A RNA helicase-like protein                     925   0.0
gi|45184843|ref|NP_982561.1| AAR020Wp [Eremothecium gossypii] >g...   910   0.0
gi|32398725|emb|CAD98685.1| pre-mRNA splicing factor ATP-depende...   909   0.0
gi|50289563|ref|XP_447213.1| unnamed protein product [Candida gl...   903   0.0
gi|23508097|ref|NP_700767.1| RNA helicase, putative [Plasmodium ...   900   0.0
gi|41053341|ref|NP_956318.1| DEAH (Asp-Glu-Ala-His) box polypept...   765   0.0
gi|30794426|ref|NP_081263.1| DEAH (Asp-Glu-Ala-His) box polypept...   756   0.0
gi|22329903|ref|NP_174527.2| RNA helicase, putative [Arabidopsis...   756   0.0
gi|47059171|ref|NP_997661.1| DEAH (Asp-Glu-Ala-His) box polypept...   756   0.0
gi|12044832|gb|AAG33228.2| DEAH-box RNA helicase [Chlamydomonas ...   754   0.0
gi|41529171|dbj|BAD08431.1| DEAD/H (Asp-Glu-Ala-Asp/His) box pol...   753   0.0
gi|26006959|sp|O60231|DD16_HUMAN Putative pre-mRNA splicing fact...   753   0.0
gi|14250712|gb|AAH08825.1| DEAH (Asp-Glu-Ala-His) box polypeptid...   753   0.0
gi|38502930|sp|Q7YR39|DD16_PANTR Putative pre-mRNA splicing fact...   753   0.0
gi|40788293|dbj|BAA25503.2| KIAA0577 protein [Homo sapiens]           753   0.0
gi|19921526|ref|NP_609946.1| CG10689-PA [Drosophila melanogaster...   750   0.0
gi|25513513|pir||C86450 F5D14.27 protein - Arabidopsis thaliana ...   750   0.0
gi|39591365|emb|CAE73419.1| Hypothetical protein CBG20862 [Caeno...   748   0.0
gi|25408373|pir||D84767 probable pre-mRNA splicing factor RNA he...   746   0.0
gi|42569631|ref|NP_181077.2| RNA helicase, putative [Arabidopsis...   746   0.0
gi|4503293|ref|NP_003578.1| DEAH (Asp-Glu-Ala-His) box polypepti...   744   0.0
gi|47218748|emb|CAG02734.1| unnamed protein product [Tetraodon n...   740   0.0
gi|32422967|ref|XP_331927.1| hypothetical protein [Neurospora cr...   737   0.0
gi|38424010|dbj|BAD01767.1| RNA helicase-like [Oryza sativa (jap...   736   0.0
gi|17531507|ref|NP_497027.1| sex determining protein, Masculinis...   735   0.0
gi|48926654|gb|AAT47443.1| putative DEAD/DEAH RNA helicase [Oryz...   734   0.0
gi|482230|pir||S41025 hypothetical protein K03H1.2 - Caenorhabdi...   734   0.0
gi|17554326|ref|NP_499212.1| sex determination DEAH box protein,...   734   0.0
gi|46107130|ref|XP_380624.1| hypothetical protein FG00448.1 [Gib...   733   0.0
gi|18859729|ref|NP_572947.1| CG32604-PA [Drosophila melanogaster...   732   0.0
gi|31238776|ref|XP_319843.1| ENSANGP00000025250 [Anopheles gambi...   728   0.0
gi|33146483|dbj|BAC79592.1| putative DEAH-box RNA helicase [Oryz...   728   0.0
gi|39590709|emb|CAE65079.1| Hypothetical protein CBG09937 [Caeno...   727   0.0
gi|31220358|ref|XP_316912.1| ENSANGP00000011076 [Anopheles gambi...   723   0.0
gi|49093416|ref|XP_408169.1| hypothetical protein AN4032.2 [Aspe...   721   0.0
gi|50550331|ref|XP_502638.1| hypothetical protein [Yarrowia lipo...   721   0.0
gi|15239967|ref|NP_196805.1| RNA helicase, putative [Arabidopsis...   721   0.0
gi|50259106|gb|EAL21783.1| hypothetical protein CNBC4850 [Crypto...   720   0.0
gi|47230418|emb|CAF99611.1| unnamed protein product [Tetraodon n...   719   0.0
gi|41053698|ref|NP_957170.1| hypothetical protein MGC63517 [Dani...   718   0.0
gi|15235842|ref|NP_193401.1| RNA helicase, putative [Arabidopsis...   718   0.0
gi|3024898|sp|Q92620|PR16_HUMAN Pre-mRNA splicing factor ATP-dep...   716   0.0
gi|17999539|ref|NP_054722.2| DEAH (Asp-Glu-Ala-His) box polypept...   716   0.0
gi|40788918|dbj|BAA13213.2| KIAA0224 [Homo sapiens]                   716   0.0
gi|30410010|ref|NP_848467.1| DEAH (Asp-Glu-Ala-His) box polypept...   715   0.0
gi|49075482|ref|XP_401803.1| hypothetical protein UM04188.1 [Ust...   714   0.0
gi|49097008|ref|XP_409964.1| hypothetical protein AN5827.2 [Aspe...   713   0.0
gi|19862987|sp|Q10752|CC28_SCHPO Putative ATP-dependent RNA heli...   711   0.0
gi|50258188|gb|EAL20882.1| hypothetical protein CNBE2430 [Crypto...   711   0.0
gi|34852059|ref|XP_215306.2| similar to DEAD/H (Asp-Glu-Ala-Asp/...   711   0.0
gi|38106993|gb|EAA53224.1| hypothetical protein MG07501.4 [Magna...   702   0.0
gi|46137751|ref|XP_390567.1| conserved hypothetical protein [Gib...   702   0.0
gi|39104622|dbj|BAC65596.4| mKIAA0577 protein [Mus musculus]          702   0.0
gi|48474990|sp|Q9P774|PR16_SCHPO Pre-mRNA splicing factor RNA he...   701   0.0
gi|7522524|pir||T39724 probable pre-mRNA splicing factor ATP-dep...   701   0.0
gi|49079422|ref|XP_403358.1| hypothetical protein UM05743.1 [Ust...   696   0.0
gi|50510419|dbj|BAD32195.1| mKIAA0224 protein [Mus musculus]          689   0.0
gi|50546395|ref|XP_500667.1| hypothetical protein [Yarrowia lipo...   684   0.0
gi|32421753|ref|XP_331320.1| hypothetical protein [Neurospora cr...   681   0.0
gi|49118496|gb|AAH73477.1| Unknown (protein for MGC:80994) [Xeno...   678   0.0
gi|34851735|ref|XP_238048.2| similar to RIKEN cDNA 5730550P09 [R...   677   0.0
gi|15226549|ref|NP_182247.1| RNA helicase, putative [Arabidopsis...   677   0.0
gi|15228730|ref|NP_191790.1| RNA helicase, putative [Arabidopsis...   670   0.0
gi|11346341|pir||T46568 ATP-dependent RNA helicase cdc28 [simila...   668   0.0
gi|31201101|ref|XP_309498.1| ENSANGP00000021966 [Anopheles gambi...   664   0.0
gi|50302815|ref|XP_451344.1| unnamed protein product [Kluyveromy...   656   0.0
gi|19921728|ref|NP_610269.1| CG11107-PA [Drosophila melanogaster...   654   0.0
gi|45188097|ref|NP_984320.1| ADR224Wp [Eremothecium gossypii] >g...   653   0.0
gi|50413843|ref|XP_457324.1| unnamed protein product [Debaryomyc...   651   0.0
gi|19112729|ref|NP_595937.1| putative pre-mrna splicing factor r...   649   0.0
gi|34878065|ref|XP_214053.2| similar to Putative pre-mRNA splici...   648   0.0
gi|13124667|sp|O43143|DD15_HUMAN Putative pre-mRNA splicing fact...   648   0.0
gi|48098531|ref|XP_392081.1| similar to ENSANGP00000021966 [Apis...   647   0.0
gi|31563436|sp|O35286|DD15_MOUSE Putative pre-mRNA splicing fact...   647   0.0
gi|46249858|gb|AAH68766.1| MGC81281 protein [Xenopus laevis]          646   0.0
gi|49084084|ref|XP_404270.1| hypothetical protein AN0133.2 [Aspe...   641   0.0
gi|50422299|ref|XP_459712.1| unnamed protein product [Debaryomyc...   641   0.0
gi|4557517|ref|NP_001349.1| DEAH (Asp-Glu-Ala-His) box polypepti...   637   0.0
gi|50546941|ref|XP_500940.1| hypothetical protein [Yarrowia lipo...   637   0.0
gi|6321318|ref|NP_011395.1| RNA helicase in the DEAH-box family,...   632   e-179
gi|25144243|ref|NP_741147.1| rna helicase (84.4 kD) (3G680) [Cae...   631   e-179
gi|39584877|emb|CAE64301.1| Hypothetical protein CBG08977 [Caeno...   630   e-179
gi|50303227|ref|XP_451555.1| unnamed protein product [Kluyveromy...   629   e-178
gi|49068848|ref|XP_398713.1| hypothetical protein UM01098.1 [Ust...   627   e-178
gi|45185005|ref|NP_982723.1| AAR180Cp [Eremothecium gossypii] >g...   626   e-177
gi|46229729|gb|EAK90547.1| Prp16p pre-mRNA splicing factor. HrpA...   625   e-177
gi|23613694|ref|NP_704715.1| ATP-dependant RNA helicase, putativ...   624   e-177
gi|50287699|ref|XP_446279.1| unnamed protein product [Candida gl...   623   e-176
gi|46138485|ref|XP_390933.1| conserved hypothetical protein [Gib...   623   e-176
gi|6681155|ref|NP_031865.1| DEAH (Asp-Glu-Ala-His) box polypepti...   622   e-176
gi|6322939|ref|NP_013012.1| RNA helicase in the DEAH-box family ...   621   e-176
gi|172270|gb|AAA34911.1| PRP16 peptide (put. helicase); putative      620   e-176
gi|46443567|gb|EAL02848.1| hypothetical protein CaO19.9255 [Cand...   619   e-175
gi|50257575|gb|EAL20280.1| hypothetical protein CNBF0920 [Crypto...   619   e-175
gi|50407806|ref|XP_456737.1| unnamed protein product [Debaryomyc...   618   e-175
gi|23482170|gb|EAA18230.1| ATP-dependent RNA helicase-like prote...   616   e-174
gi|32565154|ref|NP_741148.2| rna helicase (3G680) [Caenorhabditi...   616   e-174
gi|32415143|ref|XP_328051.1| probable ATP-binding protein PRP16 ...   614   e-174
gi|11346354|pir||T49573 probable ATP-binding protein PRP16 [impo...   614   e-174
gi|47218463|emb|CAG03735.1| unnamed protein product [Tetraodon n...   611   e-173
gi|50288067|ref|XP_446462.1| unnamed protein product [Candida gl...   608   e-172
gi|46437388|gb|EAK96735.1| hypothetical protein CaO19.2818 [Cand...   607   e-172
gi|38103437|gb|EAA50134.1| hypothetical protein MG03893.4 [Magna...   606   e-171
gi|20544129|ref|NP_068750.2| DEAH (Asp-Glu-Ala-His) box polypept...   603   e-170
gi|7770157|gb|AAF69614.1| PRO2014 [Homo sapiens]                      600   e-170
gi|10439270|dbj|BAB15476.1| unnamed protein product [Homo sapiens]    600   e-170
gi|46444943|gb|EAL04214.1| hypothetical protein CaO19.13287 [Can...   599   e-169
gi|23619564|ref|NP_705526.1| splicing factor, putative [Plasmodi...   598   e-169
gi|46228687|gb|EAK89557.1| PRP43 involved in spliceosome disasse...   598   e-169
gi|50259863|gb|EAL22531.1| hypothetical protein CNBB4090 [Crypto...   595   e-168
gi|18415102|ref|NP_567558.1| RNA helicase, putative [Arabidopsis...   590   e-166
gi|13397805|emb|CAC03449.3| dJ616B8.1 (Similar to pre-mRNA splic...   588   e-166
gi|42562325|ref|NP_173961.3| RNA helicase, putative [Arabidopsis...   587   e-166
gi|49250365|gb|AAH74605.1| Unknown (protein for IMAGE:5308120) [...   581   e-164
gi|50758072|ref|XP_415747.1| PREDICTED: similar to DEAH (Asp-Glu...   577   e-163
gi|25513550|pir||D86390 T1K7.25 protein - Arabidopsis thaliana >...   575   e-162
gi|50773518|ref|XP_423195.1| PREDICTED: similar to ATP-dependent...   572   e-161
gi|50290129|ref|XP_447496.1| unnamed protein product [Candida gl...   571   e-161
gi|21919420|ref|NP_665685.1| DEAH (Asp-Glu-Ala-His) box polypept...   566   e-159
gi|50758645|ref|XP_417352.1| PREDICTED: similar to Probable ATP-...   564   e-159
gi|45188160|ref|NP_984383.1| ADR287Cp [Eremothecium gossypii] >g...   561   e-158
gi|34871080|ref|XP_213370.2| similar to DEAH (Asp-Glu-Ala-His) b...   560   e-158
gi|20336302|ref|NP_064547.2| DEAH (Asp-Glu-Ala-His) box polypept...   559   e-157
gi|46560585|ref|NP_848144.3| DEAH (Asp-Glu-Ala-His) box polypept...   557   e-157
gi|10438200|dbj|BAB15193.1| unnamed protein product [Homo sapiens]    556   e-156
gi|26330478|dbj|BAC28969.1| unnamed protein product [Mus musculus]    556   e-156
gi|34860318|ref|XP_342566.1| similar to Probable ATP-dependent h...   556   e-156
gi|6324338|ref|NP_014408.1| RNA-dependent ATPase in the DEAH-box...   548   e-154
gi|23304704|emb|CAD48140.1| hypothetical protein [Brugia malayi]      547   e-154
gi|50747142|ref|XP_420761.1| PREDICTED: similar to Putative pre-...   547   e-154
gi|49087010|ref|XP_405500.1| hypothetical protein AN1363.2 [Aspe...   539   e-151
gi|19114003|ref|NP_593091.1| probable atp-dependent rna helicase...   538   e-151
gi|422052|pir||S35546 ATP-dependent RNA helicase - fission yeast...   538   e-151
gi|18396548|ref|NP_564296.1| RNA helicase, putative [Arabidopsis...   538   e-151
gi|38108529|gb|EAA54533.1| hypothetical protein MG02518.4 [Magna...   537   e-151
gi|32413082|ref|XP_327021.1| hypothetical protein [Neurospora cr...   533   e-149
gi|19112682|ref|NP_595890.1| putative pre-mrna splicing factor a...   529   e-148
gi|25403042|pir||C86404 probable protein ATP-dependent RNA helic...   525   e-147
gi|39586111|emb|CAE69187.1| Hypothetical protein CBG15221 [Caeno...   522   e-146
gi|48094733|ref|XP_394254.1| similar to DEAH (Asp-Glu-Ala-His) b...   521   e-146
gi|50310679|ref|XP_455361.1| unnamed protein product [Kluyveromy...   521   e-146
gi|31216263|ref|XP_316200.1| ENSANGP00000005937 [Anopheles gambi...   520   e-146
gi|31201769|ref|XP_309832.1| ENSANGP00000018268 [Anopheles gambi...   518   e-145
gi|19920696|ref|NP_608860.1| CG3225-PA [Drosophila melanogaster]...   516   e-144
gi|47194199|emb|CAF90919.1| unnamed protein product [Tetraodon n...   516   e-144
gi|17556386|ref|NP_497420.1| rna helicase (3C636) [Caenorhabditi...   513   e-143
gi|37194872|gb|AAH58276.1| Dhx40 protein [Mus musculus]               503   e-140
gi|18848216|gb|AAH24187.1| DEAH (Asp-Glu-Ala-His) box polypeptid...   499   e-139
gi|31542729|ref|NP_078888.3| DEAH (Asp-Glu-Ala-His) box polypept...   498   e-139
gi|34872954|ref|XP_213429.2| similar to Hypothetical protein FLJ...   496   e-138
gi|24641942|ref|NP_727764.1| CG32604-PB [Drosophila melanogaster...   496   e-138
gi|23478977|gb|EAA15925.1| Unknown protein [Plasmodium yoelii yo...   489   e-136
gi|3913424|sp|O17438|DD15_STRPU Putative pre-mRNA splicing facto...   488   e-136
gi|18490480|gb|AAH22656.1| Dhx8 protein [Mus musculus]                488   e-136
gi|50546625|ref|XP_500782.1| hypothetical protein [Yarrowia lipo...   479   e-133
gi|23484437|gb|EAA19765.1| putative ATP-dependent RNA helicase c...   477   e-132
gi|45550174|ref|NP_609356.2| CG4901-PA [Drosophila melanogaster]...   474   e-132
gi|50758346|ref|XP_415878.1| PREDICTED: similar to Clathrin heav...   472   e-131
gi|47211726|emb|CAF92524.1| unnamed protein product [Tetraodon n...   463   e-128
gi|27229045|ref|NP_080467.2| DEAH (Asp-Glu-Ala-His) box polypept...   456   e-126
gi|46435871|gb|EAK95244.1| hypothetical protein CaO19.107 [Candi...   452   e-125
gi|49097524|ref|XP_410222.1| hypothetical protein AN6085.2 [Aspe...   445   e-123
gi|6322772|ref|NP_012845.1| Predominantly nucleolar DEAH-box RNA...   445   e-123
gi|2317715|gb|AAB66335.1| HelD [Dictyostelium discoideum]             443   e-122
gi|50428249|ref|XP_460232.1| unnamed protein product [Debaryomyc...   442   e-122
gi|46435565|gb|EAK94944.1| hypothetical protein CaO19.7754 [Cand...   442   e-122
gi|47223117|emb|CAG11252.1| unnamed protein product [Tetraodon n...   439   e-121
gi|19173135|ref|NP_596938.1| PRE-mRNA SPLICING FACTOR (DEAD box ...   433   e-119
gi|45188013|ref|NP_984236.1| ADR140Cp [Eremothecium gossypii] >g...   431   e-119
gi|49070804|ref|XP_399691.1| hypothetical protein UM02076.1 [Ust...   430   e-118
gi|23471151|ref|ZP_00126482.1| COG1643: HrpA-like helicases [Pse...   430   e-118
gi|19114541|ref|NP_593629.1| putative pre-mrna splicing factor, ...   429   e-118
gi|50287643|ref|XP_446251.1| unnamed protein product [Candida gl...   429   e-118
gi|28871237|ref|NP_793856.1| ATP-dependent helicase HrpA [Pseudo...   428   e-118
gi|48835334|ref|ZP_00292334.1| COG1643: HrpA-like helicases [The...   427   e-118
gi|7839559|gb|AAF70326.1| PAD [Homo sapiens]                          427   e-117
gi|50312429|ref|XP_456248.1| unnamed protein product [Kluyveromy...   424   e-116
gi|48729690|ref|ZP_00263440.1| COG1643: HrpA-like helicases [Pse...   423   e-116
gi|26991230|ref|NP_746655.1| ATP-dependent helicase HrpA [Pseudo...   422   e-116
gi|7544061|emb|CAB87205.1| putative pre-mrna splicing factor; at...   421   e-116
gi|39595570|emb|CAE67071.1| Hypothetical protein CBG12480 [Caeno...   421   e-116
gi|32035763|ref|ZP_00135626.1| COG1643: HrpA-like helicases [Act...   419   e-115
gi|414604|gb|AAA34986.1| RNA helicase                                 419   e-115
gi|50727037|gb|AAB52427.3| Hypothetical protein T05E8.3 [Caenorh...   416   e-114
gi|4581864|gb|AAD24770.1| putative pre-mRNA splicing factor ATP-...   416   e-114
gi|50877096|emb|CAG36936.1| related to ATP-dependent helicase Hr...   415   e-114
gi|46164155|ref|ZP_00136651.2| COG1643: HrpA-like helicases [Pse...   415   e-114
gi|46129044|ref|ZP_00155660.2| COG1643: HrpA-like helicases [Hae...   414   e-113
gi|50260256|gb|EAL22915.1| hypothetical protein CNBA6840 [Crypto...   413   e-113
gi|15598493|ref|NP_251987.1| probable ATP-dependent helicase [Ps...   413   e-113
gi|46133270|ref|ZP_00203119.1| COG1643: HrpA-like helicases [Hae...   412   e-113
gi|15602634|ref|NP_245706.1| HrpA [Pasteurella multocida Pm70] >...   412   e-113
gi|23467080|ref|ZP_00122665.1| COG1643: HrpA-like helicases [Hae...   412   e-113
gi|46156710|ref|ZP_00132238.2| COG1643: HrpA-like helicases [Hae...   412   e-113
gi|1074634|pir||G64165 ATP-dependent helicase hrpA homolog HI107...   409   e-112
gi|16273001|ref|NP_439228.1| ATP-dependent helicase [Haemophilus...   409   e-112
gi|19074886|ref|NP_586392.1| possible PRE-mRNA SPLICING FACTOR (...   406   e-111
gi|48868338|ref|ZP_00321685.1| COG1643: HrpA-like helicases [Hae...   405   e-111
gi|37680179|ref|NP_934788.1| ATP-dependent helicase HrpA [Vibrio...   404   e-111
gi|27365663|ref|NP_761191.1| ATP-dependent helicase HrpA [Vibrio...   403   e-110
gi|22125903|ref|NP_669326.1| helicase, ATP-dependent [Yersinia p...   402   e-110
gi|16122546|ref|NP_405859.1| ATP-dependent helicase [Yersinia pe...   402   e-110
gi|19112478|ref|NP_595686.1| putative ATP-dependent RNA helicase...   402   e-110
gi|41407782|ref|NP_960618.1| HrpA [Mycobacterium avium subsp. pa...   401   e-110
gi|26247701|ref|NP_753741.1| ATP-dependent helicase hrpA [Escher...   400   e-109
gi|24113153|ref|NP_707663.1| ATP-dependent helicase HrpA [Shigel...   400   e-109
gi|15801734|ref|NP_287752.1| helicase, ATP-dependent [Escherichi...   400   e-109
gi|30062885|ref|NP_837056.1| helicase [Shigella flexneri 2a str....   400   e-109
gi|24373783|ref|NP_717826.1| ATP-dependent helicase HrpA [Shewan...   400   e-109
gi|48831213|ref|ZP_00288287.1| COG1643: HrpA-like helicases [Mag...   399   e-109
gi|30683133|ref|NP_196599.2| helicase domain-containing protein ...   398   e-109
gi|11357363|pir||T50002 hypothetical protein F12B17.280 - Arabid...   398   e-109
gi|50120933|ref|YP_050100.1| ATP-dependent helicase [Erwinia car...   398   e-109
gi|16760246|ref|NP_455863.1| ATP-dependent helicase HrpA [Salmon...   397   e-109
gi|28898227|ref|NP_797832.1| ATP-dependent helicase HrpA [Vibrio...   397   e-108
gi|46108950|ref|XP_381533.1| hypothetical protein FG01357.1 [Gib...   397   e-108
gi|16764985|ref|NP_460600.1| ATP-dependent helicase [Salmonella ...   397   e-108
gi|13638202|sp|P43329|HRPA_ECOLI ATP-dependent helicase hrpA          397   e-108
gi|19353967|gb|AAH24489.1| Dhx38 protein [Mus musculus]               397   e-108
gi|49176106|ref|NP_415931.3| helicase, ATP-dependent [Escherichi...   397   e-108
gi|15641394|ref|NP_231026.1| ATP-dependent helicase HrpA [Vibrio...   396   e-108
gi|27469550|gb|AAH42040.1| DHX33 protein [Homo sapiens]               395   e-108
gi|37526066|ref|NP_929410.1| ATP-dependent helicase [Photorhabdu...   394   e-108
gi|34496971|ref|NP_901186.1| ATP-dependent helicase hrpA [Chromo...   394   e-108
gi|48787853|ref|ZP_00283832.1| COG1643: HrpA-like helicases [Bur...   393   e-107
gi|46109326|ref|XP_381721.1| hypothetical protein FG01545.1 [Gib...   393   e-107
gi|25141387|ref|NP_491604.2| DEAD H box polypeptide (1G42) [Caen...   393   e-107
gi|46913376|emb|CAG20164.1| putative ATP-dependent helicase HrpA...   393   e-107
gi|48860878|ref|ZP_00314786.1| COG1643: HrpA-like helicases [Mic...   391   e-107
gi|19114432|ref|NP_593520.1| putative ATP dependent RNA helicase...   390   e-107
gi|29830671|ref|NP_825305.1| putative ATP-dependent helicase [St...   389   e-106
gi|46362770|ref|ZP_00225613.1| COG1643: HrpA-like helicases [Kin...   389   e-106
gi|26329317|dbj|BAC28397.1| unnamed protein product [Mus musculus]    388   e-106
gi|30248837|ref|NP_840907.1| HrpA-like helicases [Nitrosomonas e...   387   e-106
gi|42527161|ref|NP_972259.1| ATP-dependent helicase HrpA, putati...   387   e-106
gi|19527160|ref|NP_598702.1| helicase DDX32; DEAD/H (Asp-Glu-Ala...   387   e-106
gi|13905230|gb|AAH06911.1| Dhx32 protein [Mus musculus]               387   e-106
gi|23105255|ref|ZP_00091713.1| COG1643: HrpA-like helicases [Azo...   387   e-105
gi|32472986|ref|NP_865980.1| ATP-dependent helicase hrpA [Pirell...   386   e-105
gi|33146632|dbj|BAC79920.1| putative DEAD/H (Asp-Glu-Ala-Asp/His...   386   e-105
gi|34906822|ref|NP_914758.1| similar to pre-mRNA splicing factor...   386   e-105
gi|21232376|ref|NP_638293.1| ATP dependent RNA helicase [Xanthom...   385   e-105
gi|7486358|pir||T10542 hypothetical protein F3I3.40 - Arabidopsi...   385   e-105
gi|18411509|ref|NP_567206.1| helicase domain-containing protein ...   385   e-105
gi|21222494|ref|NP_628273.1| ATP-dependent helicase [Streptomyce...   384   e-105
gi|34783118|gb|AAH02473.2| DEAD/H (Asp-Glu-Ala-Asp/His) box poly...   382   e-104
gi|50085222|ref|YP_046732.1| ATP-dependent helicase [Acinetobact...   382   e-104
gi|20336300|ref|NP_060650.2| DEAD/H (Asp-Glu-Ala-Asp/His) box po...   382   e-104
gi|25028375|ref|NP_738429.1| putative ATP-dependent helicase [Co...   382   e-104
gi|7022881|dbj|BAA91754.1| unnamed protein product [Homo sapiens]     382   e-104
gi|806328|dbj|BAA07685.1| A protein similar to yeast PRP16 and P...   382   e-104
gi|19553131|ref|NP_601133.1| HrpA-like helicase [Corynebacterium...   381   e-104
gi|33596337|ref|NP_883980.1| putative ATP-dependent helicase [Bo...   379   e-103
gi|33602377|ref|NP_889937.1| putative ATP-dependent helicase [Bo...   379   e-103
gi|34861132|ref|XP_341949.1| similar to helicase DDX32 [Rattus n...   378   e-103
gi|15639516|ref|NP_218966.1| ATP-dependent helicase (hrpA) [Trep...   378   e-103
gi|33593328|ref|NP_880972.1| putative ATP-dependent helicase [Bo...   377   e-102
gi|21243849|ref|NP_643431.1| ATP-dependent RNA helicase [Xanthom...   376   e-102
gi|48769546|ref|ZP_00273891.1| COG1643: HrpA-like helicases [Ral...   376   e-102
gi|7023212|dbj|BAA91882.1| unnamed protein product [Homo sapiens]     375   e-102
gi|46321426|ref|ZP_00221803.1| COG1643: HrpA-like helicases [Bur...   373   e-101
gi|47223749|emb|CAF98519.1| unnamed protein product [Tetraodon n...   373   e-101
gi|38158022|ref|NP_055496.2| DEAH (Asp-Glu-Ala-His) box polypept...   373   e-101
gi|38158020|ref|NP_919409.1| DEAH (Asp-Glu-Ala-His) box polypept...   373   e-101
gi|38234008|ref|NP_939775.1| Putative ATP-dependent helicase [Co...   372   e-101
gi|21312618|ref|NP_082159.1| DEAH (Asp-Glu-Ala-His) box polypept...   372   e-101
gi|47116751|sp|Q9DBV3|DD34_MOUSE Probable ATP-dependent helicase...   372   e-101
gi|37359788|dbj|BAC97872.1| mKIAA0134 protein [Mus musculus]          372   e-101
gi|17545970|ref|NP_519372.1| PROBABLE ATP-DEPENDENT RNA HELICASE...   372   e-101
gi|15595172|ref|NP_212961.1| ATP-dependent helicase (hrpA) [Borr...   369   e-100
gi|23483033|gb|EAA18834.1| pre-mRNA splicing factor ATP-dependen...   368   e-100
gi|29250876|gb|EAA42363.1| GLP_137_1747_3888 [Giardia lamblia AT...   368   e-100
gi|38101970|gb|EAA48865.1| hypothetical protein MG00523.4 [Magna...   365   6e-99
gi|47574946|ref|ZP_00244981.1| COG1643: HrpA-like helicases [Rub...   362   5e-98
gi|37535284|ref|NP_921944.1| putative ATP-dependent RNA helicase...   358   4e-97
gi|49067488|ref|XP_398034.1| hypothetical protein UM00419.1 [Ust...   357   9e-97
gi|11346351|pir||T50372 probable ATP-dependent RNA helicase cdc2...   355   3e-96
gi|32422405|ref|XP_331646.1| hypothetical protein [Neurospora cr...   347   9e-94
gi|42661208|ref|XP_372677.2| similar to DEAH (Asp-Glu-Ala-His) b...   347   1e-93
gi|23478978|gb|EAA15926.1| ATP-dependent helicase ddx8 [Plasmodi...   344   1e-92
gi|31242751|ref|XP_321806.1| ENSANGP00000016870 [Anopheles gambi...   342   4e-92
gi|12320894|gb|AAG50585.1| RNA helicase, putative, 5' partial [A...   339   2e-91
gi|15837984|ref|NP_298672.1| helicase, ATP dependent [Xylella fa...   338   6e-91
gi|28198528|ref|NP_778842.1| ATP-dependent helicase [Xylella fas...   335   5e-90
gi|50547773|ref|XP_501356.1| hypothetical protein [Yarrowia lipo...   333   2e-89
gi|50842512|ref|YP_055739.1| ATP-dependent helicase HrpA [Propio...   331   7e-89
gi|22997025|ref|ZP_00041264.1| COG1643: HrpA-like helicases [Xyl...   331   7e-89
gi|47222314|emb|CAG05063.1| unnamed protein product [Tetraodon n...   327   2e-87
gi|18376272|emb|CAD21386.1| conserved hypothetical protein [Neur...   325   4e-87
gi|46125529|ref|XP_387318.1| hypothetical protein FG07142.1 [Gib...   321   9e-86
gi|8977905|emb|CAB95775.1| hypothetical protein [Homo sapiens]        320   2e-85
gi|47214890|emb|CAG01021.1| unnamed protein product [Tetraodon n...   317   1e-84
gi|8118102|gb|AAF72892.1| putative DEAH-box RNA helicase [Trypan...   316   2e-84
gi|24643238|ref|NP_728244.1| CG32533-PA [Drosophila melanogaster...   316   2e-84
gi|38111072|gb|EAA56704.1| hypothetical protein MG07059.4 [Magna...   316   3e-84
gi|19424112|ref|NP_291084.1| DEAQ RNA-dependent ATPase [Mus musc...   315   5e-84
gi|49089030|ref|XP_406275.1| hypothetical protein AN2138.2 [Aspe...   315   7e-84
gi|47227881|emb|CAG09044.1| unnamed protein product [Tetraodon n...   313   1e-83
gi|34856279|ref|XP_238357.2| similar to DEAQ RNA-dependent ATPas...   311   7e-83
gi|17543090|ref|NP_500405.1| helicase, C-terminal and Helicase-a...   310   2e-82
gi|50761474|ref|XP_424728.1| PREDICTED: similar to DEAH (Asp-Glu...   309   4e-82
gi|39583652|emb|CAE63756.1| Hypothetical protein CBG08291 [Caeno...   308   6e-82
gi|23465866|ref|NP_696469.1| ATP-dependent helicase [Bifidobacte...   307   1e-81
gi|15678020|ref|NP_274999.1| ATP-dependent RNA helicase HrpA [Ne...   307   1e-81
gi|15793438|ref|NP_283260.1| ATP-dependent DNA helicase [Neisser...   306   2e-81
gi|30025091|gb|AAF59456.3| Hypothetical protein Y37E11AM.1 [Caen...   305   4e-81
gi|40644065|emb|CAE11803.1| putative DExH/D RNA helicase [Homo s...   304   1e-80
gi|32404992|ref|XP_323109.1| hypothetical protein ( (AL451018) c...   302   4e-80
gi|24641139|ref|NP_572663.1| CG1582-PA [Drosophila melanogaster]...   301   7e-80
gi|46441629|gb|EAL00925.1| hypothetical protein CaO19.14110 [Can...   299   3e-79
gi|26326933|dbj|BAC27210.1| unnamed protein product [Mus musculus]    297   1e-78
gi|24585491|ref|NP_610056.1| CG9323-PA [Drosophila melanogaster]...   292   3e-77
gi|50260160|gb|EAL22821.1| hypothetical protein CNBB0420 [Crypto...   290   1e-76
gi|19074677|ref|NP_586183.1| PRE-mRNA SPLICING FACTOR [Encephali...   290   2e-76
gi|12845870|dbj|BAB26933.1| unnamed protein product [Mus musculus]    288   5e-76
gi|29169166|gb|AAO66336.1| ATP-dependent RNA helicase [Myxococcu...   280   2e-73
gi|6624595|emb|CAB63784.1| cdc28 [Schizosaccharomyces pombe]          279   3e-73
gi|48123124|ref|XP_396525.1| similar to Dosage compensation regu...   278   5e-73
gi|48846621|ref|ZP_00300882.1| COG1643: HrpA-like helicases [Geo...   274   1e-71
gi|39996937|ref|NP_952888.1| ATP-dependent helicase HrpB [Geobac...   274   1e-71
gi|28829757|gb|AAO52259.1| similar to Oryza sativa (Rice). Putat...   273   2e-71
gi|13812299|ref|NP_113417.1| putative ATP-dependent RNA helicase...   271   6e-71
gi|1742299|dbj|BAA15025.1| ATP-dependent helicase HrpA homolog. ...   270   2e-70
gi|45190700|ref|NP_984954.1| AER094Cp [Eremothecium gossypii] >g...   269   3e-70
gi|16125437|ref|NP_420001.1| helicase, putative [Caulobacter cre...   269   3e-70
gi|23508999|ref|NP_701667.1| pre-mRNA splicing factor RNA helica...   268   9e-70
gi|19075550|ref|NP_588050.1| putative pre-mrna splicing factor r...   268   9e-70
gi|40788976|dbj|BAA74913.2| KIAA0890 protein [Homo sapiens]           265   8e-69
gi|20336290|ref|NP_055781.2| DEAH (Asp-Glu-Ala-His) box polypept...   265   8e-69
gi|20336294|ref|NP_619520.1| DEAH (Asp-Glu-Ala-His) box polypept...   265   8e-69
gi|28871855|ref|NP_794474.1| ATP-dependent helicase HrpB [Pseudo...   264   1e-68
gi|15217831|ref|NP_176102.1| helicase domain-containing protein ...   263   2e-68
gi|50306461|ref|XP_453204.1| unnamed protein product [Kluyveromy...   263   2e-68
gi|15599156|ref|NP_252650.1| probable ATP-dependent helicase [Ps...   261   7e-68
gi|19111156|ref|NP_579925.1| HELG [Mus musculus] >gnl|BL_ORD_ID|...   261   7e-68
gi|34866433|ref|XP_345986.1| similar to 2810477H02Rik protein [R...   261   7e-68
gi|13278588|gb|AAH04082.1| Dhx30 protein [Mus musculus]               261   7e-68
gi|16740643|gb|AAH16202.1| Dhx30 protein [Mus musculus]               261   7e-68
gi|27383239|ref|NP_774768.1| helicase [Bradyrhizobium japonicum ...   261   9e-68
gi|42524497|ref|NP_969877.1| helicase [Bdellovibrio bacteriovoru...   259   2e-67
gi|39933612|ref|NP_945888.1| putative ATP-dependent helicase [Rh...   259   3e-67
gi|13474426|ref|NP_105994.1| ATP-dependent helicase [Mesorhizobi...   259   4e-67
gi|15805447|ref|NP_294143.1| ATP-dependent helicase [Deinococcus...   258   6e-67
gi|47220387|emb|CAF98486.1| unnamed protein product [Tetraodon n...   257   1e-66
gi|17988101|ref|NP_540735.1| ATP-DEPENDENT HELICASE HRPB [Brucel...   257   2e-66
gi|50876972|emb|CAG36812.1| related to ATP-dependent helicase [D...   256   3e-66
gi|50290941|ref|XP_447903.1| unnamed protein product [Candida gl...   256   3e-66
gi|48849867|ref|ZP_00304110.1| COG1643: HrpA-like helicases [Nov...   256   4e-66
gi|50764076|ref|XP_422932.1| PREDICTED: similar to putative RNA ...   254   8e-66
gi|24642763|ref|NP_573208.1| CG8915-PA [Drosophila melanogaster]...   254   1e-65
gi|22124707|ref|NP_668130.1| helicase, ATP-dependent [Yersinia p...   253   2e-65
gi|16123543|ref|NP_406856.1| ATP-dependent helicase [Yersinia pe...   253   2e-65
gi|19525735|ref|NP_598376.1| DEAQ box polypeptide 1 (RNA-depende...   252   4e-65
gi|47205228|emb|CAF92278.1| unnamed protein product [Tetraodon n...   252   5e-65
gi|37524876|ref|NP_928220.1| ATP-dependent helicase HrpB [Photor...   251   1e-64
gi|48856900|ref|ZP_00311057.1| COG1643: HrpA-like helicases [Cyt...   251   1e-64
gi|48855270|ref|ZP_00309429.1| COG1643: HrpA-like helicases [Cyt...   250   2e-64
gi|48834408|ref|ZP_00291423.1| COG1643: HrpA-like helicases [Mag...   249   3e-64
gi|26246092|ref|NP_752131.1| ATP-dependent helicase hrpB [Escher...   249   3e-64
gi|26991453|ref|NP_746878.1| ATP-dependent helicase HrpB [Pseudo...   249   3e-64
gi|48862659|ref|ZP_00316554.1| COG1643: HrpA-like helicases [Mic...   249   4e-64
gi|15799832|ref|NP_285844.1| helicase, ATP-dependent [Escherichi...   249   4e-64
gi|15963820|ref|NP_384173.1| ATP-DEPENDENT HELICASE PROTEIN [Sin...   248   6e-64
gi|1213496|gb|AAC45544.1| HelO [Sinorhizobium meliloti]               248   6e-64
gi|23009745|ref|ZP_00050680.1| COG1643: HrpA-like helicases [Mag...   248   6e-64
gi|15887410|ref|NP_353091.1| AGR_C_86p [Agrobacterium tumefacien...   248   6e-64
gi|11359994|pir||T47184 hypothetical protein DKFZp434F1526.1 - h...   248   8e-64
gi|17933977|ref|NP_530767.1| helicase [Agrobacterium tumefaciens...   248   8e-64
gi|21229753|ref|NP_635670.1| ATP-dependent RNA helicase [Xanthom...   248   8e-64
gi|50423967|ref|XP_460568.1| unnamed protein product [Debaryomyc...   248   1e-63
gi|21241067|ref|NP_640649.1| ATP-dependent RNA helicase [Xanthom...   246   2e-63
gi|48729012|ref|ZP_00262765.1| COG1643: HrpA-like helicases [Pse...   246   3e-63
gi|28198417|ref|NP_778731.1| ATP-dependent helicase [Xylella fas...   245   5e-63
gi|23102966|ref|ZP_00089461.1| COG1643: HrpA-like helicases [Azo...   244   1e-62
gi|16128141|ref|NP_414690.1| helicase, ATP-dependent [Escherichi...   244   1e-62
gi|2507332|sp|P37024|HRPB_ECOLI ATP-dependent helicase hrpB           244   1e-62
gi|48765429|ref|ZP_00269979.1| COG1643: HrpA-like helicases [Rho...   243   3e-62
gi|46188126|ref|ZP_00126158.2| COG1643: HrpA-like helicases [Pse...   242   4e-62
gi|22996669|ref|ZP_00040917.1| COG1643: HrpA-like helicases [Xyl...   242   5e-62
gi|45915102|ref|ZP_00193641.2| COG1643: HrpA-like helicases [Mes...   241   7e-62
gi|7507209|pir||T29623 hypothetical protein T05E8.3 - Caenorhabd...   241   9e-62
gi|24111586|ref|NP_706096.1| helicase, ATP-dependent [Shigella f...   241   1e-61
gi|22994030|ref|ZP_00038555.1| COG1643: HrpA-like helicases [Xyl...   240   2e-61
gi|31238779|ref|XP_319844.1| ENSANGP00000016533 [Anopheles gambi...   240   2e-61
gi|15837831|ref|NP_298519.1| ATP-dependent helicase [Xylella fas...   239   5e-61
gi|46914697|emb|CAG21474.1| hypothetical ATP-dependent helicase ...   237   1e-60
gi|23475021|ref|ZP_00130311.1| COG1643: HrpA-like helicases [Des...   236   3e-60
gi|10438089|dbj|BAB15166.1| unnamed protein product [Homo sapiens]    236   4e-60
gi|19074102|ref|NP_584708.1| ATP-DEPENDENT RNA HELICASE (DEAD bo...   235   5e-60
gi|24372223|ref|NP_716265.1| ATP-dependent helicase HrpB [Shewan...   235   5e-60
gi|16759188|ref|NP_454805.1| ATP-dependent helicase HrpB [Salmon...   235   5e-60
gi|15640622|ref|NP_230251.1| ATP-dependent helicase HrpB [Vibrio...   234   1e-59
gi|16763579|ref|NP_459194.1| ATP-dependent helicase [Salmonella ...   234   1e-59
gi|47202371|emb|CAF87546.1| unnamed protein product [Tetraodon n...   233   2e-59
gi|28899272|ref|NP_798877.1| ATP-dependent helicase HrpB [Vibrio...   233   2e-59
gi|46579954|ref|YP_010762.1| ATP-dependent helicase HrpB [Desulf...   229   3e-58
gi|50787562|ref|XP_427757.1| PREDICTED: similar to Dhx32 protein...   229   4e-58
gi|25410882|pir||A84421 probable ATP-dependent RNA helicase A [i...   228   6e-58
gi|20197904|gb|AAM15307.1| putative RNA helicase A [Arabidopsis ...   228   6e-58
gi|15227260|ref|NP_178223.1| helicase domain-containing protein ...   228   6e-58
gi|30694379|ref|NP_175298.2| helicase domain-containing protein ...   228   8e-58
gi|12597813|gb|AAG60124.1| hypothetical protein [Arabidopsis tha...   228   8e-58
gi|32472864|ref|NP_865858.1| ATP-dependent helicase [Pirellula s...   228   8e-58
gi|50122236|ref|YP_051403.1| ATP-dependent helicase [Erwinia car...   227   2e-57
gi|37680941|ref|NP_935550.1| ATP-dependent helicase HrpB [Vibrio...   226   4e-57
gi|46120972|ref|ZP_00173788.2| COG1643: HrpA-like helicases [Met...   223   2e-56
gi|22959231|ref|ZP_00006887.1| COG1643: HrpA-like helicases [Rho...   223   3e-56
gi|27365012|ref|NP_760540.1| ATP-dependent helicase HrpB [Vibrio...   223   3e-56
gi|8118104|gb|AAF72893.1| putative DEAH-box RNA helicase [Trypan...   222   4e-56
gi|29249321|gb|EAA40835.1| GLP_154_26165_28225 [Giardia lamblia ...   222   4e-56
gi|33866711|ref|NP_898270.1| putative HrpA-like helicase [Synech...   220   2e-55
gi|31220368|ref|XP_316913.1| ENSANGP00000006554 [Anopheles gambi...   218   1e-54
gi|29832773|ref|NP_827407.1| putative ATP-dependent RNA helicase...   218   1e-54
gi|1362901|pir||C56236 probable RNA helicase 3 - human (fragment)     215   5e-54
gi|50781891|ref|XP_427509.1| PREDICTED: similar to ATP-dependent...   214   9e-54
gi|29029601|ref|NP_116045.2| DEAH (Asp-Glu-Ala-His) box polypept...   214   2e-53
gi|50756307|ref|XP_415104.1| PREDICTED: similar to DEAH (Asp-Glu...   214   2e-53
gi|38014365|gb|AAH02575.2| DHX37 protein [Homo sapiens]               213   2e-53
gi|7959301|dbj|BAA96041.1| KIAA1517 protein [Homo sapiens]            213   2e-53
gi|26344906|dbj|BAC36102.1| unnamed protein product [Mus musculus]    202   3e-53
gi|21220482|ref|NP_626261.1| putative ATP-binding RNA helicase [...   212   5e-53
gi|34872286|ref|XP_213772.2| similar to DEAH (Asp-Glu-Ala-His) b...   212   5e-53
gi|46390441|dbj|BAD15903.1| putative kurz protein [Oryza sativa ...   212   5e-53
gi|42600571|ref|NP_976064.1| DEAH (Asp-Glu-Ala-His) box polypept...   211   1e-52
gi|27366084|ref|NP_761612.1| HrpA-like helicase [Vibrio vulnific...   210   2e-52
gi|50259111|gb|EAL21788.1| hypothetical protein CNBC4900 [Crypto...   210   2e-52
gi|46164588|ref|ZP_00137398.2| COG1643: HrpA-like helicases [Pse...   209   3e-52
gi|34895324|ref|NP_909005.1| putative ATP-dependent RNA helicase...   209   3e-52
gi|15242161|ref|NP_196994.1| helicase associated (HA2) domain-co...   209   4e-52
gi|10439922|dbj|BAB15596.1| unnamed protein product [Homo sapiens]    208   9e-52
gi|37679649|ref|NP_934258.1| HrpA-like helicase [Vibrio vulnific...   207   1e-51
gi|25026697|ref|NP_736751.1| putative ATP-dependent helicase [Co...   207   1e-51
gi|50752566|ref|XP_422834.1| PREDICTED: similar to DEAH (Asp-Glu...   207   1e-51
gi|38080777|ref|XP_355641.1| similar to DEAH (Asp-Glu-Ala-His) b...   206   3e-51
gi|30794390|ref|NP_082412.1| DEAH (Asp-Glu-Ala-His) box polypept...   206   3e-51
gi|12850145|dbj|BAB28610.1| unnamed protein product [Mus musculus]    206   3e-51
gi|25404184|pir||G96613 hypothetical protein T15M6.7 [imported] ...   206   3e-51
gi|47224961|emb|CAF97376.1| unnamed protein product [Tetraodon n...   206   4e-51
gi|41324368|emb|CAF18708.1| PROBABLE ATP-DEPENDENT RNA HELICASE ...   205   7e-51
gi|23308778|ref|NP_599394.2| HrpA-like helicase [Corynebacterium...   205   7e-51
gi|38232759|ref|NP_938526.1| Putative ATP-dependent helicase [Co...   205   7e-51
gi|34856989|ref|XP_227203.2| similar to DEAD/H box polypeptide 3...   205   7e-51
gi|30696202|ref|NP_176103.2| helicase domain-containing protein ...   204   1e-50
gi|18497286|ref|NP_065916.1| DEAH (Asp-Glu-Ala-His) box polypept...   204   1e-50
gi|7959237|dbj|BAA96012.1| KIAA1488 protein [Homo sapiens]            204   1e-50
gi|46123447|ref|XP_386277.1| hypothetical protein FG06101.1 [Gib...   204   2e-50
gi|30686606|ref|NP_850255.1| helicase domain-containing protein ...   203   2e-50
gi|25408429|pir||F84774 probable ATP-dependent RNA helicase A [i...   203   2e-50
gi|28898033|ref|NP_797638.1| putative ATP-dependent helicase [Vi...   202   5e-50
gi|18087663|gb|AAL58955.1| putative helicase [Oryza sativa]           202   6e-50
gi|41946845|gb|AAH66091.1| DEAH (Asp-Glu-Ala-Asp/His) box polype...   201   8e-50
gi|39573734|ref|NP_945180.1| DEAH (Asp-Glu-Ala-Asp/His) box poly...   201   8e-50
gi|40787832|gb|AAH65169.1| AW494914 protein [Mus musculus]            201   8e-50
gi|31657193|gb|AAH53623.1| DHX57 protein [Homo sapiens]               200   2e-49
gi|39777586|ref|NP_945314.1| DEAH (Asp-Glu-Ala-Asp/His) box poly...   200   2e-49
gi|40850932|gb|AAH65278.1| DHX57 protein [Homo sapiens]               200   2e-49
gi|48098777|ref|XP_392558.1| similar to FLJ21940 protein [Apis m...   200   2e-49
gi|33863906|ref|NP_895466.1| DEAD/DEAH box helicase:Helicase C-t...   199   4e-49
gi|21666020|gb|AAM73547.1| putative DEAH-box RNA/DNA helicase [H...   199   4e-49
gi|31206547|ref|XP_312236.1| ENSANGP00000010281 [Anopheles gambi...   199   5e-49
gi|29248813|gb|EAA40338.1| GLP_22_13030_14940 [Giardia lamblia A...   198   9e-49
gi|34862056|ref|XP_345626.1| similar to DEAH (Asp-Glu-Ala-Asp/Hi...   196   3e-48
gi|12322573|gb|AAG51287.1| helicase, putative [Arabidopsis thali...   196   3e-48
gi|15217524|ref|NP_174605.1| helicase domain-containing protein ...   196   3e-48
gi|50841643|ref|YP_054870.1| ATP-dependent helicase [Propionibac...   196   3e-48
gi|47186963|emb|CAF87137.1| unnamed protein product [Tetraodon n...   192   3e-48
gi|31198025|ref|XP_307960.1| ENSANGP00000013501 [Anopheles gambi...   196   3e-48
gi|50801892|ref|XP_424198.1| PREDICTED: similar to DEAH (Asp-Glu...   194   1e-47
gi|6323776|ref|NP_013847.1| Essential DEAH-box ATP-dependent RNA...   193   2e-47
gi|38103601|gb|EAA50281.1| hypothetical protein MG04040.4 [Magna...   193   3e-47
gi|23478321|gb|EAA15441.1| HelD protein-related [Plasmodium yoel...   192   4e-47
gi|23014192|ref|ZP_00054022.1| COG1643: HrpA-like helicases [Mag...   192   5e-47
gi|45198740|ref|NP_985769.1| AFR222Wp [Eremothecium gossypii] >g...   191   1e-46


>gi|17535281|ref|NP_495019.1| sex determination DEAH box protein,
            posttranscriptional regulatory factor similar to pre-mRNA
            splicing factor ATP-dependent RNA helicase.,
            Masculinisation Of Germline MOG-5 (135.8 kD) (mog-5)
            [Caenorhabditis elegans]
 gi|2500543|sp|Q09530|MOG5_CAEEL Probable pre-mRNA splicing factor
            ATP-dependent RNA helicase mog-5 (Sex determination
            protein mog-5) (Masculinization of germ line protein 5)
 gi|7498394|pir||T15921 hypothetical protein EEED8.5 - Caenorhabditis
            elegans
 gi|733602|gb|AAC46765.1| Masculinisation of germline protein 5
            [Caenorhabditis elegans]
 gi|9864170|gb|AAG01332.1| sex determining protein MOG-5
            [Caenorhabditis elegans]
          Length = 1200

 Score = 1912 bits (4953), Expect = 0.0
 Identities = 960/972 (98%), Positives = 960/972 (98%)
 Frame = +1

Query: 685  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVK 864
            EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVK
Sbjct: 229  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVK 288

Query: 865  VKVNKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGV 1044
            VKVNKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGV
Sbjct: 289  VKVNKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGV 348

Query: 1045 GQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXX 1224
            GQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNY
Sbjct: 349  GQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYDDESDGED 408

Query: 1225 XXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRE 1404
                LVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRE
Sbjct: 409  IEIELVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRE 468

Query: 1405 RDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRR 1584
            RDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRR
Sbjct: 469  RDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRR 528

Query: 1585 TNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKI 1764
            TNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKI
Sbjct: 529  TNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKI 588

Query: 1765 GCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLID 1944
            GCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLID
Sbjct: 589  GCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLID 648

Query: 1945 PDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAP 2124
            PDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAP
Sbjct: 649  PDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAP 708

Query: 2125 IFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVL 2304
            IFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVL
Sbjct: 709  IFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVL 768

Query: 2305 YERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFY 2484
            YERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFY
Sbjct: 769  YERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFY 828

Query: 2485 VVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEML 2664
            VVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEML
Sbjct: 829  VVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEML 888

Query: 2665 PTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLL 2844
            PTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLL
Sbjct: 889  PTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLL 948

Query: 2845 TKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKA 3024
            TKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKA
Sbjct: 949  TKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKA 1008

Query: 3025 KFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLM 3204
            KFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLM
Sbjct: 1009 KFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLM 1068

Query: 3205 VSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHE 3384
            VSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHE
Sbjct: 1069 VSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHE 1128

Query: 3385 LVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRI 3564
            LVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRI
Sbjct: 1129 LVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRI 1188

Query: 3565 TRVKKRIYNPNK 3600
            TRVKKRIYNPNK
Sbjct: 1189 TRVKKRIYNPNK 1200



 Score =  274 bits (701), Expect = 1e-71
 Identities = 143/149 (95%), Positives = 143/149 (95%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 180
           MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD
Sbjct: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 60

Query: 181 SLTATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAK 360
           SLTATILRIVQSMTAV      GGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAK
Sbjct: 61  SLTATILRIVQSMTAVKKKNKKGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAK 120

Query: 361 EKEDNEDDLMAQLEKMEGRYESEKRLQKE 447
           EKEDNEDDLMAQLEKMEGRYESEKRLQKE
Sbjct: 121 EKEDNEDDLMAQLEKMEGRYESEKRLQKE 149


>gi|39596868|emb|CAE59095.1| Hypothetical protein CBG02387
            [Caenorhabditis briggsae]
          Length = 1205

 Score = 1849 bits (4789), Expect = 0.0
 Identities = 921/972 (94%), Positives = 946/972 (96%)
 Frame = +1

Query: 685  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVK 864
            EVAE+GKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQI+NERVQ+VADVLKRG+ VK
Sbjct: 235  EVAEVGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIKNERVQSVADVLKRGQAVK 294

Query: 865  VKVNKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGV 1044
            VKVNKIENGK S +MKEVDQ +GEDLNP+ETDL+PDAIGVRPRTPPA TSSWMNPE+S
Sbjct: 295  VKVNKIENGKTSFTMKEVDQQTGEDLNPKETDLDPDAIGVRPRTPPAHTSSWMNPESSS- 353

Query: 1045 GQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXX 1224
              GPSTS+GGGK RVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVL+N+
Sbjct: 354  SAGPSTSMGGGKTRVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLKNFDDESDGED 413

Query: 1225 XXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRE 1404
                LVE+EPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRE
Sbjct: 414  IEIELVEEEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRE 473

Query: 1405 RDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRR 1584
            RDMD QKGFSSNARILDPMSGNQ++AW+ADESKDRNNKMKEMPEWLKHVTAGGKATYG+R
Sbjct: 474  RDMDNQKGFSSNARILDPMSGNQASAWTADESKDRNNKMKEMPEWLKHVTAGGKATYGKR 533

Query: 1585 TNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKI 1764
            TNLSM+EQRESLPIFALKK L+EA+IDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKI
Sbjct: 534  TNLSMIEQRESLPIFALKKKLIEAIIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKI 593

Query: 1765 GCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLID 1944
            GCTQPRRVAAMSVAKRVAEEYGCKLG+DVGYTIRFEDCTSQDT+IKYMTDGMLLRECLID
Sbjct: 594  GCTQPRRVAAMSVAKRVAEEYGCKLGSDVGYTIRFEDCTSQDTVIKYMTDGMLLRECLID 653

Query: 1945 PDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAP 2124
            PDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAP
Sbjct: 654  PDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAP 713

Query: 2125 IFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVL 2304
            IFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGD+LVFLTGQEEIDTSCEVL
Sbjct: 714  IFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDILVFLTGQEEIDTSCEVL 773

Query: 2305 YERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFY 2484
            YERMKSMGPDVPELIILPVYGALPSEMQTRIF+PAPAGKRKVVIATNIAETSLTIDGIFY
Sbjct: 774  YERMKSMGPDVPELIILPVYGALPSEMQTRIFEPAPAGKRKVVIATNIAETSLTIDGIFY 833

Query: 2485 VVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEML 2664
            VVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEML
Sbjct: 834  VVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEML 893

Query: 2665 PTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLL 2844
            PTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLL
Sbjct: 894  PTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLL 953

Query: 2845 TKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKA 3024
            TKLGRRMAEFPLEPSL+KLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKA
Sbjct: 954  TKLGRRMAEFPLEPSLAKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKA 1013

Query: 3025 KFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLM 3204
            KFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLM
Sbjct: 1014 KFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLM 1073

Query: 3205 VSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHE 3384
            VSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQ QPEWVVYHE
Sbjct: 1074 VSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQHQPEWVVYHE 1133

Query: 3385 LVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRI 3564
            LVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYAD NAWRI
Sbjct: 1134 LVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADPNAWRI 1193

Query: 3565 TRVKKRIYNPNK 3600
            TRVKKRIYNPNK
Sbjct: 1194 TRVKKRIYNPNK 1205



 Score =  220 bits (560), Expect = 2e-55
 Identities = 114/148 (77%), Positives = 122/148 (82%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 180
           MDQLEHLSLVSKVL E+ENHFGV +KDVAEFVI +AQEN TFDK KK L+ QGL DQFDD
Sbjct: 1   MDQLEHLSLVSKVLGELENHFGVADKDVAEFVIQMAQENSTFDKFKKELEKQGLADQFDD 60

Query: 181 SLTATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAK 360
           SLTATILRIVQ MTA        GDSKED+KDSHKITLISDAKEEIKARLPALAMAN
Sbjct: 61  SLTATILRIVQHMTASKKKSKKAGDSKEDVKDSHKITLISDAKEEIKARLPALAMANITI 120

Query: 361 EKEDNEDDLMAQLEKMEGRYESEKRLQK 444
           EKED+ +DLMAQLE MEG+YE EK   K
Sbjct: 121 EKEDSGNDLMAQLEMMEGKYEKEKNRDK 148


>gi|31199251|ref|XP_308573.1| ENSANGP00000015955 [Anopheles gambiae]
 gi|30178733|gb|EAA04624.2| ENSANGP00000015955 [Anopheles gambiae str.
            PEST]
          Length = 1257

 Score = 1333 bits (3449), Expect = 0.0
 Identities = 667/971 (68%), Positives = 798/971 (81%), Gaps = 5/971 (0%)
 Frame = +1

Query: 685  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENV 861
            E  E G IYDGRV +I +FG F+ L GFR+K+EGLVHISQ+  E RV  V DV+ RG+ V
Sbjct: 292  EEPEPGHIYDGRVVNIVAFGCFVQLNGFRRKKEGLVHISQLSTEGRVNLVTDVVNRGDEV 351

Query: 862  KVKVNKIENGKISLSMKEVDQNSGEDLNPRE----TDLNPDAIGVRPRTPPASTSSWMNP 1029
            KVKV  +   KISLSMKEV+Q+SG DLNP       +      G R    P +  S +N
Sbjct: 352  KVKVMSLAGNKISLSMKEVEQSSGRDLNPLSHAHLKEGGDGEAGARNPDRPMTVPSMLNL 411

Query: 1030 EASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXX 1209
            +   + Q   TS    K   RIS+PERWE++QM  +GV+  ++MPDFDEE G+L
Sbjct: 412  QEGTLEQVEETS---RKKVTRISSPERWEIKQMISSGVIDRSEMPDFDEETGLLPK--DE 466

Query: 1210 XXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKI 1389
                     +VEDEP FL+G+G+   ++ PV++VKNPDGSLAQAA+MQ AL+KER+E K+
Sbjct: 467  DSEADIEIEIVEDEPPFLQGHGRALHDLSPVRIVKNPDGSLAQAAMMQTALAKERREQKM 526

Query: 1390 QAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKA 1569
              QRE++MD     + N   +DP+        +A  ++      +++PEW K +  G K+
Sbjct: 527  -LQREQEMDAVPT-NMNKNWIDPLPDEDDERTAASNTRGVGMSTQDVPEWKKAIIGGKKS 584

Query: 1570 TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLG 1749
            ++GR+T++S+VEQR+SLPI+ L+ +L++A+ DNQIL+V+GETGSGKTTQ+TQY  E+G
Sbjct: 585  SFGRKTDMSLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLAESGFI 644

Query: 1750 RRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLR 1929
             RGKIGCTQPRRVAAMSVAKRVAEEYGC+LG +VGYTIRFEDCTSQ+T+IKYMTDGMLLR
Sbjct: 645  ARGKIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSQETVIKYMTDGMLLR 704

Query: 1930 ECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEY 2109
            ECL+D DL  YS+IMLDEAHERTIHTDVLFGLLK A +KRPELKLI+TSATLD+VKFS+Y
Sbjct: 705  ECLVDFDLKSYSVIMLDEAHERTIHTDVLFGLLKQAVQKRPELKLIVTSATLDAVKFSQY 764

Query: 2110 FLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDT 2289
            F EAPIFTIPGRTFPVEILYT+EPE+DYL+A+ ITVMQIHL EPPGDVL+FLTGQEEIDT
Sbjct: 765  FFEAPIFTIPGRTFPVEILYTKEPETDYLDASLITVMQIHLREPPGDVLLFLTGQEEIDT 824

Query: 2290 SCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTI 2469
            +CE+LYERMKS+GPDVPELIILPVY ALPSEMQTRIFDPAP G RKVVIATNIAETSLTI
Sbjct: 825  ACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTI 884

Query: 2470 DGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAF 2649
            DGI+YVVDPGFVKQK+YN K+GMDSLVVTPISQAAAKQR+GRAGRTGPGK YRLYTERA+
Sbjct: 885  DGIYYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKAYRLYTERAY 944

Query: 2650 RDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALD 2829
            RDEMLPTPVPEIQRTNLA+T+LQLK MGIN+L+ FDFMDAPP++S++ AL  LH+LSALD
Sbjct: 945  RDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALD 1004

Query: 2830 GDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHA 3009
             +GLLT+LGRRMAEFPLEP+LSKLLIMSV L CS+EVLTIV+ML+VQN+FYRPK+KQ  A
Sbjct: 1005 NEGLLTRLGRRMAEFPLEPNLSKLLIMSVALQCSDEVLTIVSMLSVQNVFYRPKDKQALA 1064

Query: 3010 DQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDR 3189
            DQKKAKF+Q EGDHLTLLAVYNSWKN+ FS  WC+ENF+Q+R++KRAQD+RKQLLGIMDR
Sbjct: 1065 DQKKAKFNQIEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDR 1124

Query: 3190 HKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEW 3369
            HKL +VS G++  RVQKAICSGFFRNAAK+DPQEGYRTL D Q VYIHPSSA F +QPEW
Sbjct: 1125 HKLDVVSAGKNTVRVQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEW 1184

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADA 3549
            VVYHELV TTKEYMREVT IDPKWLVEFAP+FF+  D TKLS FK+NQ+++PL++KY +
Sbjct: 1185 VVYHELVQTTKEYMREVTTIDPKWLVEFAPAFFRFSDPTKLSKFKKNQRLEPLYNKYEEP 1244

Query: 3550 NAWRITRVKKR 3582
            NAWRI+R ++R
Sbjct: 1245 NAWRISRTRRR 1255



 Score = 87.0 bits (214), Expect = 3e-15
 Identities = 53/151 (35%), Positives = 82/151 (54%), Gaps = 3/151 (1%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 180
           ++QLEHLSLVSK+ +E+ENH G+ +KD+AEF+I LA +NPT +  K+ L   G   +F D
Sbjct: 4   LEQLEHLSLVSKICTELENHLGLNDKDLAEFIIDLAHKNPTIEAFKRVLVENGA--EFSD 61

Query: 181 SLTATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAK 360
           S T  +LRI+Q M             ++D  D + +            + P LA+ N  K
Sbjct: 62  SFTTNLLRIIQLMKPAGKQSTSA--FEDDANDGNNLAY----------KFPGLAIPNNKK 109

Query: 361 ---EKEDNEDDLMAQLEKMEGRYESEKRLQK 444
                E+ EDD     +++E +Y+ +K  +K
Sbjct: 110 AYSSDEEAEDDTKHDKKRIE-KYKDKKEEKK 139


>gi|20129977|ref|NP_610928.1| CG8241-PA [Drosophila melanogaster]
 gi|7303231|gb|AAF58294.1| CG8241-PA [Drosophila melanogaster]
          Length = 1242

 Score = 1318 bits (3412), Expect = 0.0
 Identities = 660/967 (68%), Positives = 802/967 (82%), Gaps = 4/967 (0%)
 Frame = +1

Query: 694  EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENVKVK 870
            E GKIY G++ +I  FG F+ L G R++ EGLVHISQ+R E RV  V +V+ R + VKVK
Sbjct: 283  EAGKIYSGKIANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVK 342

Query: 871  VNKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPP---ASTSSWMNPEASG 1041
            V  I   K+SLSMKEVDQ+SG+DLNP       D   +R R P    +S++S +N + +G
Sbjct: 343  VMSITGQKVSLSMKEVDQDSGKDLNPLSHAPEDDE-SLRDRNPDGPFSSSTSMLNLQGNG 401

Query: 1042 VGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXX 1221
            +      S    K   RIS+PERWE++QM  +GVL  ++MPDFDEE G+L
Sbjct: 402  MEGDEHES---RKRVTRISSPERWEIKQMISSGVLDRSEMPDFDEETGLLPK--DEDDEA 456

Query: 1222 XXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQR 1401
                 +VE+EP FL G+G+   ++ PV++VKNPDGSLAQAA+MQ ALSKER+E K+  QR
Sbjct: 457  DIEIEIVEEEPPFLSGHGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQKM-LQR 515

Query: 1402 ERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGR 1581
            E++++     S N   +DP+  ++S + +A+  +       E+PEW KHV  G K+++G+
Sbjct: 516  EQEIEAMPT-SLNKNWIDPLPEDESRSLAAN-MRGMAAAPPEVPEWKKHVIGGKKSSFGK 573

Query: 1582 RTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGK 1761
            +T+L++VEQR+SLPI+ L+ +L++A+ DNQIL+V+GETGSGKTTQ+TQY  E G   RGK
Sbjct: 574  KTDLTLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGK 633

Query: 1762 IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLI 1941
            IGCTQPRRVAAMSVAKRVAEEYGC+LG +VGYTIRFEDCTS +TIIKYMTDGMLLRECL+
Sbjct: 634  IGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLM 693

Query: 1942 DPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEA 2121
            + +L  YS+IMLDEAHERTIHTDVLFGLLK A +KRPELKLI+TSATLD+VKFS+YF +A
Sbjct: 694  EAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKA 753

Query: 2122 PIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEV 2301
            PIFTIPGRTFPVE+LYT+EPE+DYL+A+ ITVMQIHL EPPGD+L+FLTGQEEIDT+CE+
Sbjct: 754  PIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEI 813

Query: 2302 LYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIF 2481
            LYERMKS+GPDVPELIILPVY ALPSEMQTRIFDPAPAG RKVVIATNIAETSLTIDGIF
Sbjct: 814  LYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIF 873

Query: 2482 YVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEM 2661
            YVVDPGFVKQK+YN K+GMDSLVVTPISQAAAKQR+GRAGRTGPGK YRLYTERA+RDEM
Sbjct: 874  YVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEM 933

Query: 2662 LPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGL 2841
            LPTPVPEIQRTNLA+T+LQLK MGIN+L+ FDFMDAPP++S++ AL  LH+LSALD +GL
Sbjct: 934  LPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGL 993

Query: 2842 LTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKK 3021
            LT+LGRRMAEFPLEP+LSK+LIMSV L CS+E+LTIV+ML+VQN+FYRPK+KQ  ADQKK
Sbjct: 994  LTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKK 1053

Query: 3022 AKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLL 3201
            AKF+Q EGDHLTLLAVYNSWKN+ FS  WC+ENF+Q+R++KR+QD+RKQLLGIMDRHKL
Sbjct: 1054 AKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLD 1113

Query: 3202 MVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYH 3381
            +VS G++  R+QKAICSGFFRNAAK+DPQEGYRTL D Q VYIHPSSA F +QPEWV+YH
Sbjct: 1114 VVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYH 1173

Query: 3382 ELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWR 3561
            ELV TTKEYMREVT IDPKWLVEFAPSFF+  D TKLS FK+NQ+++PL++KY + NAWR
Sbjct: 1174 ELVQTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWR 1233

Query: 3562 ITRVKKR 3582
            I+RV++R
Sbjct: 1234 ISRVRRR 1240



 Score = 83.2 bits (204), Expect = 4e-14
 Identities = 53/150 (35%), Positives = 82/150 (54%), Gaps = 1/150 (0%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 180
           + +LE+LSLVSK+ +E++NH G+ +KD+AEF+I L  +N T+D  +KAL   G   +F D
Sbjct: 4   LQKLEYLSLVSKICTELDNHLGINDKDLAEFIIDLENKNRTYDTFRKALLDNGA--EFPD 61

Query: 181 SLTATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMAN-TA 357
           SL   + RI+  M         GG S+E      K     D K ++    P LA+ N T
Sbjct: 62  SLVQNLQRIINLMRP----SRPGGASQEKTVGDKK----EDKKSQLLKMFPGLALPNDTY 113

Query: 358 KEKEDNEDDLMAQLEKMEGRYESEKRLQKE 447
            +KE+++DD     EK++ + E      K+
Sbjct: 114 SKKEESDDD-----EKVKAKPEKHSETHKK 138


>gi|21428730|gb|AAM50025.1| SD07467p [Drosophila melanogaster]
          Length = 1242

 Score = 1317 bits (3409), Expect = 0.0
 Identities = 659/967 (68%), Positives = 802/967 (82%), Gaps = 4/967 (0%)
 Frame = +1

Query: 694  EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENVKVK 870
            E GKIY G++ +I  FG F+ L G R++ EGLVHISQ+R E RV  V +V+ R + VKVK
Sbjct: 283  EAGKIYSGKIANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVKVK 342

Query: 871  VNKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPP---ASTSSWMNPEASG 1041
            V  I   K+SLSMKEVDQ+SG+DLNP       D   +R R P    +S++S +N + +G
Sbjct: 343  VMSITGQKVSLSMKEVDQDSGKDLNPLSHAPEDDE-SLRDRNPDGPFSSSTSMLNLQGNG 401

Query: 1042 VGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXX 1221
            +      S    K   RIS+PERWE++QM  +GVL  ++MPDFDEE G+L
Sbjct: 402  MEGDEHES---RKRVTRISSPERWEIKQMISSGVLDRSEMPDFDEETGLLPK--DEDDEA 456

Query: 1222 XXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQR 1401
                 +VE+EP FL G+G+   ++ PV++VKNPDGSLAQAA+MQ ALSKER+E ++  QR
Sbjct: 457  DIEIEIVEEEPPFLSGHGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQRM-LQR 515

Query: 1402 ERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGR 1581
            E++++     S N   +DP+  ++S + +A+  +       E+PEW KHV  G K+++G+
Sbjct: 516  EQEIEAMPT-SLNKNWIDPLPEDESRSLAAN-MRGMAAAPPEVPEWKKHVIGGKKSSFGK 573

Query: 1582 RTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGK 1761
            +T+L++VEQR+SLPI+ L+ +L++A+ DNQIL+V+GETGSGKTTQ+TQY  E G   RGK
Sbjct: 574  KTDLTLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGK 633

Query: 1762 IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLI 1941
            IGCTQPRRVAAMSVAKRVAEEYGC+LG +VGYTIRFEDCTS +TIIKYMTDGMLLRECL+
Sbjct: 634  IGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLM 693

Query: 1942 DPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEA 2121
            + +L  YS+IMLDEAHERTIHTDVLFGLLK A +KRPELKLI+TSATLD+VKFS+YF +A
Sbjct: 694  EAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKA 753

Query: 2122 PIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEV 2301
            PIFTIPGRTFPVE+LYT+EPE+DYL+A+ ITVMQIHL EPPGD+L+FLTGQEEIDT+CE+
Sbjct: 754  PIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEI 813

Query: 2302 LYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIF 2481
            LYERMKS+GPDVPELIILPVY ALPSEMQTRIFDPAPAG RKVVIATNIAETSLTIDGIF
Sbjct: 814  LYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIF 873

Query: 2482 YVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEM 2661
            YVVDPGFVKQK+YN K+GMDSLVVTPISQAAAKQR+GRAGRTGPGK YRLYTERA+RDEM
Sbjct: 874  YVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEM 933

Query: 2662 LPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGL 2841
            LPTPVPEIQRTNLA+T+LQLK MGIN+L+ FDFMDAPP++S++ AL  LH+LSALD +GL
Sbjct: 934  LPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGL 993

Query: 2842 LTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKK 3021
            LT+LGRRMAEFPLEP+LSK+LIMSV L CS+E+LTIV+ML+VQN+FYRPK+KQ  ADQKK
Sbjct: 994  LTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKK 1053

Query: 3022 AKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLL 3201
            AKF+Q EGDHLTLLAVYNSWKN+ FS  WC+ENF+Q+R++KR+QD+RKQLLGIMDRHKL
Sbjct: 1054 AKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLD 1113

Query: 3202 MVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYH 3381
            +VS G++  R+QKAICSGFFRNAAK+DPQEGYRTL D Q VYIHPSSA F +QPEWV+YH
Sbjct: 1114 VVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYH 1173

Query: 3382 ELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWR 3561
            ELV TTKEYMREVT IDPKWLVEFAPSFF+  D TKLS FK+NQ+++PL++KY + NAWR
Sbjct: 1174 ELVQTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWR 1233

Query: 3562 ITRVKKR 3582
            I+RV++R
Sbjct: 1234 ISRVRRR 1240



 Score = 83.2 bits (204), Expect = 4e-14
 Identities = 53/150 (35%), Positives = 82/150 (54%), Gaps = 1/150 (0%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 180
           + +LE+LSLVSK+ +E++NH G+ +KD+AEF+I L  +N T+D  +KAL   G   +F D
Sbjct: 4   LQKLEYLSLVSKICTELDNHLGINDKDLAEFIIDLENKNRTYDTFRKALLDNGA--EFPD 61

Query: 181 SLTATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMAN-TA 357
           SL   + RI+  M         GG S+E      K     D K ++    P LA+ N T
Sbjct: 62  SLVQNLQRIINLMRP----SRPGGASQEKTVGDKK----EDKKSQLLKMFPGLALPNDTY 113

Query: 358 KEKEDNEDDLMAQLEKMEGRYESEKRLQKE 447
            +KE+++DD     EK++ + E      K+
Sbjct: 114 SKKEESDDD-----EKVKAKPEKHSETHKK 138


>gi|34873791|ref|XP_213460.2| similar to ATP-dependent helicase DDX8
            (RNA helicase HRH1) (DEAH-box protein 8) [Rattus
            norvegicus]
          Length = 1242

 Score = 1302 bits (3370), Expect = 0.0
 Identities = 658/971 (67%), Positives = 782/971 (79%), Gaps = 5/971 (0%)
 Frame = +1

Query: 685  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENV 861
            E   IG IY+G+V SI  FG F+ LEG R++ EGLVHIS++R E RV  VADV+ +G+ V
Sbjct: 282  EEPAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRV 341

Query: 862  KVKVNKIENGKISLSMKEVDQNSGEDLNP-RETDL---NPDAIGVRPRTPPASTSSWMNP 1029
            KVKV      K SLSMK+VDQ +GEDLNP R  +L     +   +R    P   S    P
Sbjct: 342  KVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAP 401

Query: 1030 EASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXX 1209
            E               K   RIS PE+WE++QM  A VL+  + PDFDEE G+L
Sbjct: 402  EVEDDSLER-------KRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDE 454

Query: 1210 XXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKI 1389
                     LVE+EP FLRG+ K   ++ P+K+VKNPDGSL+QAA+MQ AL+KER+E K
Sbjct: 455  EDEDLEIE-LVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELK- 512

Query: 1390 QAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKA 1569
            QAQRE +MD+      N   +DP+   +    +A+  +       ++PEW KH   G KA
Sbjct: 513  QAQREAEMDSIP-MGLNKHWVDPLPDAEGRQIAAN-MRGIGMMPNDIPEWKKHAFGGNKA 570

Query: 1570 TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLG 1749
            +YG++T +S++EQRESLPI+ LK+ L++A+ DNQIL+V+GETGSGKTTQ+TQY  EAG
Sbjct: 571  SYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYT 630

Query: 1750 RRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLR 1929
             RGKIGCTQPRRVAAMSVAKRV+EE+GC LG +VGYTIRFEDCTS +T+IKYMTDGMLLR
Sbjct: 631  SRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLR 690

Query: 1930 ECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEY 2109
            ECLIDPDL+ Y++IMLDEAHERTIHTDVLFGLLK   +KR ++KLI+TSATLD+VKFS+Y
Sbjct: 691  ECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQY 750

Query: 2110 FLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDT 2289
            F EAPIFTIPGRT+PVEILYT+EPE+DYL+A+ ITVMQIHLTEPPGD+LVFLTGQEEIDT
Sbjct: 751  FYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDT 810

Query: 2290 SCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTI 2469
            +CE+LYERMKS+GPDVPELIILPVY ALPSEMQTRIFDPAP G RKVVIATNIAETSLTI
Sbjct: 811  ACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTI 870

Query: 2470 DGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAF 2649
            DGI+YVVDPGFVKQK+YN K+G+D LVVTPISQA AKQR+GRAGRTGPGKCYRLYTERA+
Sbjct: 871  DGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAY 930

Query: 2650 RDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALD 2829
            RDEML T VPEIQRTNLAST+L LKAMGIN+L+ FDFMDAPP++++ITA+  L+TL ALD
Sbjct: 931  RDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALD 990

Query: 2830 GDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHA 3009
             +GLLT+LGRRMAEFPLEP L K+LIMSV LGCSEE+LTIV+ML+VQN+FYRPK+KQ  A
Sbjct: 991  DEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALA 1050

Query: 3010 DQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDR 3189
            DQKKAKFHQ EGDHLTLLAVYNSWKN+ FS PWC+ENFIQ RS++RAQDIRKQ+LGIMDR
Sbjct: 1051 DQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDR 1110

Query: 3190 HKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEW 3369
            HKL +VSCG+   RVQKAICSGFFRNAAK+DPQEGYRTL D Q VYIHPSSA F +QPEW
Sbjct: 1111 HKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEW 1170

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADA 3549
            VVYHELV+TTKEYMREVT IDP+WLVEFAP+FFK+ D TKLS  K+ Q+++PL+++Y +
Sbjct: 1171 VVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEP 1230

Query: 3550 NAWRITRVKKR 3582
            NAWRI+R  +R
Sbjct: 1231 NAWRISRAFRR 1241



 Score = 75.1 bits (183), Expect = 1e-11
 Identities = 37/71 (52%), Positives = 54/71 (75%)
 Frame = +1

Query: 7   QLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSL 186
           +LE+LSLVSKV +E++NH G+ +KD+AEFVI LA++N TFD  K +L   G   +F DSL
Sbjct: 24  KLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKASLVKNGA--EFTDSL 81

Query: 187 TATILRIVQSM 219
            + +LR++Q+M
Sbjct: 82  ISNLLRLIQTM 92


>gi|4826690|ref|NP_004932.1| DEAH (Asp-Glu-Ala-His) box polypeptide 8;
            DEAH-box protein 8; DEAD/H (Asp-Glu-Ala-Asp/His) box
            polypeptide 8 (RNA helicase) [Homo sapiens]
 gi|3023637|sp|Q14562|DHX8_HUMAN ATP-dependent helicase DHX8 (RNA
            helicase HRH1) (DEAH-box protein 8)
 gi|1362899|pir||A56236 probable RNA helicase 1 - human
 gi|807817|dbj|BAA09078.1| RNA helicase [Homo sapiens]
          Length = 1220

 Score = 1302 bits (3370), Expect = 0.0
 Identities = 658/971 (67%), Positives = 782/971 (79%), Gaps = 5/971 (0%)
 Frame = +1

Query: 685  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENV 861
            E   IG IY+G+V SI  FG F+ LEG R++ EGLVHIS++R E RV  VADV+ +G+ V
Sbjct: 260  EEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRV 319

Query: 862  KVKVNKIENGKISLSMKEVDQNSGEDLNP-RETDL---NPDAIGVRPRTPPASTSSWMNP 1029
            KVKV      K SLSMK+VDQ +GEDLNP R  +L     +   +R    P   S    P
Sbjct: 320  KVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAP 379

Query: 1030 EASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXX 1209
            E               K   RIS PE+WE++QM  A VL+  + PDFDEE G+L
Sbjct: 380  EVEDDSLER-------KRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDE 432

Query: 1210 XXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKI 1389
                     LVE+EP FLRG+ K   ++ P+K+VKNPDGSL+QAA+MQ AL+KER+E K
Sbjct: 433  EDEDLEIE-LVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELK- 490

Query: 1390 QAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKA 1569
            QAQRE +MD+      N   +DP+   +    +A+  +       ++PEW KH   G KA
Sbjct: 491  QAQREAEMDSIP-MGLNKHWVDPLPDAEGRQIAAN-MRGIGMMPNDIPEWKKHAFGGNKA 548

Query: 1570 TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLG 1749
            +YG++T +S++EQRESLPI+ LK+ L++A+ DNQIL+V+GETGSGKTTQ+TQY  EAG
Sbjct: 549  SYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYT 608

Query: 1750 RRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLR 1929
             RGKIGCTQPRRVAAMSVAKRV+EE+GC LG +VGYTIRFEDCTS +T+IKYMTDGMLLR
Sbjct: 609  SRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLR 668

Query: 1930 ECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEY 2109
            ECLIDPDL+ Y++IMLDEAHERTIHTDVLFGLLK   +KR ++KLI+TSATLD+VKFS+Y
Sbjct: 669  ECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQY 728

Query: 2110 FLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDT 2289
            F EAPIFTIPGRT+PVEILYT+EPE+DYL+A+ ITVMQIHLTEPPGD+LVFLTGQEEIDT
Sbjct: 729  FYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDT 788

Query: 2290 SCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTI 2469
            +CE+LYERMKS+GPDVPELIILPVY ALPSEMQTRIFDPAP G RKVVIATNIAETSLTI
Sbjct: 789  ACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTI 848

Query: 2470 DGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAF 2649
            DGI+YVVDPGFVKQK+YN K+G+D LVVTPISQA AKQR+GRAGRTGPGKCYRLYTERA+
Sbjct: 849  DGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAY 908

Query: 2650 RDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALD 2829
            RDEML T VPEIQRTNLAST+L LKAMGIN+L+ FDFMDAPP++++ITA+  L+TL ALD
Sbjct: 909  RDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALD 968

Query: 2830 GDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHA 3009
             +GLLT+LGRRMAEFPLEP L K+LIMSV LGCSEE+LTIV+ML+VQN+FYRPK+KQ  A
Sbjct: 969  DEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALA 1028

Query: 3010 DQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDR 3189
            DQKKAKFHQ EGDHLTLLAVYNSWKN+ FS PWC+ENFIQ RS++RAQDIRKQ+LGIMDR
Sbjct: 1029 DQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDR 1088

Query: 3190 HKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEW 3369
            HKL +VSCG+   RVQKAICSGFFRNAAK+DPQEGYRTL D Q VYIHPSSA F +QPEW
Sbjct: 1089 HKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEW 1148

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADA 3549
            VVYHELV+TTKEYMREVT IDP+WLVEFAP+FFK+ D TKLS  K+ Q+++PL+++Y +
Sbjct: 1149 VVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEP 1208

Query: 3550 NAWRITRVKKR 3582
            NAWRI+R  +R
Sbjct: 1209 NAWRISRAFRR 1219



 Score = 75.1 bits (183), Expect = 1e-11
 Identities = 37/71 (52%), Positives = 54/71 (75%)
 Frame = +1

Query: 7   QLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSL 186
           +LE+LSLVSKV +E++NH G+ +KD+AEFVI LA++N TFD  K +L   G   +F DSL
Sbjct: 24  KLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKASLVKNGA--EFTDSL 81

Query: 187 TATILRIVQSM 219
            + +LR++Q+M
Sbjct: 82  ISNLLRLIQTM 92


>gi|27882034|gb|AAH44586.1| DHX8 protein [Homo sapiens]
          Length = 1214

 Score = 1301 bits (3366), Expect = 0.0
 Identities = 657/971 (67%), Positives = 782/971 (79%), Gaps = 5/971 (0%)
 Frame = +1

Query: 685  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENV 861
            E   IG IY+G+V SI  FG F+ LEG R++ EGLVHIS++R E RV  VADV+ +G+ V
Sbjct: 254  EEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRV 313

Query: 862  KVKVNKIENGKISLSMKEVDQNSGEDLNP-RETDL---NPDAIGVRPRTPPASTSSWMNP 1029
            KVKV      K SLSMK+VDQ +GEDLNP R  +L     +   +R    P   S    P
Sbjct: 314  KVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAP 373

Query: 1030 EASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXX 1209
            E               K   RIS PE+WE++QM  A VL+  + PDFDEE G+L
Sbjct: 374  EVEDDSLER-------KRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDE 426

Query: 1210 XXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKI 1389
                     LVE+EP FLRG+ K   ++ P+K+VKNPDGSL+QAA+MQ AL+KER+E K
Sbjct: 427  EDEDLEIE-LVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELK- 484

Query: 1390 QAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKA 1569
            QAQRE +MD+      N   +DP+   +    +A+  +       ++PEW KH   G KA
Sbjct: 485  QAQREAEMDSIP-MGLNKHWVDPLPDAEGRQIAAN-MRGIGMMPNDIPEWKKHAFGGNKA 542

Query: 1570 TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLG 1749
            +YG++T +S++EQRESLPI+ LK+ L++A+ DNQIL+V+GETGSGKTTQ+TQY  EAG
Sbjct: 543  SYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYT 602

Query: 1750 RRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLR 1929
             RGKIGCTQPRRVAAMSVAKRV+EE+GC LG +VGYTIRFEDCTS +T+IKYMTDGMLLR
Sbjct: 603  SRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLR 662

Query: 1930 ECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEY 2109
            ECLIDPDL+ Y++IMLDEAHERTIHTDVLFGLLK   +KR ++KLI+TSATLD+VKFS+Y
Sbjct: 663  ECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQY 722

Query: 2110 FLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDT 2289
            F EAPIFTIPGRT+PVEILYT+EPE+DYL+A+ ITVMQIHLTEPPGD+LVFLTGQEEIDT
Sbjct: 723  FYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDT 782

Query: 2290 SCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTI 2469
            +CE+LYERMKS+GPDVPELIILPVY ALPSEMQTRIFDPAP G RKVVIATNIAETSLTI
Sbjct: 783  ACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTI 842

Query: 2470 DGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAF 2649
            DGI+YVVDPGFVKQK+YN K+G+D LVVTPISQA AKQR+GRAGRTGPGKCYRLYTERA+
Sbjct: 843  DGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAY 902

Query: 2650 RDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALD 2829
            RDEML T VPEIQRTNLAST+L LKAMGIN+L+ FDFMDAPP++++ITA+  L+TL ALD
Sbjct: 903  RDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALD 962

Query: 2830 GDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHA 3009
             +GLLT+LGRRMAEFPLEP L K+LIMSV LGCSEE+LTIV+ML+VQN+FYRPK+KQ  A
Sbjct: 963  DEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALA 1022

Query: 3010 DQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDR 3189
            DQKKAKFHQ EGDHLTLLAVYNSWKN+ FS PWC+ENFI+ RS++RAQDIRKQ+LGIMDR
Sbjct: 1023 DQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIKARSLRRAQDIRKQMLGIMDR 1082

Query: 3190 HKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEW 3369
            HKL +VSCG+   RVQKAICSGFFRNAAK+DPQEGYRTL D Q VYIHPSSA F +QPEW
Sbjct: 1083 HKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEW 1142

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADA 3549
            VVYHELV+TTKEYMREVT IDP+WLVEFAP+FFK+ D TKLS  K+ Q+++PL+++Y +
Sbjct: 1143 VVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEP 1202

Query: 3550 NAWRITRVKKR 3582
            NAWRI+R  +R
Sbjct: 1203 NAWRISRAFRR 1213



 Score = 75.1 bits (183), Expect = 1e-11
 Identities = 37/71 (52%), Positives = 54/71 (75%)
 Frame = +1

Query: 7   QLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSL 186
           +LE+LSLVSKV +E++NH G+ +KD+AEFVI LA++N TFD  K +L   G   +F DSL
Sbjct: 18  KLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKASLVKNGA--EFTDSL 75

Query: 187 TATILRIVQSM 219
            + +LR++Q+M
Sbjct: 76  ISNLLRLIQTM 86


>gi|28704113|gb|AAH47327.1| DHX8 protein [Homo sapiens]
          Length = 1214

 Score = 1299 bits (3362), Expect = 0.0
 Identities = 656/971 (67%), Positives = 782/971 (79%), Gaps = 5/971 (0%)
 Frame = +1

Query: 685  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENV 861
            E   IG IY+G+V SI  FG F+ LEG R++ EGLVHIS++R E RV  VADV+ +G+ V
Sbjct: 254  EEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRV 313

Query: 862  KVKVNKIENGKISLSMKEVDQNSGEDLNP-RETDL---NPDAIGVRPRTPPASTSSWMNP 1029
            KVKV      K SLSMK+VDQ +GEDLNP R  +L     +   +R    P   S    P
Sbjct: 314  KVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAP 373

Query: 1030 EASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXX 1209
            E               K   +IS PE+WE++QM  A VL+  + PDFDEE G+L
Sbjct: 374  EVEDDSLER-------KRLTQISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDE 426

Query: 1210 XXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKI 1389
                     LVE+EP FLRG+ K   ++ P+K+VKNPDGSL+QAA+MQ AL+KER+E K
Sbjct: 427  EDEDLEIE-LVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELK- 484

Query: 1390 QAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKA 1569
            QAQRE +MD+      N   +DP+   +    +A+  +       ++PEW KH   G KA
Sbjct: 485  QAQREAEMDSIP-MGLNKHWVDPLPDAEGRQIAAN-MRGIGMMPNDIPEWKKHAFGGNKA 542

Query: 1570 TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLG 1749
            +YG++T +S++EQRESLPI+ LK+ L++A+ DNQIL+V+GETGSGKTTQ+TQY  EAG
Sbjct: 543  SYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYT 602

Query: 1750 RRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLR 1929
             RGKIGCTQPRRVAAMSVAKRV+EE+GC LG +VGYTIRFEDCTS +T+IKYMTDGMLLR
Sbjct: 603  SRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLR 662

Query: 1930 ECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEY 2109
            ECLIDPDL+ Y++IMLDEAHERTIHTDVLFGLLK   +KR ++KLI+TSATLD+VKFS+Y
Sbjct: 663  ECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQY 722

Query: 2110 FLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDT 2289
            F EAPIFTIPGRT+PVEILYT+EPE+DYL+A+ ITVMQIHLTEPPGD+LVFLTGQEEIDT
Sbjct: 723  FYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDT 782

Query: 2290 SCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTI 2469
            +CE+LYERMKS+GPDVPELIILPVY ALPSEMQTRIFDPAP G RKVVIATNIAETSLTI
Sbjct: 783  ACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTI 842

Query: 2470 DGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAF 2649
            DGI+YVVDPGFVKQK+YN K+G+D LVVTPISQA AKQR+GRAGRTGPGKCYRLYTERA+
Sbjct: 843  DGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAY 902

Query: 2650 RDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALD 2829
            RDEML T VPEIQRTNLAST+L LKAMGIN+L+ FDFMDAPP++++ITA+  L+TL ALD
Sbjct: 903  RDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALD 962

Query: 2830 GDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHA 3009
             +GLLT+LGRRMAEFPLEP L K+LIMSV LGCSEE+LTIV+ML+VQN+FYRPK+KQ  A
Sbjct: 963  DEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALA 1022

Query: 3010 DQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDR 3189
            DQKKAKFHQ EGDHLTLLAVYNSWKN+ FS PWC+ENFIQ RS++RAQDIR+Q+LGIMDR
Sbjct: 1023 DQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIREQMLGIMDR 1082

Query: 3190 HKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEW 3369
            HKL +VSCG+   RVQKAICSGFFRNAAK+DPQEGYRTL D Q VYIHPSSA F +QPEW
Sbjct: 1083 HKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEW 1142

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADA 3549
            VVYHELV+TTKEYMREVT IDP+WLVEFAP+FFK+ D TKLS  K+ Q+++PL+++Y +
Sbjct: 1143 VVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEP 1202

Query: 3550 NAWRITRVKKR 3582
            NAWRI+R  +R
Sbjct: 1203 NAWRISRAFRR 1213



 Score = 75.1 bits (183), Expect = 1e-11
 Identities = 37/71 (52%), Positives = 54/71 (75%)
 Frame = +1

Query: 7   QLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSL 186
           +LE+LSLVSKV +E++NH G+ +KD+AEFVI LA++N TFD  K +L   G   +F DSL
Sbjct: 18  KLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKASLVKNGA--EFTDSL 75

Query: 187 TATILRIVQSM 219
            + +LR++Q+M
Sbjct: 76  ISNLLRLIQTM 86


>gi|37654286|gb|AAQ96248.1| LRRGT00035 [Rattus norvegicus]
          Length = 1210

 Score = 1286 bits (3327), Expect = 0.0
 Identities = 652/971 (67%), Positives = 776/971 (79%), Gaps = 12/971 (1%)
 Frame = +1

Query: 685  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENV 861
            E   IG IY+G+V SI  FG F+ LEG R++ EGLVHIS++R E RV  VADV+ +G+ V
Sbjct: 229  EEPAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRV 288

Query: 862  KVKVNKIENGKISLSMKEVDQNSGEDLNP-RETDL---NPDAIGVRPRTPPASTSSWMNP 1029
            KVKV      K SLSMK+VDQ +GEDLNP R  +L     +   +R    P   S    P
Sbjct: 289  KVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAP 348

Query: 1030 EASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXX 1209
            E               K   RIS PE+WE++QM  A VL+  + PDFDEE G+L
Sbjct: 349  EVEDDSLER-------KRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDE 401

Query: 1210 XXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKI 1389
                     LVE+EP FLRG+ K   ++ P+K+VKNPDGSL+QAA+MQ AL+KER+E K
Sbjct: 402  EDEDLEIE-LVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELK- 459

Query: 1390 QAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKA 1569
            QAQRE +MD+      N   +DP+   +    +A+  +       ++PEW KH   G KA
Sbjct: 460  QAQREAEMDSIP-MGLNKHWVDPLPDAEGRQIAAN-MRGIGMMPNDIPEWKKHAFGGNKA 517

Query: 1570 TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLG 1749
            +YG++T +S++EQRESLPI+ LK+ L++A+ DNQIL+V+GETGSGKTTQ+TQY  EAG
Sbjct: 518  SYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYT 577

Query: 1750 RRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLR 1929
             RGKIGCTQPRRVAAMSVAKRV+EE+GC LG +VGYTIRFEDCTS +T+IKYMTDGMLLR
Sbjct: 578  SRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLR 637

Query: 1930 ECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEY 2109
            ECLIDPDL+ Y++IMLDEAHERTIHTDVLFGLLK   +KR ++KLI+TSATLD+VKFS+Y
Sbjct: 638  ECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQY 697

Query: 2110 FLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDT 2289
            F EAPIFTIPGRT+PVEILYT+EPE+DYL+A+ ITVMQIHLTEPPGD+LVFLTGQEEIDT
Sbjct: 698  FYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDT 757

Query: 2290 SCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTI 2469
            +CE+LYERMKS+GPDVPELIILPVY ALPSEMQTRIFDPAP G RKVVIATNIAETSLTI
Sbjct: 758  ACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTI 817

Query: 2470 DGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAF 2649
            DGI+YVVDPGFVKQK+YN K+G+D LVVTPISQA AKQR+GRAGRTGPGKCYRLYTERA+
Sbjct: 818  DGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAY 877

Query: 2650 RDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALD 2829
            RDEML T VPEIQRTNLAST+L LKAMGIN+L+ FDFMDAPP++++ITA+  L+TL ALD
Sbjct: 878  RDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALD 937

Query: 2830 GDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHA 3009
             +GLLT+LGRRMAEFPLEP L K+LIMSV LGCSEE+LTIV+ML+VQN+FYRPK+KQ  A
Sbjct: 938  DEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALA 997

Query: 3010 DQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDR 3189
            DQKKAKFHQ EGDHLTLLAVYNSWKN+ FS PWC+ENFIQ RS++RAQDIRKQ+LGIMDR
Sbjct: 998  DQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDR 1057

Query: 3190 HKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEW 3369
            HKL +VSCG+   RVQKAICSGFFRNAAK+DPQEGYRTL D Q VYIHPSSA F +QPEW
Sbjct: 1058 HKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEW 1117

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDK---- 3537
            VVYHELV+TTKEYMREVT IDP+WLVEFAP+FFK+ D TKLS  K+ Q+++PL+++
Sbjct: 1118 VVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRGEGM 1177

Query: 3538 ---YADANAWR 3561
               Y +  +W+
Sbjct: 1178 RVLYTELRSWK 1188



 Score = 62.8 bits (151), Expect = 6e-08
 Identities = 32/76 (42%), Positives = 52/76 (68%), Gaps = 5/76 (6%)
 Frame = +1

Query: 7   QLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQG-----LGDQ 171
           +LE+LSLVSKV +E++NH G+ +KD+AEFVI LA++N TFD  K +L   G     + D+
Sbjct: 24  KLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKASLVKNGAEFTTMLDE 83

Query: 172 FDDSLTATILRIVQSM 219
            D  +   +L+ ++++
Sbjct: 84  EDVKVAVDVLKELEAL 99


>gi|47207907|emb|CAF89868.1| unnamed protein product [Tetraodon
            nigroviridis]
          Length = 1310

 Score = 1163 bits (3009), Expect = 0.0
 Identities = 611/984 (62%), Positives = 728/984 (73%), Gaps = 60/984 (6%)
 Frame = +1

Query: 700  GKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENVKVKVN 876
            G IY G+V SI  FG F+ LEG R++ EGLVH+S++R E RV  VADV+ +G+ V+VKV
Sbjct: 232  GGIYSGKVCSIMQFGCFVQLEGLRKRWEGLVHVSELRKEGRVADVADVVTKGQKVQVKVL 291

Query: 877  KIENGKISLSMK------------EVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSW 1020
             +   K SLSMK            +VDQ +GEDLNP    +    +G      P
Sbjct: 292  SVTGTKASLSMKASHLGCFHEEESDVDQVTGEDLNPNRRRVADSGVGEEMLRNPD----- 346

Query: 1021 MNPEASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNY 1200
              P  + V +   +S    + + +I+  E+WE++QM  A VL   + P+FDEE G+L
Sbjct: 347  -RPVEAAVLETQDSSTERKRLK-KITDLEKWEIKQMIAANVLPKEEFPEFDEETGILPKI 404

Query: 1201 XXXXXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKE 1380
                        LVE+EP FLRG  K   ++ PVK++KNPDGSL+QAA+MQ AL+KER+E
Sbjct: 405  DDDDDEELEIE-LVEEEPPFLRGQTKWSTDMSPVKIMKNPDGSLSQAAMMQSALAKERRE 463

Query: 1381 TKIQAQRERDMDT-QKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTA 1557
             K  A R  +MD    G   N   +DPM   +    +A+  +        +PEW K
Sbjct: 464  QK-HAARMAEMDCIPTGLHKNW--IDPMPDYEGRQIAAN-MRGIGATPVNLPEWKKKALG 519

Query: 1558 GGKATYGRRTNLSMVEQRESLPIFALKKNLME------------------------AMID 1665
            G + +YGRRT LS+++QRESLPIF LK+ L++                        A+ D
Sbjct: 520  GNQVSYGRRTQLSLLQQRESLPIFKLKEQLVQVGPGRAAPALRLLSRPPTGFSPPQAVHD 579

Query: 1666 NQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGT 1845
            NQIL+VVGETGSGKTTQ+TQY  EAG   RGKIGCTQPRRVAAMSVAKRV+EEYGC+LG
Sbjct: 580  NQILIVVGETGSGKTTQITQYLAEAGYTGRGKIGCTQPRRVAAMSVAKRVSEEYGCRLGQ 639

Query: 1846 DVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGL 2025
            +VGYTIRFEDCTS +T+IKYMT GML RECL+DPD+S YSLIMLDEAHERTIHTDVLFGL
Sbjct: 640  EVGYTIRFEDCTSMETLIKYMTHGMLQRECLVDPDMSQYSLIMLDEAHERTIHTDVLFGL 699

Query: 2026 LKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAA 2205
            LK   +KR ++KLI++SATLD+VKFS+YF EAPIFTIPGRTFPVEILY REPE+DYLEA+
Sbjct: 700  LKKTVQKRKDMKLIVSSATLDAVKFSQYFYEAPIFTIPGRTFPVEILYAREPETDYLEAS 759

Query: 2206 HITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEM 2385
             ITVMQIHLTEPPGD+LVFLTGQEEIDT+CE+LYERMKS+GPDVPELIILPVY ALPSEM
Sbjct: 760  LITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEM 819

Query: 2386 QTRIFDPAPAGKRKV----------------------VIATNIAETSLTIDGIFYVVDPG 2499
            QTRIFDPAP G RKV                      ++ATNIAETSLTIDGI+YVVDPG
Sbjct: 820  QTRIFDPAPPGSRKVRRRQHQRLVDDHGDLCSASCQVILATNIAETSLTIDGIYYVVDPG 879

Query: 2500 FVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVP 2679
            FVKQ +YN K+G+D LVVTPISQA AKQR+GRAGRTGPGKCYRLYTERA+RDEML T VP
Sbjct: 880  FVKQIVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVP 939

Query: 2680 EIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGR 2859
            EIQRTNLAST+L LKAMGIN+L+ FDFMDAPP++++ITA+  L+TL ALD +GLLT+LGR
Sbjct: 940  EIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGR 999

Query: 2860 RMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQP 3039
            RMAEFPLEP L K+LIMSV LGCSEE+LTIV+ML+VQN+FYRPK+KQ  ADQKK KF Q
Sbjct: 1000 RMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKTKFFQL 1059

Query: 3040 EGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGR 3219
            EGDH+TLLAVYNSWKN+  S  WCFENFIQ RS+KRAQDIRKQ+L IMDRHKL +VSCG+
Sbjct: 1060 EGDHMTLLAVYNSWKNNKLSNAWCFENFIQARSLKRAQDIRKQMLSIMDRHKLDVVSCGK 1119

Query: 3220 DVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTT 3399
               +VQKAICSGFFRNAA++ PQ+GYRTL D Q VY+HPSS  F +QPEW+VYHELV+TT
Sbjct: 1120 AAVQVQKAICSGFFRNAARKHPQDGYRTLIDQQVVYLHPSSTLFNRQPEWLVYHELVLTT 1179

Query: 3400 KEYMREVTAIDPKWLVEFAPSFFK 3471
            KEYMREVT IDP+WL      FF+
Sbjct: 1180 KEYMREVTTIDPRWLKAICSGFFR 1203



 Score = 79.7 bits (195), Expect = 5e-13
 Identities = 53/144 (36%), Positives = 79/144 (54%), Gaps = 10/144 (6%)
 Frame = +1

Query: 7   QLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSL 186
           +LE+LSLVSKV +E+ENH G+ +KD+AEFVI LA+++ TFD+ K  L   G   +F ++L
Sbjct: 7   RLEYLSLVSKVCTELENHLGISDKDLAEFVICLAEKHQTFDEFKAVLVENGA--EFTETL 64

Query: 187 TATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMAN----- 351
            A +LR++Q+M            SK D  D     L    KE+++++ PAL   +
Sbjct: 65  IANLLRLIQTMRP------SPSTSKADQTD----VLAKSEKEQLRSKYPALCQPDAPAWT 114

Query: 352 -----TAKEKEDNEDDLMAQLEKM 408
                T +E E      M QLE +
Sbjct: 115 VPRGPTGEEDEQVAAAAMKQLEML 138


>gi|49074900|ref|XP_401551.1| hypothetical protein UM03936.1 [Ustilago
            maydis 521]
 gi|46099848|gb|EAK85081.1| hypothetical protein UM03936.1 [Ustilago
            maydis 521]
          Length = 1201

 Score = 1151 bits (2978), Expect = 0.0
 Identities = 584/976 (59%), Positives = 744/976 (75%), Gaps = 14/976 (1%)
 Frame = +1

Query: 694  EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIR-NERVQTVADVLKRGENVKVK 870
            ++ KIY+G+V++++ FG F++LEG R + EG+VHI  I    RV   +D+L RG+ VKVK
Sbjct: 220  QLYKIYEGQVSNMRDFGVFVSLEGLRGRFEGMVHIGSIAAGTRVNHPSDLLSRGQRVKVK 279

Query: 871  VNKIENGKISLSMKEVDQNSGEDLNPR-----ETDLNPDAIGVRPRTPPASTSSWMNPEA 1035
            V  +   +I LSMK+VDQ +G DL P      E ++  +      R+   + S+ +
Sbjct: 280  VMSVVGDRIGLSMKDVDQATGRDLTPHLRIKTEAEMAEERERHAARSASGANSAPLGGTR 339

Query: 1036 SGVGQGPSTSI---GGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXX 1206
               G G   ++   G G++  R+++PERWELRQ+  +GV  A+D P+  EE     N
Sbjct: 340  GSNGAGSGIAVKEDGRGRSMKRLTSPERWELRQLIASGVAKASDYPELLEEDLRTPNTQP 399

Query: 1207 XXXXXXXXXXLV--EDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKE 1380
                      +   E E  FL+G      E+ PVK+VK PDG+L +AA+    L+KER+E
Sbjct: 400  GADDDDEEIDIEVNEKEAPFLKGQTSSSIEMSPVKIVKAPDGTLNRAAMAGATLAKERRE 459

Query: 1381 TKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKD-RNNKMKEMPEWLKHVTA 1557
             + Q + E + D +    ++   LDPM+      ++ D   +    K ++ P W K  T
Sbjct: 460  LRKQ-EAEEEADAEAADMTSGW-LDPMAQQGDRMFAQDRRGNILGAKAQDQPAWKKE-TF 516

Query: 1558 GGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIE 1737
                T+GR TNLSM EQR+SLPIF L++ L++A+ DNQ+L+VVG+TGSGKTTQMTQY  E
Sbjct: 517  NKATTFGRITNLSMQEQRQSLPIFKLRQELVQAIRDNQVLIVVGDTGSGKTTQMTQYLAE 576

Query: 1738 AGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDG 1917
             G   RGKIGCTQPRRVAA+SVAKRVAEE GC++G +VGYTIRFEDCTS +T IKYMTDG
Sbjct: 577  EGFADRGKIGCTQPRRVAAVSVAKRVAEEVGCRVGQEVGYTIRFEDCTSPETKIKYMTDG 636

Query: 1918 MLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVK 2097
            ML RECL+DPD+S YS+IMLDEAHERTI TDVLFGLLK A ++RP+LKLI+TSATLD+ K
Sbjct: 637  MLQRECLVDPDVSNYSVIMLDEAHERTIATDVLFGLLKKALKRRPDLKLIVTSATLDAEK 696

Query: 2098 FSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQE 2277
            FS YF   PIFTIPGRT+PVEILYT+EPE DYL+AA ITVMQIHL+EP GD+LVFLTGQE
Sbjct: 697  FSTYFFGCPIFTIPGRTYPVEILYTKEPEPDYLDAALITVMQIHLSEPTGDILVFLTGQE 756

Query: 2278 EIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAET 2457
            EIDTSCE+L+ERMK++GP VPELIILPVY ALPSEMQTRIF+P PAG RKV++ATNIAET
Sbjct: 757  EIDTSCEILFERMKALGPSVPELIILPVYSALPSEMQTRIFEPTPAGSRKVILATNIAET 816

Query: 2458 SLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYT 2637
            S+TIDGI+YVVDPGFVKQ  Y+P+ GMDSLVVTPISQA A+QR+GRAGRTGPGKCYRLYT
Sbjct: 817  SITIDGIYYVVDPGFVKQNAYDPRLGMDSLVVTPISQAQARQRAGRAGRTGPGKCYRLYT 876

Query: 2638 ERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTL 2817
            E A+R+EMLP  +P+IQR NLAST+L LKAMGIN+L++FDFMD PP  +++TAL +L+ L
Sbjct: 877  EAAYRNEMLPNSIPDIQRQNLASTILALKAMGINDLVNFDFMDPPPAQTLLTALESLYAL 936

Query: 2818 SALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEK 2997
            SALD +GLLT+LGR+MA+FP+EP +SK+LI SVDLGCSEE+L+IVAML+VQN+FYRPK+K
Sbjct: 937  SALDDEGLLTRLGRKMADFPMEPMMSKMLIASVDLGCSEEMLSIVAMLSVQNVFYRPKDK 996

Query: 2998 QDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLG 3177
            Q  AD KKAKF QPEGDHLTLL VYN W    FS PWC +NF+Q RS++RAQD+RKQL+G
Sbjct: 997  QTQADAKKAKFFQPEGDHLTLLGVYNGWAASKFSMPWCMDNFVQGRSLRRAQDVRKQLVG 1056

Query: 3178 IMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTD-GQNVYIHPSSACFQ 3354
            IMDR+K  +VSCG++ +RV+KAICSG+FRNAAK+DPQEGY++L + G +VYIHPSSA F
Sbjct: 1057 IMDRYKHDIVSCGKNYNRVRKAICSGYFRNAAKKDPQEGYKSLAESGGSVYIHPSSALFN 1116

Query: 3355 QQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFD 3534
            + PE+ VYHE+V+TT+EYMREVTAI+PKWLVE AP FF+  D+  +S  KR +K+ PLFD
Sbjct: 1117 RAPEYCVYHEVVLTTREYMREVTAIEPKWLVEVAPRFFRTADALNISKRKRQEKVAPLFD 1176

Query: 3535 KYA-DANAWRITRVKK 3579
            ++A   + WR+++VK+
Sbjct: 1177 RFAKHQDEWRLSKVKR 1192



 Score = 46.6 bits (109), Expect = 0.004
 Identities = 41/146 (28%), Positives = 65/146 (44%), Gaps = 12/146 (8%)
 Frame = +1

Query: 7   QLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQG--LGDQFDD 180
           QLE LSL  KV +E+ NH G+ ++ +AEF++ L     +    K  L   G    D F
Sbjct: 11  QLELLSLTGKVANELLNHTGINDRVLAEFILSLHDSATSVADFKSKLSEVGADFPDSFVT 70

Query: 181 SLTATILRI----VQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARL-PALAM 345
           +L   ILR+     +   +        G +    K   K T   D + E KAR+ P LA+
Sbjct: 71  NLDRLILRLHPKHKKPSASKASTNDKPGSASPSAKGKEKAT-AEDEERERKARMFPGLAI 129

Query: 346 ANTAKEKEDNE-----DDLMAQLEKM 408
            +   +  +++     DD + + E M
Sbjct: 130 KDQEWQPSEDKGRNAVDDFLKEFEDM 155


>gi|48716672|dbj|BAD23339.1| putative RNA helicase [Oryza sativa
            (japonica cultivar-group)]
          Length = 1240

 Score = 1146 bits (2964), Expect = 0.0
 Identities = 589/976 (60%), Positives = 734/976 (74%), Gaps = 17/976 (1%)
 Frame = +1

Query: 694  EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVKVKV 873
            E+ ++Y GRV  +   G F+ LE  R  +EGLVHISQ+   RV    +++KR + V VKV
Sbjct: 280  ELYQVYRGRVTRVMDTGCFVRLEDVRGGREGLVHISQMATRRVANAKEMVKRDQEVYVKV 339

Query: 874  NKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGVGQG 1053
              ++  K+SLSM++VDQ++G DL P +     DA    PR  P+  S      ASGVG G
Sbjct: 340  VSVKGQKLSLSMRDVDQDTGRDLLPIQRG-GDDA----PRANPSGGS------ASGVGVG 388

Query: 1054 PSTSIGGGKARV---------------RISTPERWELRQMQGAGVLTATDMPDFDEEM-G 1185
                +G     +               R+S+PERWE +Q+  +GVL   D P FDE+  G
Sbjct: 389  SGKRLGLSGIMIAEEDEVAPPSRRPLKRMSSPERWEAKQLIASGVLDVRDYPMFDEDGDG 448

Query: 1186 VLRNYXXXXXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALS 1365
            +L  Y            L EDEP FL+G  +   ++ PVK+ KNP+GSL++AA +Q AL
Sbjct: 449  ML--YQEEGAEEEQEIELNEDEPAFLQGQSRFSIDMSPVKIFKNPEGSLSRAAALQTALI 506

Query: 1366 KERKETKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLK 1545
            KER+E + Q QR       K    N    DPM  +      A E +       +MPEW K
Sbjct: 507  KERREVREQEQRAMLDSIPKDL--NRPWEDPMP-DTGERHLAQELRGVGLSAYDMPEWKK 563

Query: 1546 HVTAGGKA-TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMT 1722
               A GKA T+G+R+ LS+ +QR+SLPI+ LKK L++A+ DNQ+LVV+GETGSGKTTQ+T
Sbjct: 564  E--AYGKALTFGQRSKLSIQDQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVT 621

Query: 1723 QYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIK 1902
            QY  EAG   RGKIGCTQPRRVAAMSVAKRVAEE+GC+LG +VGY IRFEDCT  DT+IK
Sbjct: 622  QYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIK 681

Query: 1903 YMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSAT 2082
            YMTDGMLLRE L+D +LS YS+IMLDEAHERTIHTDVLFGLLK   ++R +++LI+TSAT
Sbjct: 682  YMTDGMLLREILVDENLSQYSVIMLDEAHERTIHTDVLFGLLKQLIKRRSDMRLIVTSAT 741

Query: 2083 LDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVF 2262
            LD+ KFS YF    IFTIPGRTFPVEILYT++PESDYL+AA ITV+QIHLTEP GD+L+F
Sbjct: 742  LDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDAALITVLQIHLTEPEGDILLF 801

Query: 2263 LTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIAT 2442
            LTGQEEID +C+ LYERMK +G DVPELIILPVY ALPSEMQ++IFDPAP GKRKVV+AT
Sbjct: 802  LTGQEEIDHACQCLYERMKGLGKDVPELIILPVYSALPSEMQSKIFDPAPPGKRKVVVAT 861

Query: 2443 NIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKC 2622
            NIAE SLTIDGI+YVVDPGF K  +YN K G+DSLV+TPISQA+AKQR+GRAGRTGPGKC
Sbjct: 862  NIAEASLTIDGIYYVVDPGFAKINVYNSKQGLDSLVITPISQASAKQRAGRAGRTGPGKC 921

Query: 2623 YRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALN 2802
            YRLYTE A+R+EM PT +PEIQR NL ST+L +KAMGIN+L+ FDFMD P   ++I+A+
Sbjct: 922  YRLYTESAYRNEMSPTTIPEIQRINLGSTVLNMKAMGINDLLSFDFMDPPAPQALISAME 981

Query: 2803 TLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFY 2982
             L++L ALD +GLLTKLGR+MAEFPL+P LSK+L+ SVDLGCS+E+LTI+AM+   NIFY
Sbjct: 982  QLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFY 1041

Query: 2983 RPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIR 3162
            RP+EKQ  ADQK+AKF QPEGDHLTLLAVY +WK  +FS PWCFENF+Q RS++RAQD+R
Sbjct: 1042 RPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVR 1101

Query: 3163 KQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSS 3342
            KQLL IMDR+KL +VS GR+ ++++KAI +GFF +AA++DPQEGYRTL + Q VYIHPSS
Sbjct: 1102 KQLLTIMDRYKLDVVSAGRNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSS 1161

Query: 3343 ACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKID 3522
            A FQ+QP+WV+YHELVMTTKEYMREVT IDPKWL E AP F+K  D TK+S  KR ++I+
Sbjct: 1162 ALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLTELAPRFYKSADPTKMSKRKRQERIE 1221

Query: 3523 PLFDKYADANAWRITR 3570
            PL+D+Y + N+WR+++
Sbjct: 1222 PLYDRYHEPNSWRLSK 1237



 Score = 48.5 bits (114), Expect = 0.001
 Identities = 33/119 (27%), Positives = 55/119 (45%)
 Frame = +1

Query: 7   QLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSL 186
           +LE+LSLVSKV SE+E H GV +K +AEF+  L +++ +       L + G      D
Sbjct: 17  KLEYLSLVSKVCSELETHIGVGDKVLAEFITELGRDSASVADFDTKLKANGA--DLPDYF 74

Query: 187 TATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAKE 363
             T+L I+ ++            + +      K   +S   +  +AR   L +   A+E
Sbjct: 75  VRTLLTIIHAILPPPSDSRNPSSASQPAAGGSKFPGLSRPDDPDRARNLRLELERDAEE 133


>gi|49094794|ref|XP_408858.1| hypothetical protein AN4721.2
            [Aspergillus nidulans FGSC A4]
 gi|40741573|gb|EAA60763.1| hypothetical protein AN4721.2 [Aspergillus
            nidulans FGSC A4]
          Length = 1241

 Score = 1138 bits (2943), Expect = 0.0
 Identities = 565/963 (58%), Positives = 737/963 (75%), Gaps = 3/963 (0%)
 Frame = +1

Query: 703  KIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRN-ERVQTVADVLKRGENVKVKVNK 879
            KIYDGRV  ++ FGAF+ L G R K +GLVH+S ++   RV   +D++ RG+ VKVKV
Sbjct: 275  KIYDGRVTGVKDFGAFVNLVGVRGKVDGLVHVSAMQEGTRVNHPSDLVSRGQPVKVKVIS 334

Query: 880  IENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGVGQGPS 1059
            I+  +I LSMKEVDQ +G+DL P++   +   +      P       ++ +   + +
Sbjct: 335  IQGSRIGLSMKEVDQETGQDLVPQKRLASGANMERLDGMPSDDRYGNLSADVPVIEESDG 394

Query: 1060 TSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEM-GVLRNYXXXXXXXXXXXX 1236
             S+   K R R+++PERWE++Q+  +G ++A D PD DEE    L
Sbjct: 395  RSM---KNRKRLTSPERWEIKQLIASGAVSAADYPDIDEEYHATLTGEGTFEEEEDIDIE 451

Query: 1237 LVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMD 1416
            + ++EP FL G  K   E+ P++VVK PDGS+ ++A+    L+KER+E + Q  +++  +
Sbjct: 452  VRDEEPAFLAGQTKMSLELSPIRVVKAPDGSMNRSAMAGTNLAKERRELRQQEAQDKAAE 511

Query: 1417 TQKGFSSNARILDPMSGNQSTAWSAD-ESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNL 1593
               G   NA+  DPM+  +  A  AD  S  +    + +PEW K VT G   ++G+RTN+
Sbjct: 512  QAAGVDLNAQWQDPMASERKFA--ADLRSTQQTGTDEAVPEW-KRVTMGKTPSFGKRTNM 568

Query: 1594 SMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCT 1773
            S+ +QRESLP++  ++ L+EA+ +NQ+L+VVG+TGSGKTTQ+TQY  EAG   +G IGCT
Sbjct: 569  SIKQQRESLPVYKFRQQLLEAVAENQLLIVVGDTGSGKTTQVTQYLAEAGWANKGIIGCT 628

Query: 1774 QPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDL 1953
            QPRRVAAMSVAKRVAEE GCKLG +VGYTIRFEDCTS +T IKYMTDGML RE L+DPDL
Sbjct: 629  QPRRVAAMSVAKRVAEEVGCKLGAEVGYTIRFEDCTSPETKIKYMTDGMLQREVLLDPDL 688

Query: 1954 SGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFT 2133
              YS+IMLDEAHERTI TDVLFGLLK   ++RP+L+LI+TSATLD+ KFSEYF   PIF+
Sbjct: 689  KKYSVIMLDEAHERTIATDVLFGLLKTTLKRRPDLRLIVTSATLDADKFSEYFYGCPIFS 748

Query: 2134 IPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYER 2313
            IPGRTFPVEI+Y++EPESDYL+AA ITVMQIHLTEPPGD+L+FLTGQEEIDT+CE+LYER
Sbjct: 749  IPGRTFPVEIMYSKEPESDYLDAALITVMQIHLTEPPGDMLLFLTGQEEIDTACEILYER 808

Query: 2314 MKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVD 2493
            MK++GP VPEL+ILPVY ALPSEMQ+RIFDPAP G RKVVIATNIAETS+TID I+YV+D
Sbjct: 809  MKALGPSVPELVILPVYSALPSEMQSRIFDPAPPGGRKVVIATNIAETSITIDNIYYVID 868

Query: 2494 PGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTP 2673
            PGFVKQK Y+PK GMDSLVVTPISQA AKQR+GRAGRTGPGKC+RLYTE A++ EMLPT
Sbjct: 869  PGFVKQKAYDPKLGMDSLVVTPISQAQAKQRAGRAGRTGPGKCFRLYTEAAYQSEMLPTT 928

Query: 2674 VPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKL 2853
            +P+IQR NL+ T+L LKAMGIN+L+ FDFMD PP ++M+TAL  L+ LSALD +GLLT+L
Sbjct: 929  IPDIQRQNLSHTILMLKAMGINDLLHFDFMDPPPTNTMLTALEELYALSALDDEGLLTRL 988

Query: 2854 GRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFH 3033
            GR+MA+FP+EP+L+K+LI SVD+GCSEE+L+IVAML++Q++FYRPKEKQ  ADQKKAKFH
Sbjct: 989  GRKMADFPMEPALAKVLIASVDMGCSEEMLSIVAMLSIQSVFYRPKEKQQQADQKKAKFH 1048

Query: 3034 QPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSC 3213
             P GDHLTLL VYN+WK   FS  WC+ENFIQ R ++RAQD+R+QLLGIM R+   +VSC
Sbjct: 1049 DPHGDHLTLLNVYNAWKRSGFSNAWCYENFIQARQIRRAQDVRQQLLGIMQRYHHKIVSC 1108

Query: 3214 GRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVM 3393
            GR+ ++V++A+C+GFFRN+A++DPQEGY+TL +G  VY+HPSSA F +  E V+YH LV+
Sbjct: 1109 GRNTTKVRQALCTGFFRNSARKDPQEGYKTLVEGTPVYMHPSSAMFGKPAEHVIYHTLVL 1168

Query: 3394 TTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRITRV 3573
            TTKEYM   T I+PKWLVE AP+FFK+  + +LS  K+ ++I PL +++A  + WR++
Sbjct: 1169 TTKEYMHCTTGIEPKWLVEAAPTFFKVAPTDRLSKRKKAERIQPLHNRFAGEDDWRLSAQ 1228

Query: 3574 KKR 3582
            +++
Sbjct: 1229 RRQ 1231



 Score = 58.2 bits (139), Expect = 1e-06
 Identities = 36/108 (33%), Positives = 60/108 (55%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 180
           +  LEHLSL+S++ +E++NH GV +K +AE++I    +  +F + K AL++ G GD F
Sbjct: 4   LQSLEHLSLISRITNELQNHLGVSDKVLAEYIIEQHLKCSSFAEFKSALEAMG-GDLFPM 62

Query: 181 SLTATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKA 324
           SL  ++ R+V +M            +K+D  D H     SD  + + A
Sbjct: 63  SLMESVDRLVLTM-----HPRYKNKNKKDRGDEHVENGASDDMDALNA 105


>gi|32411385|ref|XP_326173.1| hypothetical protein [Neurospora crassa]
 gi|28924189|gb|EAA33344.1| hypothetical protein [Neurospora crassa]
          Length = 1179

 Score = 1134 bits (2933), Expect = 0.0
 Identities = 569/968 (58%), Positives = 739/968 (75%), Gaps = 9/968 (0%)
 Frame = +1

Query: 703  KIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVKVKVNKI 882
            K+Y+G V  I+ FGAF+ L G + K +GLVH+S    +RV   +D+L +G+ VKVKV K+
Sbjct: 209  KVYEGHVTGIKDFGAFVNLHGVKGKVDGLVHVSAF-GQRVNHPSDLLSKGQEVKVKVIKL 267

Query: 883  ENGKISLSMKEVDQNSGEDLNPR---ETDLNPDAIGVRPRTPPASTSSWMNPEASGVGQG 1053
            E G++ LSMK+VDQ +G DL P+    +  N +A+G R            N   +G G
Sbjct: 268  EGGRVGLSMKDVDQETGMDLAPQLRIGSGANMEALGGR------GGYDTKNVVTNGFGDK 321

Query: 1054 PS--TSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEE-MGVLRNYXXXXXXXX 1224
             +   +    + + R+++PERWE+RQM  AG+  A+D P+ +E+    L+
Sbjct: 322  GAFQATANARQHKKRMTSPERWEIRQMIAAGIAKASDYPELEEDYQATLKGEGQMELEED 381

Query: 1225 XXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRE 1404
                + ++EP FL G  K   E+ P++VVK PDGSL +AA+    L+KERKE + Q + E
Sbjct: 382  VDIEVRDEEPPFLAGQTKQSLELSPIRVVKAPDGSLNRAAMAGTNLAKERKELR-QQETE 440

Query: 1405 RDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKE---MPEWLKHVTAGGKATY 1575
                 +K    +++  DPM+  ++  +++D  K+          +PEW K   A  + +
Sbjct: 441  AKKAEEKKVDLSSQWQDPMANPETRKFASDLRKNAQAAPAAPDAVPEW-KRAVAPKEVSL 499

Query: 1576 GRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRR 1755
            GRRTN+S+ EQRESLP+FA ++ L+ A+ +NQ+L+VVGETGSGKTTQ+TQY  EAG
Sbjct: 500  GRRTNMSIKEQRESLPVFAFREQLITAVRENQVLIVVGETGSGKTTQLTQYLAEAGFTNN 559

Query: 1756 GKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLREC 1935
            G IGCTQPRRVAA+SVAKRV+EE GC+LG +VGYTIRFED TS  T IKYMTDGML RE
Sbjct: 560  GMIGCTQPRRVAAVSVAKRVSEEVGCQLGQEVGYTIRFEDVTSPATKIKYMTDGMLQREI 619

Query: 1936 LIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFL 2115
            LIDPDL  YS+IMLDEAHERTI TDVLF LLK   ++R +LK+I+TSATLD+ KFSEYF
Sbjct: 620  LIDPDLKRYSVIMLDEAHERTIATDVLFALLKKTMKRREDLKVIVTSATLDADKFSEYFN 679

Query: 2116 EAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSC 2295
            + PIFTIPGRTFPVEILY+REPESDYL+AA  TVMQIHL+EP GD+L+FLTGQEEIDT+C
Sbjct: 680  QCPIFTIPGRTFPVEILYSREPESDYLDAALTTVMQIHLSEPMGDILLFLTGQEEIDTAC 739

Query: 2296 EVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDG 2475
            E+LYERMK++GP+VPEL+ILPVY ALPSEMQ+RIFDPAP G RKVVIATNIAETS+TID
Sbjct: 740  EILYERMKALGPNVPELLILPVYSALPSEMQSRIFDPAPPGSRKVVIATNIAETSITIDH 799

Query: 2476 IFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRD 2655
            I+YVVDPGFVKQ  Y+PK GMDSLVVTPISQA A QR+GRAGRTGPGKC+RLYTE A++
Sbjct: 800  IYYVVDPGFVKQNAYDPKLGMDSLVVTPISQAQANQRAGRAGRTGPGKCFRLYTEAAYQS 859

Query: 2656 EMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGD 2835
            EMLPT +PEIQR NL++T+L LKAMGIN+L+ FDFMD PP+++M+TAL  L+ L+ALD +
Sbjct: 860  EMLPTTIPEIQRQNLSNTILMLKAMGINDLLRFDFMDPPPVNTMLTALEELYALAALDDE 919

Query: 2836 GLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQ 3015
            GLLT+LGR+MA+FP+EP+L+K+LI SV+ GCS+E++TIVAMLN+ N+FYRPKEKQ  ADQ
Sbjct: 920  GLLTRLGRKMADFPMEPALAKVLIASVEKGCSDEMVTIVAMLNLPNVFYRPKEKQAQADQ 979

Query: 3016 KKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHK 3195
            KKAKFH P GDHLTLL VYNSWKN+ ++ PWCFENFIQ RSM+RA+D+R Q++ IMDRH+
Sbjct: 980  KKAKFHDPHGDHLTLLNVYNSWKNNGYANPWCFENFIQARSMRRAKDVRDQIVKIMDRHR 1039

Query: 3196 LLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVV 3375
              ++SCGRD ++V++A+C+GFFRNAA++DPQEGY+TL +G  VY+HPSSA F +Q EWVV
Sbjct: 1040 HPVISCGRDTNKVRQALCAGFFRNAARKDPQEGYKTLIEGTPVYLHPSSALFGKQAEWVV 1099

Query: 3376 YHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANA 3555
            YH LV+TT+EYM   T+I+PKWLVE AP+FFK+  + KLS  K+ ++I+PL++KYA A+
Sbjct: 1100 YHTLVLTTREYMHYTTSIEPKWLVEAAPTFFKMAPTDKLSKRKKAERIEPLYNKYAGADD 1159

Query: 3556 WRITRVKK 3579
            WR++  ++
Sbjct: 1160 WRLSAQRR 1167



 Score = 62.0 bits (149), Expect = 1e-07
 Identities = 48/148 (32%), Positives = 78/148 (52%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 180
           ++ LE LSLVSKV SE++NH GV EK +AEF+I    E  +FD+ K+ L +  +G  F
Sbjct: 4   LESLELLSLVSKVTSELQNHLGVSEKTLAEFIIAQRVECGSFDEFKQKLAT--IGADFPP 61

Query: 181 SLTATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAK 360
           SL  +I R+V ++          G ++ D  + H       + EE       L++ +
Sbjct: 62  SLVESIDRLVLTLHP-KFKGQNHGQTRADENEKH-----GQSAEEKTKVFKGLSIPD--- 112

Query: 361 EKEDNEDDLMAQLEKMEGRYESEKRLQK 444
           ++ D  DD +A LE +E +   ++R +K
Sbjct: 113 KEVDVIDDTLALLESLEPKRAEKERPRK 140


>gi|15231574|ref|NP_189288.1| ATP-dependent RNA helicase, putative
            [Arabidopsis thaliana]
 gi|27735187|sp|Q38953|DHX8_ARATH Putative pre-mRNA splicing factor
            ATP-dependent RNA helicase
 gi|9293935|dbj|BAB01838.1| pre-mRNA splicing factor ATP-dependent RNA
            helicase-like protein [Arabidopsis thaliana]
          Length = 1168

 Score = 1133 bits (2930), Expect = 0.0
 Identities = 578/973 (59%), Positives = 726/973 (74%), Gaps = 14/973 (1%)
 Frame = +1

Query: 694  EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVKVKV 873
            E+ ++Y GRV  +   G F+  + FR K EGLVH+SQ+   RV    + +KR   V VKV
Sbjct: 212  ELYQVYKGRVTRVMDAGCFVQFDKFRGK-EGLVHVSQMATRRVDKAKEFVKRDMEVYVKV 270

Query: 874  NKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPE-ASGVGQ 1050
              I + K SLSM++VDQN+G DL P     + D             SS  NP   +  GQ
Sbjct: 271  ISISSDKYSLSMRDVDQNTGRDLIPLRKPSDED------------DSSRSNPSYRTKDGQ 318

Query: 1051 GPSTSIGG------------GKARVRISTPERWELRQMQGAGVLTATDMPDFDEEM-GVL 1191
               T I G             +   ++S+PERWE +Q+  +GVL   + P +DE+  G+L
Sbjct: 319  VTKTGISGIRIVEENDVAPSRRPLKKMSSPERWEAKQLIASGVLRVDEFPMYDEDGDGML 378

Query: 1192 RNYXXXXXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKE 1371
              Y            + EDEP FL+G  +   ++ PVK+ KNP+GSL++AA +Q AL+KE
Sbjct: 379  --YQEEGAEEELEIEMNEDEPAFLQGQTRYSVDMSPVKIFKNPEGSLSRAAALQSALTKE 436

Query: 1372 RKETKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHV 1551
            R+E + Q QR       K  +       P +G +  A    E +       +MPEW K
Sbjct: 437  RREMREQQQRTMLDSIPKDLNRPWEDPMPETGERHLA---QELRGVGLSAYDMPEWKKDA 493

Query: 1552 TAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYA 1731
              G   T+G+R+ LS+ EQRESLPI+ LKK L++A+ DNQ+LVV+GETGSGKTTQ+TQY
Sbjct: 494  F-GKTPTFGQRSKLSIQEQRESLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYL 552

Query: 1732 IEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMT 1911
             EAG   +GKIGCTQPRRVAAMSVAKRVAEE+GC+LG +VGY IRFEDCT  DT+IKYMT
Sbjct: 553  AEAGYTTKGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMT 612

Query: 1912 DGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDS 2091
            DGMLLRE LID +LS YS+IMLDEAHERTIHTDVLFGLLK   ++R +L+LI+TSATLD+
Sbjct: 613  DGMLLREILIDENLSQYSVIMLDEAHERTIHTDVLFGLLKKLMKRRLDLRLIVTSATLDA 672

Query: 2092 VKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTG 2271
             KFS YF    IFTIPGRTFPVEILYT++PE+DYL+AA ITV+QIHLTEP GD+LVFLTG
Sbjct: 673  EKFSGYFFNCNIFTIPGRTFPVEILYTKQPETDYLDAALITVLQIHLTEPEGDILVFLTG 732

Query: 2272 QEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIA 2451
            QEEID++C+ LYERMK +G +VPELIILPVY ALPSEMQ+RIFDP P GKRKVV+ATNIA
Sbjct: 733  QEEIDSACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPPPPGKRKVVVATNIA 792

Query: 2452 ETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRL 2631
            E SLTIDGI+YVVDPGF KQ +YNPK G++SLV+TPISQA+AKQR+GRAGRTGPGKCYRL
Sbjct: 793  EASLTIDGIYYVVDPGFAKQNVYNPKQGLESLVITPISQASAKQRAGRAGRTGPGKCYRL 852

Query: 2632 YTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLH 2811
            YTE A+R+EM PT +PEIQR NL  T L +KAMGIN+L+ FDFMD P   ++I+A+  L+
Sbjct: 853  YTESAYRNEMPPTSIPEIQRINLGMTTLTMKAMGINDLLSFDFMDPPQPQALISAMEQLY 912

Query: 2812 TLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPK 2991
            +L ALD +GLLTKLGR+MAEFPLEP LSK+L+ SVDLGCS+E+LT++AM+   NIFYRP+
Sbjct: 913  SLGALDEEGLLTKLGRKMAEFPLEPPLSKMLLASVDLGCSDEILTMIAMIQTGNIFYRPR 972

Query: 2992 EKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQL 3171
            EKQ  ADQK+AKF QPEGDHLTLLAVY +WK  +FS PWCFENFIQ RS++RAQD+RKQL
Sbjct: 973  EKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFIQSRSLRRAQDVRKQL 1032

Query: 3172 LGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF 3351
            L IMD++KL +V+ G++ ++++KAI +GFF + A++DPQEGYRTL + Q VYIHPSSA F
Sbjct: 1033 LSIMDKYKLDVVTAGKNFTKIRKAITAGFFFHGARKDPQEGYRTLVENQPVYIHPSSALF 1092

Query: 3352 QQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLF 3531
            Q+QP+WV+YH+LVMTTKEYMREVT IDPKWLVE AP FFK+ D TK+S  KR ++I+PL+
Sbjct: 1093 QRQPDWVIYHDLVMTTKEYMREVTVIDPKWLVELAPRFFKVSDPTKMSKRKRQERIEPLY 1152

Query: 3532 DKYADANAWRITR 3570
            D+Y + N+WR+++
Sbjct: 1153 DRYHEPNSWRLSK 1165



 Score = 57.0 bits (136), Expect = 3e-06
 Identities = 46/147 (31%), Positives = 65/147 (43%), Gaps = 2/147 (1%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQG--LGDQF 174
           +++L HLSLVS V +E+E H G  EK +AEF+I L + + T D+  K L   G  + D F
Sbjct: 6   LNKLNHLSLVSNVCNELETHLGSAEKVLAEFIIDLGRHSETVDEFDKNLKEAGAEMPDYF 65

Query: 175 DDSLTATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANT 354
             SL  TI  I             G D K       K   I D K+++K       +
Sbjct: 66  VRSLLTTIHGIYPPKPKSEKKKEEGDDQK------FKGLAIKDTKDKVKEL--EKEIERE 117

Query: 355 AKEKEDNEDDLMAQLEKMEGRYESEKR 435
           A+E+   ED    +  +  GR     R
Sbjct: 118 AEERRREEDRNRDRDRRESGRDRDRDR 144


>gi|1402875|emb|CAA66825.1| RNA helicase [Arabidopsis thaliana]
 gi|1495271|emb|CAA66613.1| RNA helicase [Arabidopsis thaliana]
          Length = 1121

 Score = 1133 bits (2930), Expect = 0.0
 Identities = 578/973 (59%), Positives = 726/973 (74%), Gaps = 14/973 (1%)
 Frame = +1

Query: 694  EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVKVKV 873
            E+ ++Y GRV  +   G F+  + FR K EGLVH+SQ+   RV    + +KR   V VKV
Sbjct: 165  ELYQVYKGRVTRVMDAGCFVQFDKFRGK-EGLVHVSQMATRRVDKAKEFVKRDMEVYVKV 223

Query: 874  NKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPE-ASGVGQ 1050
              I + K SLSM++VDQN+G DL P     + D             SS  NP   +  GQ
Sbjct: 224  ISISSDKYSLSMRDVDQNTGRDLIPLRKPSDED------------DSSRSNPSYRTKDGQ 271

Query: 1051 GPSTSIGG------------GKARVRISTPERWELRQMQGAGVLTATDMPDFDEEM-GVL 1191
               T I G             +   ++S+PERWE +Q+  +GVL   + P +DE+  G+L
Sbjct: 272  VTKTGISGIRIVEENDVAPSRRPLKKMSSPERWEAKQLIASGVLRVDEFPMYDEDGDGML 331

Query: 1192 RNYXXXXXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKE 1371
              Y            + EDEP FL+G  +   ++ PVK+ KNP+GSL++AA +Q AL+KE
Sbjct: 332  --YQEEGAEEELEIEMNEDEPAFLQGQTRYSVDMSPVKIFKNPEGSLSRAAALQSALTKE 389

Query: 1372 RKETKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHV 1551
            R+E + Q QR       K  +       P +G +  A    E +       +MPEW K
Sbjct: 390  RREMREQQQRTMLDSIPKDLNRPWEDPMPETGERHLA---QELRGVGLSAYDMPEWKKDA 446

Query: 1552 TAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYA 1731
              G   T+G+R+ LS+ EQRESLPI+ LKK L++A+ DNQ+LVV+GETGSGKTTQ+TQY
Sbjct: 447  F-GKTPTFGQRSKLSIQEQRESLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYL 505

Query: 1732 IEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMT 1911
             EAG   +GKIGCTQPRRVAAMSVAKRVAEE+GC+LG +VGY IRFEDCT  DT+IKYMT
Sbjct: 506  AEAGYTTKGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMT 565

Query: 1912 DGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDS 2091
            DGMLLRE LID +LS YS+IMLDEAHERTIHTDVLFGLLK   ++R +L+LI+TSATLD+
Sbjct: 566  DGMLLREILIDENLSQYSVIMLDEAHERTIHTDVLFGLLKKLMKRRLDLRLIVTSATLDA 625

Query: 2092 VKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTG 2271
             KFS YF    IFTIPGRTFPVEILYT++PE+DYL+AA ITV+QIHLTEP GD+LVFLTG
Sbjct: 626  EKFSGYFFNCNIFTIPGRTFPVEILYTKQPETDYLDAALITVLQIHLTEPEGDILVFLTG 685

Query: 2272 QEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIA 2451
            QEEID++C+ LYERMK +G +VPELIILPVY ALPSEMQ+RIFDP P GKRKVV+ATNIA
Sbjct: 686  QEEIDSACQSLYERMKGLGKNVPELIILPVYSALPSEMQSRIFDPPPPGKRKVVVATNIA 745

Query: 2452 ETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRL 2631
            E SLTIDGI+YVVDPGF KQ +YNPK G++SLV+TPISQA+AKQR+GRAGRTGPGKCYRL
Sbjct: 746  EASLTIDGIYYVVDPGFAKQNVYNPKQGLESLVITPISQASAKQRAGRAGRTGPGKCYRL 805

Query: 2632 YTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLH 2811
            YTE A+R+EM PT +PEIQR NL  T L +KAMGIN+L+ FDFMD P   ++I+A+  L+
Sbjct: 806  YTESAYRNEMPPTSIPEIQRINLGMTTLTMKAMGINDLLSFDFMDPPQPQALISAMEQLY 865

Query: 2812 TLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPK 2991
            +L ALD +GLLTKLGR+MAEFPLEP LSK+L+ SVDLGCS+E+LT++AM+   NIFYRP+
Sbjct: 866  SLGALDEEGLLTKLGRKMAEFPLEPPLSKMLLASVDLGCSDEILTMIAMIQTGNIFYRPR 925

Query: 2992 EKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQL 3171
            EKQ  ADQK+AKF QPEGDHLTLLAVY +WK  +FS PWCFENFIQ RS++RAQD+RKQL
Sbjct: 926  EKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFIQSRSLRRAQDVRKQL 985

Query: 3172 LGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF 3351
            L IMD++KL +V+ G++ ++++KAI +GFF + A++DPQEGYRTL + Q VYIHPSSA F
Sbjct: 986  LSIMDKYKLDVVTAGKNFTKIRKAITAGFFFHGARKDPQEGYRTLVENQPVYIHPSSALF 1045

Query: 3352 QQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLF 3531
            Q+QP+WV+YH+LVMTTKEYMREVT IDPKWLVE AP FFK+ D TK+S  KR ++I+PL+
Sbjct: 1046 QRQPDWVIYHDLVMTTKEYMREVTVIDPKWLVELAPRFFKVSDPTKMSKRKRQERIEPLY 1105

Query: 3532 DKYADANAWRITR 3570
            D+Y + N+WR+++
Sbjct: 1106 DRYHEPNSWRLSK 1118


>gi|50258475|gb|EAL21164.1| hypothetical protein CNBD5400
            [Cryptococcus neoformans var. neoformans B-3501A]
          Length = 1189

 Score = 1130 bits (2923), Expect = 0.0
 Identities = 583/972 (59%), Positives = 731/972 (74%), Gaps = 13/972 (1%)
 Frame = +1

Query: 703  KIYDGRVNSIQSFGAFITLEGFRQK-------QEGLVHISQIRNERVQTVADVLKRGENV 861
            KIY+G + +I  FGAF+TL+G  +K        EGL+H+S I N RV +  D LKRG+ V
Sbjct: 225  KIYNGTIANITDFGAFVTLDGVERKIDGNQRSNEGLIHVSNITNGRVNSPRDFLKRGQRV 284

Query: 862  KVKVNKIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASG 1041
            KVKV  + + KI LSMK+VDQN+G+DL+P  T    +   V+ +      SS+    ASG
Sbjct: 285  KVKVMAV-SPKIGLSMKDVDQNTGDDLSPHLTVKTAEEAAVQQQR----MSSYA---ASG 336

Query: 1042 VGQGPSTSIGGGK--ARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXX 1215
                P  ++   +  +  R+S+PER+E++Q+  +G ++A D PD DE+     N
Sbjct: 337  SNSTPLLAVDERQRSSAKRLSSPERFEIKQLIASGAVSAADYPDLDEDFST--NVANHEI 394

Query: 1216 XXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETK-IQ 1392
                   + E EP FL G  K   E+ PVK++K PDGSL ++AL   +L+KER++ K ++
Sbjct: 395  EEDIDVEVNEVEPAFLSGQTKVTLELSPVKIIKAPDGSLNRSALAGASLAKERRDLKRLE 454

Query: 1393 AQRERDMDTQKGFSSNARILDPMSGNQSTAWSAD-ESKDRNNKMKEMPEWLKHVTAGGKA 1569
            A  + D +T++    N   LDPM+      +++D +      K  +MP W     A
Sbjct: 455  ANEQADAETRE---INQPWLDPMANQNERQFASDIKGNLLGQKAAQMPAWK---AANKVV 508

Query: 1570 TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLG 1749
            +YG+ T++S+ EQR SLPI+ L++ L+ A+ DNQILVVVG+TGSGKTTQM QY  E G
Sbjct: 509  SYGKITSMSIQEQRRSLPIYKLREQLVAAIRDNQILVVVGDTGSGKTTQMAQYLAEEGFL 568

Query: 1750 RRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLR 1929
             +G++GCTQPR+VAA+SVAKRVAEE GC+LG +VGYTIRFED TS +T IKYMTDGMLLR
Sbjct: 569  EKGRLGCTQPRKVAAVSVAKRVAEEVGCRLGAEVGYTIRFEDMTSPETKIKYMTDGMLLR 628

Query: 1930 ECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEY 2109
            E L+DPD S YS+IMLDEAHERTI TDVLFGLLK A ++RP+LKLI TSATLD+ KF+ Y
Sbjct: 629  ELLVDPDCSKYSVIMLDEAHERTIATDVLFGLLKKACKRRPDLKLICTSATLDAAKFATY 688

Query: 2110 FLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDT 2289
            F   PIFTIPGRT+PVE LYT+EPE DYLEA+ IT++QIHL EP GDVL+FLTGQEEIDT
Sbjct: 689  FWGCPIFTIPGRTYPVETLYTKEPEPDYLEASLITILQIHLMEPAGDVLLFLTGQEEIDT 748

Query: 2290 SCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTI 2469
            +CEVLYER+K++GP VPEL+ILPVY ALPSEMQ+RIF+PAP G RKVVIATNIAETS+TI
Sbjct: 749  ACEVLYERVKALGPQVPELLILPVYAALPSEMQSRIFEPAPPGARKVVIATNIAETSITI 808

Query: 2470 DGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAF 2649
            DGI+YV+DPGF KQ  Y+PK GMDSL+VTPISQA A+QR+GRAGRTGPGKCYRLYTE A+
Sbjct: 809  DGIYYVIDPGFAKQNAYDPKLGMDSLIVTPISQAQARQRAGRAGRTGPGKCYRLYTEVAY 868

Query: 2650 RDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALD 2829
            R+EMLP P+PEIQRTNLAST+L LKAMGIN+LI FDFMD PP  +M+TAL  L+ L ALD
Sbjct: 869  RNEMLPNPIPEIQRTNLASTILTLKAMGINDLISFDFMDPPPAATMLTALEQLYALGALD 928

Query: 2830 GDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNV-QNIFYRPKEKQDH 3006
             +GLLT++GR+MA+FPL+P LSK+LI SVD GCSEE LTIVAML     ++YRPK+KQ
Sbjct: 929  DEGLLTRIGRKMADFPLDPPLSKMLIKSVDYGCSEEALTIVAMLQAGGQVYYRPKDKQTQ 988

Query: 3007 ADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMD 3186
            AD KKAKFHQPEGD LTLLAVYN WKN  FS PWCFENFIQ R+MK AQD+RKQL+GIMD
Sbjct: 989  ADAKKAKFHQPEGDLLTLLAVYNGWKNSKFSNPWCFENFIQTRAMKTAQDVRKQLIGIMD 1048

Query: 3187 RHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPE 3366
            R+K  +VSCG + +RV+ AICSGFFRNAAK+DP EGY+TL +G  V IHPSSA FQ+ PE
Sbjct: 1049 RYKHDLVSCGTNYNRVRMAICSGFFRNAAKKDPTEGYKTLVEGTPVSIHPSSALFQRPPE 1108

Query: 3367 WVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKY-A 3543
            W VY+ELV+T KEYM +VT I+PKWL E AP+FF+I D  K+S  K ++KI+PLFD++ A
Sbjct: 1109 WCVYYELVLTAKEYMHQVTVIEPKWLSEVAPTFFRIADQNKISKRKASEKIEPLFDRFAA 1168

Query: 3544 DANAWRITRVKK 3579
            D + WR+++ KK
Sbjct: 1169 DKDDWRLSKQKK 1180



 Score = 47.4 bits (111), Expect = 0.003
 Identities = 43/157 (27%), Positives = 72/157 (45%), Gaps = 20/157 (12%)
 Frame = +1

Query: 7   QLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSL 186
           +LE LSLVSKV  E+ NH  + +K +AEFVI L +++ T +  +K L+   +G  F +
Sbjct: 10  KLELLSLVSKVSQELFNHTKLQDKKLAEFVIALHEQSKTTEAFQKKLNE--IGADFPEWF 67

Query: 187 TATILRIVQSM-TAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMAN---- 351
              + R++ +M             SK+  K     +++ + K+    + P L+M +
Sbjct: 68  VKNLDRLIVTMHPKYKRKAAKMKASKQSGKSDDGQSVMEEQKQLQARKFPGLSMPDQDWK 127

Query: 352 ---------TAKEKED------NEDDLMAQLEKMEGR 417
                     AKE  +      +  D MAQLE +  R
Sbjct: 128 PAEKYVDERAAKEPHETLPESLSTSDTMAQLESIASR 164


>gi|38104766|gb|EAA51285.1| hypothetical protein MG08807.4
            [Magnaporthe grisea 70-15]
          Length = 1207

 Score = 1120 bits (2897), Expect = 0.0
 Identities = 566/970 (58%), Positives = 727/970 (74%), Gaps = 11/970 (1%)
 Frame = +1

Query: 703  KIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRN-ERVQTVADVLKRGENVKVKVNK 879
            K+YDG V  ++ FGAF+ L G + K +GLVH+S + + +RV   +D + +G+ VKVKV K
Sbjct: 235  KVYDGHVTGVKDFGAFVNLHGVKGKVDGLVHVSALTDGQRVSHPSDFVDKGQPVKVKVIK 294

Query: 880  IENGKISLSMKEVDQNSGEDLNPR---ETDLNPDAIGVRPRTPPASTSSWMNPEASGVGQ 1050
            IE  +I LSMKEVDQ +GEDL P     +  N  A+G R             P+ S +
Sbjct: 295  IEGSRIGLSMKEVDQQTGEDLAPEVGFHSGANSMALGSRHNLSNGLLED-KAPDLSAI-- 351

Query: 1051 GPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMG-VLRNYXXXXXXXXX 1227
                ++ G K + R+++PERWE+RQM  +GV  A+D P+ +E+    L
Sbjct: 352  --KNTLPGRKHKKRMTSPERWEIRQMIASGVAKASDYPELEEDYNNALSGEGQMELEEDV 409

Query: 1228 XXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRER 1407
               + ++EP FL G  K   E+ P++VVK PDGSL +AA+   +L KERKE +   Q+E
Sbjct: 410  DIEIRDEEPPFLAGQTKQSLELSPIRVVKAPDGSLNRAAMAGTSLVKERKEIR---QQEA 466

Query: 1408 DMDTQKGFSSNARIL-----DPMSGNQSTAWSADESKDRNNKMKE-MPEWLKHVTAGGKA 1569
            +   Q   ++    L     DPM+      ++AD  +   N+  E +PEW +   A
Sbjct: 467  EAAAQAAATNGKVDLASQWEDPMADPDKRKFAADMRRTMQNRPSEAVPEW-RQAIAPKNQ 525

Query: 1570 TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLG 1749
            ++G+RTN+++ +QRESLP+FA ++ L++A+ +NQI++VVGETGSGKTTQ+TQY  EAG
Sbjct: 526  SFGKRTNMTIKQQRESLPVFAFREQLIKAVKENQIMIVVGETGSGKTTQLTQYLAEAGFA 585

Query: 1750 RRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLR 1929
              G IGCTQPRRVAAMSVAKRV+EE GC+LG +VGYTIRFEDCTS  T IKYMTDGML R
Sbjct: 586  NEGVIGCTQPRRVAAMSVAKRVSEEVGCELGQEVGYTIRFEDCTSPATRIKYMTDGMLQR 645

Query: 1930 ECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEY 2109
            E +IDPDL  YS+IMLDEAHERTI TDVLF LLK A R+RP+LK+I+TSATLD+ KFS Y
Sbjct: 646  EIVIDPDLKRYSVIMLDEAHERTIATDVLFALLKKATRRRPDLKIIVTSATLDADKFSAY 705

Query: 2110 FLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDT 2289
            F E PIFTIPGRTFPVEILY+++PESDYL+AA  TVMQIH+ EPPGD+L+FLTGQEEIDT
Sbjct: 706  FNECPIFTIPGRTFPVEILYSKDPESDYLDAALTTVMQIHIDEPPGDILLFLTGQEEIDT 765

Query: 2290 SCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTI 2469
            SCE+L+ERMK++GP VPELIILPVY ALP+EMQ+RIFDPAP G RKVVIATNIAETS+TI
Sbjct: 766  SCEILFERMKALGPSVPELIILPVYSALPNEMQSRIFDPAPPGSRKVVIATNIAETSITI 825

Query: 2470 DGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAF 2649
            D I+YVVDPGFVKQ  Y+PK GMDSLVVTPISQA A QR+GRAGRTGPGKC+RLYTE A+
Sbjct: 826  DHIYYVVDPGFVKQNAYDPKLGMDSLVVTPISQAQANQRAGRAGRTGPGKCFRLYTEAAY 885

Query: 2650 RDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALD 2829
            + EMLPT +PEIQR NL++T+L LKAMGIN+L+ FDFMD PP+++M+TAL  L+ LSALD
Sbjct: 886  QTEMLPTSIPEIQRQNLSNTILLLKAMGINDLLHFDFMDPPPINTMLTALEELYALSALD 945

Query: 2830 GDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHA 3009
             +GLLT+LGR+MA+FP+EPSLSK+LI SV++ CS+E+L+IVAMLN+ N+FYRPKEKQ  A
Sbjct: 946  DEGLLTRLGRKMADFPMEPSLSKVLIASVEMRCSDEMLSIVAMLNLPNVFYRPKEKQTQA 1005

Query: 3010 DQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDR 3189
            D KKAKFH P GDHLTLL VYN+WK   +S+PWC ENFIQ R++ RA+D+R Q+  IM R
Sbjct: 1006 DAKKAKFHDPNGDHLTLLNVYNAWKQSRYSKPWCAENFIQFRALTRARDVRNQIERIMQR 1065

Query: 3190 HKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEW 3369
             K  ++SCG D +RV++A+CSGFFRNAA++D QEGYRTL +G  VY+HPSSA F +  EW
Sbjct: 1066 FKYQVMSCGSDTNRVRQALCSGFFRNAARKDQQEGYRTLIEGTPVYLHPSSALFGKHAEW 1125

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADA 3549
            V+YH LV+TTKEYM   T+I+PKWLV+ AP+FFK+  S KLS  ++ ++I PL++K+
Sbjct: 1126 VIYHTLVLTTKEYMHCTTSIEPKWLVDAAPTFFKVSASDKLSKRRQQERIQPLYNKFEGE 1185

Query: 3550 NAWRITRVKK 3579
            N WR++  ++
Sbjct: 1186 NDWRLSAQRR 1195



 Score = 64.3 bits (155), Expect = 2e-08
 Identities = 50/149 (33%), Positives = 75/149 (49%), Gaps = 4/149 (2%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 180
           ++ LE LSLVSKV SE++NH GV +KD+A+++I    E   F+  KK +DS+    +F
Sbjct: 4   LENLELLSLVSKVTSELKNHMGVDDKDLADYIIANRLECDGFEAFKKWMDSE---CEFPP 60

Query: 181 SLTATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANT-- 354
           SL  +I R+V+SM           D           T     +E+       LA+A+T
Sbjct: 61  SLIESIDRLVRSMHPKLRNSSQNADLSAP-------TTTGRTQEQKNELFKGLAVADTQP 113

Query: 355 --AKEKEDNEDDLMAQLEKMEGRYESEKR 435
             A E  D  DD +A LE +  + + EK+
Sbjct: 114 ALADEGPDAIDDTLALLEGLAPKGKPEKK 142


>gi|50760719|ref|XP_418105.1| PREDICTED: similar to ATP-dependent
            helicase DHX8 (RNA helicase HRH1) (DEAH-box protein 8)
            [Gallus gallus]
          Length = 1146

 Score = 1119 bits (2894), Expect = 0.0
 Identities = 554/773 (71%), Positives = 649/773 (83%), Gaps = 22/773 (2%)
 Frame = +1

Query: 1330 LAQAALMQGALSKERKETKIQAQRERDMDTQ----------------KGFSSNARILDPM 1461
            + Q+  MQ A +KE  + + QA RE +MD+                 +G      + D
Sbjct: 374  IKQSGXMQRAXAKEPXKPQ-QALREAEMDSIPMGLNTHWNAPDDGAIRGVLLGPVLCDLK 432

Query: 1462 SGNQSTAWSADESKDRNNKM------KEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLP 1623
              N   ++  D  +   N         ++PEW KH   G KA+YG++T LS++EQRESLP
Sbjct: 433  CDNGIVSFLVDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQLSIIEQRESLP 492

Query: 1624 IFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSV 1803
            IF LK+ L++A+ DNQIL+V+GETGSGKTTQ+TQY  EAG   RGKIGCTQPRRVAAMSV
Sbjct: 493  IFRLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSV 552

Query: 1804 AKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDE 1983
            AKRV+EE+GC LG +VGYTIRFEDCTS +T+IKYMTDGMLLRECLIDPDL+ Y++IMLDE
Sbjct: 553  AKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDE 612

Query: 1984 AHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEI 2163
            AHERTIHTDVLFGLLK   +KR ++KLI+TSATLD+VKFS+YF EAPIFTIPGRT+PVEI
Sbjct: 613  AHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEI 672

Query: 2164 LYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPE 2343
            LYT+EPE+DYL+A+ ITVMQIHLTEPPGD+LVFLTGQEEIDT+CE+LYERMKS+GPDVPE
Sbjct: 673  LYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPE 732

Query: 2344 LIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYN 2523
            LIILPVY ALPSEMQTRIFDPAP G RKVVIATNIAETSLTIDGI+YVVDPGFVKQK+YN
Sbjct: 733  LIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYN 792

Query: 2524 PKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLA 2703
             K+G+D LVVTPISQA AKQR+GRAGRTGPGKCYRLYTERA+RDEML T VPEIQRTNLA
Sbjct: 793  SKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLA 852

Query: 2704 STLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLE 2883
            ST+L LKAMGIN+L+ FDFMDAPP++++ITA+  L+TL ALD +GLLT+LGRRMAEFPLE
Sbjct: 853  STVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLE 912

Query: 2884 PSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLL 3063
            P L K+LIMSV LGCSEE+LTIV+ML+VQN+FYRPK+KQ  ADQKKAKFHQ EGDHLTLL
Sbjct: 913  PMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLL 972

Query: 3064 AVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKA 3243
            AVYNSWKN+ FS PWC+ENFIQ RS++RAQDIRKQ+LGIMDRHKL +VSCG+   RVQKA
Sbjct: 973  AVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKA 1032

Query: 3244 ICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVT 3423
            ICSGFFRNAAK+DPQEGYRTL D Q VYIHPSSA F +QPEWVVYHELV+TTKEYMREVT
Sbjct: 1033 ICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVT 1092

Query: 3424 AIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRITRVKKR 3582
             IDP+WLVEFAP+FFK+ D TKLS  K+ Q+++PL+++Y + NAWRI+R  +R
Sbjct: 1093 TIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR 1145



 Score =  109 bits (273), Expect = 4e-22
 Identities = 68/152 (44%), Positives = 88/152 (57%), Gaps = 5/152 (3%)
 Frame = +1

Query: 685  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENV 861
            E   IG IY+G+V SI  FG F+ LEG R++ EGLVHIS++R E RV  VADV+ +G+ V
Sbjct: 232  EEPSIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRV 291

Query: 862  KVKVNKIENGKISLSMKEVDQNSGEDLNP-RETDL---NPDAIGVRPRTPPASTSSWMNP 1029
            KVKV      K SLSMK+VDQ++GEDLNP R  +L     +   +R    P+  S    P
Sbjct: 292  KVKVLSFTGSKTSLSMKDVDQDTGEDLNPNRRRNLVGETNEETSMRNPDRPSHLSLVNAP 351

Query: 1030 EASGVGQGPSTSIGGGKARVRISTPERWELRQ 1125
            E               K   RIS PE+WE++Q
Sbjct: 352  EV-------EDDTLERKRLTRISDPEKWEIKQ 376



 Score = 78.2 bits (191), Expect = 1e-12
 Identities = 55/151 (36%), Positives = 81/151 (53%), Gaps = 4/151 (2%)
 Frame = +1

Query: 7   QLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSL 186
           +LE+LSLVSKV +E++NH G+ +KD+AEFVI LA++N TFD  K  L   G   +F DSL
Sbjct: 12  KLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKNTTFDTFKAVLIKNGA--EFTDSL 69

Query: 187 TATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAKEK 366
            + +LR++Q+M            SKE       +T     KE +K   PAL   +    +
Sbjct: 70  ISNLLRLIQTMRPPSKPST----SKE------VVTKPKSEKERLKELFPALCRPDNPNVR 119

Query: 367 ED-NEDDLMA---QLEKMEGRYESEKRLQKE 447
              +EDD+      L+++E    S  R  K+
Sbjct: 120 NMLDEDDVKVAADALKELEALMPSADRQGKQ 150


>gi|46121247|ref|XP_385178.1| hypothetical protein FG05002.1
            [Gibberella zeae PH-1]
 gi|42551260|gb|EAA74103.1| hypothetical protein FG05002.1 [Gibberella
            zeae PH-1]
          Length = 1195

 Score = 1118 bits (2891), Expect = 0.0
 Identities = 567/973 (58%), Positives = 731/973 (74%), Gaps = 11/973 (1%)
 Frame = +1

Query: 694  EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRN-ERVQTVADVLKRGENVKVK 870
            ++ K+Y G V  ++ FG F+ L   + + +GLVH+S++   +RV   +D++ +G+ V VK
Sbjct: 223  QLHKVYQGHVTGLKDFGCFVNLHNVKGRVDGLVHVSRMSTGQRVNHPSDLVTQGQEVWVK 282

Query: 871  V---NKIENGK--ISLSMKEVDQNSGEDLNPR---ETDLNPDAIGVRPRTPPASTSSWMN 1026
            V   +K +NG+  + LSMK+VDQ +G+DL P+    T  N +A+G   R   A  S
Sbjct: 283  VTSLDKDQNGRDRVGLSMKDVDQQNGQDLEPQVRMSTGANMEALGGGARDGFAEPSGMPR 342

Query: 1027 PEASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGV-LRNYX 1203
             +      GP       + + R+++PERWE+RQ+  +GV  A+D PD +E+    LR
Sbjct: 343  ND-----MGPPR-----RQKKRMTSPERWEIRQLIASGVAKASDYPDLEEDYNATLRGDG 392

Query: 1204 XXXXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKET 1383
                       + E+EP FL G  K   E+ P++VVK PDGS+ +AA+    L+KERKE
Sbjct: 393  ELELEEDVDIEVREEEPPFLAGQTKQSLELSPIRVVKAPDGSMNRAAMSGTNLAKERKEL 452

Query: 1384 KIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKE-MPEWLKHVTAG 1560
            K Q       D  K   S  +  DPM+      +++D    R N+  E +PEW K V
Sbjct: 453  KQQEADAAAKDEPKENLSQ-QWQDPMADPDKRKFASDLRNARKNQPAEDVPEWKKAVIPK 511

Query: 1561 GKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEA 1740
            G++  G+RTN+S+ +QRESLP+FA +  L++A+ +NQIL+VVGETGSGKTTQ+TQY  EA
Sbjct: 512  GQSL-GKRTNMSIKDQRESLPVFAFRTQLIKAVHENQILIVVGETGSGKTTQLTQYLAEA 570

Query: 1741 GLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGM 1920
            G    G IGCTQPRRVAAMSVAKRVAEE GCKLG +VGYTIRFEDCTS  T IKYMTDGM
Sbjct: 571  GFANDGMIGCTQPRRVAAMSVAKRVAEEVGCKLGEEVGYTIRFEDCTSPSTKIKYMTDGM 630

Query: 1921 LLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKF 2100
            L RE L+DPD+S YS IMLDEAHERTI TDVLF LLK   ++RP++K+I+TSATLD+ KF
Sbjct: 631  LQREILVDPDMSRYSCIMLDEAHERTIATDVLFALLKKTLKRRPDMKVIVTSATLDADKF 690

Query: 2101 SEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEE 2280
            S YF E PIFTIPGRTFPVE+LY+REPESDYL+ A +TVMQIHLTEP GD+L+FLTGQEE
Sbjct: 691  SAYFNECPIFTIPGRTFPVEVLYSREPESDYLDTALVTVMQIHLTEPKGDILLFLTGQEE 750

Query: 2281 IDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETS 2460
            IDT+CEVL+ERMK++GP+VP+LIILPVY +LP+EMQ+RIFDPAP G RKVVIATNIAETS
Sbjct: 751  IDTACEVLFERMKALGPNVPDLIILPVYASLPTEMQSRIFDPAPPGSRKVVIATNIAETS 810

Query: 2461 LTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTE 2640
            +TID I+YVVDPGFVKQ  Y+PK GMDSLVVTPISQA A QR+GRAGRTGPGKC+RLYTE
Sbjct: 811  ITIDEIYYVVDPGFVKQNAYDPKLGMDSLVVTPISQAQANQRAGRAGRTGPGKCFRLYTE 870

Query: 2641 RAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLS 2820
             A++ EMLPT +PEIQR NL++T+L LKAMGIN+L+ FDFMD PP+++M+TAL  L+ LS
Sbjct: 871  AAYQSEMLPTTIPEIQRQNLSTTILMLKAMGINDLLHFDFMDPPPINTMLTALEELYALS 930

Query: 2821 ALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQ 3000
            ALD +GLLT+LGR+MA+FP+EPSL+K+LI +VDL C+EEVL+IV+MLN+  +FYRPKEKQ
Sbjct: 931  ALDDEGLLTRLGRKMADFPMEPSLAKVLIAAVDLDCAEEVLSIVSMLNIPTVFYRPKEKQ 990

Query: 3001 DHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGI 3180
              ADQKKAKFH P GDHLT L VYNSWK   +S PWCFENFIQ RSM+RA+D+R Q++ I
Sbjct: 991  SQADQKKAKFHDPHGDHLTFLNVYNSWKTSGYSAPWCFENFIQARSMRRAKDVRDQIVKI 1050

Query: 3181 MDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQ 3360
            MDR+K  + SCGR   +V++A+C+GFFRNAA++DPQEGY+TL +G  VY+HPSSA F +Q
Sbjct: 1051 MDRYKHPIRSCGRATEKVRRALCAGFFRNAARKDPQEGYKTLIEGTPVYLHPSSALFGKQ 1110

Query: 3361 PEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKY 3540
             EWV+YHELV+T+KEYM   T+I+PKWLVE AP+FFK+  + +LS  K+ ++I PL++K+
Sbjct: 1111 AEWVIYHELVLTSKEYMHCTTSIEPKWLVEAAPTFFKVAPTDRLSKRKKAERIQPLYNKF 1170

Query: 3541 ADANAWRITRVKK 3579
            A  + WR++  +K
Sbjct: 1171 ATEDDWRLSAQRK 1183



 Score = 62.4 bits (150), Expect = 8e-08
 Identities = 51/145 (35%), Positives = 75/145 (51%)
 Frame = +1

Query: 10  LEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSLT 189
           LE LSLVSKV SEV+NH GV EK VAEF+I    E  +FD+ +  L++   G     SL
Sbjct: 7   LELLSLVSKVTSEVQNHLGVGEKTVAEFLIAKRTECNSFDEFRDNLETSTPG--LPPSLV 64

Query: 190 ATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAKEKE 369
            +I R+V ++          G +K++ K+    TL    KE++ + L          +
Sbjct: 65  ESIDRLVLAL-----HPKFKGKAKDEQKEHPSRTL--QEKEKVFSGLALPDKEPARDDGA 117

Query: 370 DNEDDLMAQLEKMEGRYESEKRLQK 444
           D  DD +A LE +E + + EK  +K
Sbjct: 118 DAIDDTLALLEGLEPKAKKEKPTRK 142


>gi|19114165|ref|NP_593253.1| putative pre-mRNA splicing factor
            ATP-dependent RNA helicase [Schizosaccharomyces pombe]
 gi|3913431|sp|O42643|DHX8_SCHPO Putative pre-mRNA splicing factor
            ATP-dependent RNA helicase C10F6.02c
 gi|7492844|pir||T37496 probable pre-mRNA splicing factor
            ATP-dependent RNA helicase - fission yeast
            (Schizosaccharomyces pombe)
 gi|2661607|emb|CAA15715.1| SPAC10F6.02c [Schizosaccharomyces pombe]
          Length = 1168

 Score = 1050 bits (2715), Expect = 0.0
 Identities = 537/970 (55%), Positives = 710/970 (72%), Gaps = 12/970 (1%)
 Frame = +1

Query: 706  IYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIR-NERVQTVADVLKRGENVKVKVNKI 882
            IY G V+ I+ FGAF+TL+GFR++ +GLVHIS I+ N R+   ++ +  G+ V VKV +I
Sbjct: 209  IYSGVVSGIKDFGAFVTLDGFRKRTDGLVHISNIQLNGRLDHPSEAVSYGQPVFVKVIRI 268

Query: 883  ENG--KISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGVGQGP 1056
            +    +ISLSMKEV+Q +GEDLNP       D +    +    + +  ++ + S +G
Sbjct: 269  DESAKRISLSMKEVNQVTGEDLNP-------DQVSRSTKKGSGANAIPLSAQNSEIGHVN 321

Query: 1057 STSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXX---XXXX 1227
                     R R+++PE WEL+Q+  +G ++ATD+P+ ++  G   N
Sbjct: 322  PLETFTSNGRKRLTSPEIWELQQLAASGAISATDIPELND--GFNTNNAAEINPEDDEDV 379

Query: 1228 XXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRER 1407
               L E+EP FL G  K   ++ P+KVVK PDGSL++AA+    L+ +R+E +   Q+E
Sbjct: 380  EIELREEEPGFLAGQTKVSLKLSPIKVVKAPDGSLSRAAMQGQILANDRREIR---QKEA 436

Query: 1408 DMDTQKGFSSNARIL---DPMSGNQSTAWSADESKDRNNKM-KEMPEWLKHVTAGGKATY 1575
             + +++        L   D MS  Q   ++ D       ++  E P W +  T     +Y
Sbjct: 437  KLKSEQEMEKQDLSLSWQDTMSNPQDRKFAQDVRDSAARQLTSETPSW-RQATRNANISY 495

Query: 1576 GRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRR 1755
            G+RT LSM EQRE LP+F L+K  +EA+  NQILV++GETGSGKTTQ+TQY  E G
Sbjct: 496  GKRTTLSMKEQREGLPVFKLRKQFLEAVSKNQILVLLGETGSGKTTQITQYLAEEGYTSD 555

Query: 1756 GK-IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRE 1932
             K IGCTQPRRVAAMSVAKRVAEE GC++G +VGYTIRFED TS+ T IKYMTDGML RE
Sbjct: 556  SKMIGCTQPRRVAAMSVAKRVAEEVGCRVGEEVGYTIRFEDKTSRMTQIKYMTDGMLQRE 615

Query: 1933 CLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYF 2112
            CL+DP LS YS+I+LDEAHERT+ TDVLFGLLK    KRP+LKLI+TSATLD+ +FS YF
Sbjct: 616  CLVDPLLSKYSVIILDEAHERTVATDVLFGLLKGTVLKRPDLKLIVTSATLDAERFSSYF 675

Query: 2113 LEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTS 2292
             + PIFTIPGR++PVEI+YT++PE+DYL+AA +TVMQIHL+E PGD+LVFLTGQEEIDTS
Sbjct: 676  YKCPIFTIPGRSYPVEIMYTKQPEADYLDAALMTVMQIHLSEGPGDILVFLTGQEEIDTS 735

Query: 2293 CEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTID 2472
            CE+LYER K +G  +PEL+ILPVY ALPSE+Q+RIF+PAP G RKVVIATNIAETSLTID
Sbjct: 736  CEILYERSKMLGDSIPELVILPVYSALPSEIQSRIFEPAPPGGRKVVIATNIAETSLTID 795

Query: 2473 GIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFR 2652
            GI+YVVDPGFVKQ  ++PK GMDSL+VTPISQA A+QRSGRAGRTGPGKCYRLYTE A+R
Sbjct: 796  GIYYVVDPGFVKQSCFDPKLGMDSLIVTPISQAQARQRSGRAGRTGPGKCYRLYTESAYR 855

Query: 2653 DEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDG 2832
            +EMLP+P+PEIQR NL+ T+L LKAMGIN+L++FDFMD PP  +MI AL  L+ LSALD
Sbjct: 856  NEMLPSPIPEIQRQNLSHTILMLKAMGINDLLNFDFMDPPPAQTMIAALQNLYALSALDD 915

Query: 2833 DGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHAD 3012
            +GLLT LGR+MA+FP+EP LSK+LI SV+LGCSEE+L+I+AML+V NI+ RP+EKQ  AD
Sbjct: 916  EGLLTPLGRKMADFPMEPQLSKVLITSVELGCSEEMLSIIAMLSVPNIWSRPREKQQEAD 975

Query: 3013 QKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRH 3192
            +++A+F  PE DHLTLL VY +WK +  S  WC+E++IQ R M+RA+D+RKQL+ +MDR+
Sbjct: 976  RQRAQFANPESDHLTLLNVYTTWKMNRCSDNWCYEHYIQARGMRRAEDVRKQLIRLMDRY 1035

Query: 3193 KLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEG-YRTLTDGQNVYIHPSSACFQQQPEW 3369
            +  +VSCGR    + +A+CSG+F N AKRD  EG Y+T+ +   VY+HPS   F +  EW
Sbjct: 1036 RHPVVSCGRKRELILRALCSGYFTNVAKRDSHEGCYKTIVENAPVYMHPSGVLFGKAAEW 1095

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADA 3549
            V+YHEL+ T+KEYM  V+ ++PKWLVE AP+FFK  ++ ++S  K+N K+ PL++++
Sbjct: 1096 VIYHELIQTSKEYMHTVSTVNPKWLVEVAPTFFKFANANQVSKTKKNLKVLPLYNRFEKP 1155

Query: 3550 NAWRITRVKK 3579
            + WRI++ +K
Sbjct: 1156 DEWRISKQRK 1165



 Score = 60.1 bits (144), Expect = 4e-07
 Identities = 39/141 (27%), Positives = 72/141 (50%), Gaps = 5/141 (3%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 180
           + +LE+LSLVSKV SE+ NH G+ +  +AEF+I+L  ++  +D+ K  + S   G +F D
Sbjct: 4   LKELEYLSLVSKVASEIRNHTGIDDNTLAEFIINLHDQSKNYDEFKNNVLS--CGGEFTD 61

Query: 181 SLTATILRIVQSMTAVXXXXXXGGDSKEDIKD--SHKITLISDAKEEIKARLPALAMANT 354
           S    I R+++ +           ++  +  +  SH +      K+  +   P L++ N+
Sbjct: 62  SFLQNISRLIKEIKPKDDIPTDNVNNGSNSVNGASHDLDSKDVDKQHQRKMFPGLSIPNS 121

Query: 355 AKEKEDNE---DDLMAQLEKM 408
                D     D+ M +LE++
Sbjct: 122 TNNLRDRPALMDNAMDELEEL 142


>gi|50421073|ref|XP_459081.1| unnamed protein product [Debaryomyces
            hansenii]
 gi|49654748|emb|CAG87249.1| unnamed protein product [Debaryomyces
            hansenii CBS767]
          Length = 1147

 Score = 1017 bits (2630), Expect = 0.0
 Identities = 541/1000 (54%), Positives = 705/1000 (70%), Gaps = 29/1000 (2%)
 Frame = +1

Query: 685  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE---RVQTVADVLKRGE 855
            E  E G +Y G V++I ++GAFI L   +  Q GL H+SQI  +   R+Q  +DVLK  +
Sbjct: 167  EPIEAGNVYKGYVSNITTYGAFIRLNDPKSFQSGLCHVSQISFDGRTRIQNPSDVLKLNQ 226

Query: 856  NVKVKVNKIENG-----------KISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPP 1002
             + VKV  IE             KISLSM+ +DQ +G D   R  ++N +A   R
Sbjct: 227  EIFVKVLLIEKPTSQVGRRLPREKISLSMRGIDQATGLD---RSEEINQNAKEEREGRV- 282

Query: 1003 ASTSSWMNPEASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDF--DE 1176
             +T         GV +             R+++PERWE+RQ+  +G ++A D P+   DE
Sbjct: 283  RNTDEQSKQSNRGVKR-------------RLTSPERWEIRQLIASGAMSAKDYPELLQDE 329

Query: 1177 EMGVL-----RNYXXXXXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQA 1341
            +          N             L  DEP FL+G  +   E+ PVK++KNP+GSL++A
Sbjct: 330  DPNAAFRDDTTNDDNNDDDLEIDIELNHDEPAFLKGQTQSSVELAPVKIIKNPEGSLSRA 389

Query: 1342 ALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKM 1521
            A+    L+K+ KE +++ QRE++   ++  + +    DP++   + A + + +      +
Sbjct: 390  AMNGSRLAKDIKEERLKEQREKEKQARQEKAKSKDSHDPLN-RANNAQNTEIATTNEKTL 448

Query: 1522 KEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGS 1701
              + EW K        +YG+RT+LS+ EQRESLPIF ++ +L++A+ +NQ LV+VGETGS
Sbjct: 449  NFISEWKKS-QMDKNISYGKRTSLSIKEQRESLPIFPMRADLIKAVRENQFLVIVGETGS 507

Query: 1702 GKTTQMTQYAIEAGL----GRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRF 1869
            GKTTQ+ QY  E  L    G +  IGCTQPRRVAA+SVAKRVAEEYGCK+G DVGYTIRF
Sbjct: 508  GKTTQIVQYLAEESLDKVEGEQKIIGCTQPRRVAAVSVAKRVAEEYGCKVGEDVGYTIRF 567

Query: 1870 EDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKR 2049
            ED TS+DT +KYMTDGML RE L DP +S YS+IMLDEAHERTI TDVLF LLK A
Sbjct: 568  EDKTSKDTRMKYMTDGMLQREALNDPLMSRYSVIMLDEAHERTIATDVLFTLLKKAVANN 627

Query: 2050 PELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIH 2229
            P LK+IITSATLD+ KFS YF   PI  IPGRT+PV+ILYTREPE DYL +A  +V+QIH
Sbjct: 628  PNLKIIITSATLDANKFSNYFNSCPIVRIPGRTYPVDILYTREPEMDYLSSALDSVIQIH 687

Query: 2230 LTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPA 2409
            ++EP GD+LVFLTGQEEIDTSCE LYERMK +G  VPELIILPVY ALPSEMQ++IF+
Sbjct: 688  ISEPEGDILVFLTGQEEIDTSCEALYERMKILGDTVPELIILPVYSALPSEMQSKIFEAT 747

Query: 2410 PAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRS 2589
            P G RKV++ATNIAETS+TIDGI+YVVDPGFVK   Y+ K GMDSL ++PISQA A QRS
Sbjct: 748  PPGSRKVILATNIAETSITIDGIYYVVDPGFVKINAYDSKLGMDSLTISPISQAQANQRS 807

Query: 2590 GRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDA 2769
            GRAGRTGPGKCYRLYTE AF+ EMLP  VPEIQR NL+ T+L LKAMGIN+L++F+FMD
Sbjct: 808  GRAGRTGPGKCYRLYTESAFKTEMLPNTVPEIQRQNLSHTILMLKAMGINDLLNFEFMDP 867

Query: 2770 PPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTI 2949
            PP ++M+ AL  L+TLSALD DG LTKLGR+MAEFP+EP+L+K LI+SVD GCS+E+LTI
Sbjct: 868  PPTNTMMNALQDLYTLSALDDDGYLTKLGRKMAEFPMEPALAKTLIISVDFGCSDEILTI 927

Query: 2950 VAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQ 3129
            VAML+VQ +FYRPK+KQ  ADQKK +FH   GDHLTLL VY SW  +  ++ WC EN+IQ
Sbjct: 928  VAMLSVQTVFYRPKDKQKQADQKKYRFHHQYGDHLTLLNVYRSWSLNGNNKQWCVENYIQ 987

Query: 3130 VRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLT 3309
             RSMKRAQ++RKQL+ IM +++  ++SCG ++ RV+KA+C+GFF++++KRDPQEGY+TL
Sbjct: 988  DRSMKRAQEVRKQLVLIMSKYRHPIISCGPNIDRVRKALCAGFFKHSSKRDPQEGYKTLV 1047

Query: 3310 DGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTK 3489
            +   V++HPSSA F + P++V+YH L++T+KEYM  VT ID KWL+E AP FFK  D+ K
Sbjct: 1048 EQTPVHLHPSSALFGKSPDYVIYHTLLLTSKEYMHCVTVIDAKWLLELAPGFFKKTDAAK 1107

Query: 3490 LSTFKRNQKIDPLFDKYA-DANAWRIT---RVKKRIYNPN 3597
            LS  ++N KI PLFDK++ D ++WR++    +KKR    N
Sbjct: 1108 LSEKRKNDKIVPLFDKFSKDKDSWRLSSQASIKKRALGNN 1147


>gi|50546573|ref|XP_500756.1| hypothetical protein [Yarrowia
            lipolytica]
 gi|49646622|emb|CAG83003.1| unnamed protein product [Yarrowia
            lipolytica CLIB99]
          Length = 1111

 Score =  998 bits (2581), Expect = 0.0
 Identities = 521/968 (53%), Positives = 687/968 (70%), Gaps = 7/968 (0%)
 Frame = +1

Query: 697  IGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVKVKVN 876
            I K+Y GRV ++ SFGAF+TL G + K +GLVH+S +   RV   +DV+  G+ V VKV
Sbjct: 163  INKVYKGRVKNLTSFGAFVTLSGLKNKTDGLVHVSVLAANRVDHPSDVVSVGDVVYVKVC 222

Query: 877  KIENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGVGQGP 1056
            KI+  KI LS+ +VDQ +G+ +   E     D  G   R        +   +   V
Sbjct: 223  KIDGRKIGLSLNDVDQQTGQVMERVERSRGRDG-GSEERG-----RRYQKQDEQPV---- 272

Query: 1057 STSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXX 1236
                   K R R+++PERWE+RQ+  +GV+ A D PD DE++  L+
Sbjct: 273  -------KKRTRLTSPERWEIRQLIASGVVNAADYPDLDEDIESLQQEATVGVEEDVEIE 325

Query: 1237 LVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMD 1416
            + E EP FL G      E+ PV+VVK PDGSL +AA+     +KER+E K Q ++  D+
Sbjct: 326  VKEIEPPFLAGQTFQSLELSPVRVVKAPDGSLNRAAINSAVSAKERREKK-QKEKAEDLL 384

Query: 1417 TQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMK---EMPEWLKHVTAGGKAT-YG-- 1578
            +Q          D  S  + +  S D + D     K     PEW K  T G K T YG
Sbjct: 385  SQ----------DAASETRDSRNSLDVASDPLAHHKYGAADPEW-KQATIGTKNTAYGNR 433

Query: 1579 RRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG 1758
            +R ++S+ E R SLP++  +++L+ A+ DNQI++VVGETGSGKTTQ+TQY  EAG  +
Sbjct: 434  QRDSMSIAEVRRSLPVYEFRQDLINAIRDNQIIIVVGETGSGKTTQITQYLYEAGFAKNK 493

Query: 1759 KIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECL 1938
            +IGCTQPRRVAA+SVAKRVAEE GCK+G +VGY IRFED T   T IKYMTDGML RE L
Sbjct: 494  RIGCTQPRRVAAVSVAKRVAEEVGCKVGKEVGYLIRFEDWTCPQTKIKYMTDGMLQREAL 553

Query: 1939 IDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLE 2118
            +DPD+  YS++MLDEAHERTI TD+LF LLK AA++RP+L+L+ITSATL++ KFS YF
Sbjct: 554  VDPDMDQYSVLMLDEAHERTIATDILFALLKKAAKRRPDLRLVITSATLNAEKFSSYFDG 613

Query: 2119 APIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCE 2298
            API TIPGRTFPVE  + +EPE+DYLEAA  TVM IH+T+ PGD+LVFLTGQEEID++CE
Sbjct: 614  APIITIPGRTFPVEEHFAKEPEADYLEAAIDTVMDIHVTQDPGDILVFLTGQEEIDSACE 673

Query: 2299 VLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGI 2478
            +LYER K +      LIILPVY +LPSEMQ+RIFDPAP G RKVV+ATNIAETS+TIDG+
Sbjct: 674  ILYERSKKIESVAGPLIILPVYSSLPSEMQSRIFDPAPPGSRKVVLATNIAETSITIDGV 733

Query: 2479 FYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDE 2658
            +YVVDPGFVK   Y+ K GMDSL + PISQA A QR+GRAGRTGPGKCYRLYTE +F +E
Sbjct: 734  YYVVDPGFVKINAYDSKLGMDSLQIAPISQAQATQRAGRAGRTGPGKCYRLYTENSFHNE 793

Query: 2659 MLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDG 2838
            ML   VPEIQR NL+ T+L LKAMGIN+L++FDFMD PP +++++ALN LH LSA+DG+G
Sbjct: 794  MLTNTVPEIQRQNLSHTILMLKAMGINDLLNFDFMDPPPHNTLLSALNDLHHLSAIDGEG 853

Query: 2839 LLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQK 3018
            LLTKLGR MA+FP+EP+++K+L+ SVD  C+EE+LTIVAML+VQ++F+RPK   + AD K
Sbjct: 854  LLTKLGRNMADFPMEPAMAKVLLNSVDHNCAEEILTIVAMLSVQSVFFRPKNMAEKADAK 913

Query: 3019 KAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKL 3198
            + KF  P GDHLT+L VYN+WK ++ S+ W  ENFIQ RSM+RAQD+R QL+ IM R+K
Sbjct: 914  RKKFMDPTGDHLTMLNVYNAWKRNNCSKMWTNENFIQDRSMRRAQDVRNQLVSIMGRYKH 973

Query: 3199 LMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVY 3378
             + SCG     V+K +CSG+F+N+A++DPQ+GY+TL +   V++HPSSA F +  ++V+Y
Sbjct: 974  RISSCGASTDIVRKVLCSGYFKNSAEKDPQQGYKTLIERTPVFMHPSSALFSKPSQYVIY 1033

Query: 3379 HELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYA-DANA 3555
            H L++T+KEYM  VT+ID KWL   AP+FF   D++KLS  K+++KI PL+D+YA D ++
Sbjct: 1034 HTLLLTSKEYMHCVTSIDAKWLPWAAPTFFSFADTSKLSKEKKSKKIVPLYDRYAQDQDS 1093

Query: 3556 WRITRVKK 3579
            WR++  ++
Sbjct: 1094 WRLSSARR 1101



 Score = 46.6 bits (109), Expect = 0.004
 Identities = 33/124 (26%), Positives = 60/124 (47%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 180
           ++QLE ++LVS +  E+ N+ G+ +K +AEFV+ + +E+   D+   A   + +G  F D
Sbjct: 4   LEQLEIIALVSTLTQEINNYTGINDKTLAEFVLGMYEESKG-DRDDFATKLKAVGGDFPD 62

Query: 181 SLTATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAK 360
           S    + +++  +         G      +K+   +      KEE   +L  L M +TA
Sbjct: 63  SFVDRMRQLISDL----HPKYRGNSMPAPVKEEPTV-----KKEEPSEKLSVLTMKDTAP 113

Query: 361 EKED 372
            K D
Sbjct: 114 IKSD 117


>gi|46443884|gb|EAL03163.1| hypothetical protein CaO19.4033 [Candida
            albicans SC5314]
 gi|46444050|gb|EAL03328.1| hypothetical protein CaO19.11516 [Candida
            albicans SC5314]
          Length = 996

 Score =  932 bits (2410), Expect = 0.0
 Identities = 494/968 (51%), Positives = 664/968 (68%), Gaps = 10/968 (1%)
 Frame = +1

Query: 694  EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIR--NERVQTVADVLKRGENVKV 867
            ++GKIY G V S+ ++GAFI +EG      GL HISQ+     RV++  +VL   + V V
Sbjct: 74   QVGKIYSGVVQSVTNYGAFIKIEG----TSGLCHISQMSFDGSRVEST-NVLAPNQKVFV 128

Query: 868  KVNKIEN--GKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASG 1041
            KV  I+    +ISLSM+ ++QN+G +      +  P     + R P
Sbjct: 129  KVIDIQTHANRISLSMRGINQNTGHE------EPIPQRGRYQERQP-------------- 168

Query: 1042 VGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXX 1221
                        + + ++++PERWE+RQ+  +G ++A D P+ D+E
Sbjct: 169  ------------RPKRKLTSPERWEIRQLISSGAVSADDYPELDQEEDT---QTESEKTD 213

Query: 1222 XXXXXLVEDEPDFLRGYG--KGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQA 1395
                 L + +PDFL+G    K   E  P+ V  N  G L ++A      +++ KE K +
Sbjct: 214  NLHIELNDKKPDFLKGVKVTKDFPETTPIPV--NQSGPLTKSAQRGSKFARDFKEEKFKQ 271

Query: 1396 QRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATY 1575
            +++R+ + +      + + DP+        ++D   D  + + +   W K   +    T+
Sbjct: 272  KKQREKEEKM----QSELSDPLFQTSEPVKNSDLDPDTESFISK---WKK---SNKTETF 321

Query: 1576 GRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRR 1755
            G+RT+L + EQR  LP++A++  L+EA+ DNQ +V+VGETGSGKTTQ+ QY  E G+ +
Sbjct: 322  GKRTSLPIQEQRRMLPVYAMRSQLLEAIRDNQFVVIVGETGSGKTTQIVQYIYEEGMNKV 381

Query: 1756 GK----IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGML 1923
            G     IGCTQPRRVAA SVAKRV+EE GCKLG  VGYTIRFED TS++T+IKYMTDGML
Sbjct: 382  GGQTKLIGCTQPRRVAAESVAKRVSEEVGCKLGDTVGYTIRFEDVTSENTVIKYMTDGML 441

Query: 1924 LRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFS 2103
             RE L DP+++ YS+IMLDEAHERTI TDVLF LLK AA++ P LK+I+TSATLDS KFS
Sbjct: 442  EREALNDPNMNRYSVIMLDEAHERTIATDVLFALLKNAAKQNPNLKVIVTSATLDSNKFS 501

Query: 2104 EYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEI 2283
             YF   PI TIPGRTFPVE+LYT+ PE DYL AA  +V+QIH++EP GD+LVFLTGQEEI
Sbjct: 502  RYFNNCPIITIPGRTFPVEVLYTKAPEMDYLAAALESVIQIHVSEPAGDILVFLTGQEEI 561

Query: 2284 DTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSL 2463
            +TSCE L+ERMK +G ++PELIILPVY ALPSEMQTRIF+P P G RKV++ATNIAETS+
Sbjct: 562  ETSCEALHERMKLLGENIPELIILPVYSALPSEMQTRIFEPTPPGSRKVILATNIAETSI 621

Query: 2464 TIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTER 2643
            TIDGI+YVVDPGFVK  +Y+ K GMDSL VTPIS+A A QRSGRAGRTGPGKCYRLYTE+
Sbjct: 622  TIDGIYYVVDPGFVKINMYDSKLGMDSLRVTPISKAQANQRSGRAGRTGPGKCYRLYTEQ 681

Query: 2644 AFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSA 2823
            A+  EM+P  +PEIQR NL+ T+L LKAMGI++L++F+FMD P   +M+TAL  L+ L A
Sbjct: 682  AYEKEMIPNTIPEIQRQNLSHTILMLKAMGIHDLVNFEFMDPPSTTTMLTALEDLYILDA 741

Query: 2824 LDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQD 3003
            LD DG LT LGR+MA+ P+EP+L+K LI SV+  C+EE+L+IVAML+VQ IFYRPK+KQ
Sbjct: 742  LDDDGNLTTLGRKMADLPMEPALAKTLIQSVEYECTEEILSIVAMLSVQTIFYRPKDKQA 801

Query: 3004 HADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIM 3183
             ADQ+K++FH   GDHLTLL V+ SW  +++S+ WC +NFIQ RSM+RA ++RKQL  IM
Sbjct: 802  LADQRKSRFHHSLGDHLTLLNVFQSWCRNNYSKTWCRDNFIQERSMRRAMEVRKQLKSIM 861

Query: 3184 DRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQP 3363
             R     +SCG DV RV++  CSG+F+N+AKR   EGY+TL +   VY+HPSS+ + ++P
Sbjct: 862  QRFGYKTMSCGNDVDRVRRTFCSGYFKNSAKRQEGEGYKTLNENTLVYLHPSSSLYGKKP 921

Query: 3364 EWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYA 3543
            ++V+YH L++T+KEYM  V+ IDP WL E AP +F+  D+  +   K+ QKI PLF +
Sbjct: 922  QYVIYHTLLLTSKEYMHCVSIIDPNWLYELAPKYFRPADAKTVQEIKKKQKIVPLFSRQK 981

Query: 3544 DANAWRIT 3567
              N WR++
Sbjct: 982  KDN-WRLS 988


>gi|50304197|ref|XP_452048.1| unnamed protein product [Kluyveromyces
            lactis]
 gi|49641180|emb|CAH02441.1| unnamed protein product [Kluyveromyces
            lactis NRRL Y-1140]
          Length = 1111

 Score =  932 bits (2408), Expect = 0.0
 Identities = 482/983 (49%), Positives = 661/983 (67%), Gaps = 23/983 (2%)
 Frame = +1

Query: 697  IGKIYDGRVNSIQSFGAFITLEGFRQKQ-EGLVHISQIRNERVQTVADVLKRGENVKVKV 873
            + K+Y G+V ++  FG F+ + G R    +GLVH+S++ +  V    DV+ R ++V VKV
Sbjct: 178  LDKVYPGKVQNVTKFGCFVRIFGVRNTNVDGLVHVSELSSSHVDKPEDVVHRNQDVFVKV 237

Query: 874  NKIEN-GKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGVGQ 1050
             KI+N GKISL+MK +DQ++G +   R                   T   + P+
Sbjct: 238  IKIQNNGKISLAMKGIDQSTGMEAATR-----------------GRTKEKVIPKR----- 275

Query: 1051 GPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXX 1230
                         ++++PERWE+RQ+  +G  +  D P+  ++  + +
Sbjct: 276  -------------KLTSPERWEIRQLISSGAASIEDYPELKDDYNISQPTNSEADGTNEQ 322

Query: 1231 XXL--------VEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETK 1386
                       V+DEP FL+G  K   + E   + K P GSL ++A++     KE +E K
Sbjct: 323  KEEEELEVEINVDDEPKFLKGQVKPDRKYELPSITKVPKGSLNRSAMVGSYTMKEHREEK 382

Query: 1387 IQAQRERDMDTQKGFSSNARILDPMSGNQ------------STAWSADESKDRNNKMKEM 1530
            ++ ++E     +K  + + ++ DP S               +TAW     K+R
Sbjct: 383  LKRKKE----VKKQLNKSKQLADPSSSKVLSNSEFDARQLVATAWERSRMKER------- 431

Query: 1531 PEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKT 1710
                         +YG+RT+L + EQRE LP++ +++ L++A+I NQ LV+VGETGSGKT
Sbjct: 432  ------------VSYGKRTSLPIKEQRERLPVYRMRQQLIDAVIKNQFLVIVGETGSGKT 479

Query: 1711 TQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQD 1890
            TQ+TQY  E GL  +G IGCTQPRRVAA+SVAKRVAEE GC +G +VGYTIRFED TS
Sbjct: 480  TQLTQYLDEEGLSNKGMIGCTQPRRVAAVSVAKRVAEEMGCNVGEEVGYTIRFEDETSSR 539

Query: 1891 TIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLII 2070
            T IKY+TDGM+ RE L+DP +S YS+I+LDEAHERT+ TDVLF LLK AA +RP+LK+II
Sbjct: 540  TRIKYLTDGMMQREALLDPLMSRYSVILLDEAHERTVATDVLFALLKKAALQRPDLKVII 599

Query: 2071 TSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGD 2250
            TSATLDS KFS+YF+  P+  IPG+TFPVE+LY+ +P+ DY+E+A  T M IH+ EP GD
Sbjct: 600  TSATLDSDKFSKYFMNCPVIEIPGKTFPVEVLYSSKPQMDYIESALDTTMDIHINEPQGD 659

Query: 2251 VLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKV 2430
            VLVFLTGQEEIDT CE+LYER+K++   +PELIILPVY ALPSE+Q+RIF+P P G RKV
Sbjct: 660  VLVFLTGQEEIDTCCEILYERVKALDGTIPELIILPVYSALPSEIQSRIFEPTPKGSRKV 719

Query: 2431 VIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTG 2610
            + ATNIAETS+TIDG++YV+DPGF K   YNP+ GM+ L+V+PISQA A QR GRAGRTG
Sbjct: 720  IFATNIAETSITIDGVYYVIDPGFSKINTYNPRVGMEQLLVSPISQAQANQRKGRAGRTG 779

Query: 2611 PGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMI 2790
            PGKC+RLYTE AF++EMLP  VPEIQR NL  T+L LKAMGIN+L++F+FMD PP   M+
Sbjct: 780  PGKCFRLYTESAFKNEMLPNTVPEIQRQNLEHTILMLKAMGINDLLNFEFMDPPPKSFMV 839

Query: 2791 TALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQ 2970
            +AL  L  L ALD +G LT LG+RM++FP+EP LSK L+ SV   CS+E+LTIVAML++Q
Sbjct: 840  SALEELFNLQALDEEGFLTTLGKRMSQFPMEPGLSKTLLASVTNKCSDEMLTIVAMLSIQ 899

Query: 2971 NIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRA 3150
            N+FYRPK+KQ  AD +KA+FH P GDHLTLL V+N W+  ++S+ +C  NF+  R +KRA
Sbjct: 900  NVFYRPKDKQQEADNRKARFHHPYGDHLTLLNVFNRWRESNYSKSFCTTNFLHERHLKRA 959

Query: 3151 QDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYI 3330
             D+R+QL  I  +  L +VSC  DV  ++K + SGFFRNAAKR+ Q GY+TLTDG  V I
Sbjct: 960  LDVRQQLFNIFKKMNLPIVSCHGDVDCIRKTLVSGFFRNAAKRESQAGYKTLTDGTQVAI 1019

Query: 3331 HPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRN 3510
             P S+ F ++ ++V+YH +V+T++EYM +VTAI+ KWL+E AP F+K+ D    S  ++
Sbjct: 1020 SPGSSLFGKEYDYVLYHSIVLTSREYMMQVTAIESKWLLESAPHFYKVADPNGSS--RKK 1077

Query: 3511 QKIDPLFDKYADA-NAWRITRVK 3576
             KI PL D++A + ++WR++ ++
Sbjct: 1078 AKIVPLNDRFAQSKDSWRLSSIR 1100


>gi|6320850|ref|NP_010929.1| RNA-dependent ATPase/ATP-dependent RNA
            helicase in the DEAH-box family, associates with the
            lariat intermediate before the second catalytic step of
            splicing; Prp22p [Saccharomyces cerevisiae]
 gi|130830|sp|P24384|PR22_YEAST Pre-mRNA splicing factor RNA helicase
            PRP22
 gi|83433|pir||S13643 PRP22 protein - yeast (Saccharomyces cerevisiae)
 gi|4234|emb|CAA41530.1| PRP22 [Saccharomyces cerevisiae]
 gi|603605|gb|AAB64546.1| Prp22p: pre-mRNA splicing factor RNA
            helicase [Saccharomyces cerevisiae]
          Length = 1145

 Score =  931 bits (2407), Expect = 0.0
 Identities = 489/988 (49%), Positives = 676/988 (67%), Gaps = 29/988 (2%)
 Frame = +1

Query: 703  KIYDGRVNSIQSFGAFITLEGFRQKQ-EGLVHISQIRNERVQTVADVLKRGENVKVKVNK 879
            K+Y+G+V +I +FG F+ + G R K  +GLVHIS++ ++R     DV+++G+++ V+V K
Sbjct: 179  KVYEGKVRNITTFGCFVQIFGTRMKNCDGLVHISEMSDQRTLDPHDVVRQGQHIFVEVIK 238

Query: 880  IEN-GKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGVGQGP 1056
            I+N GKISLSMK +DQ+SGE +  R T+   D    R R+  A TS  M  +
Sbjct: 239  IQNNGKISLSMKNIDQHSGE-IRKRNTESVED----RGRSNDAHTSRNMKNKIK------ 287

Query: 1057 STSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXX 1236
                     R  +++PERWE+RQ+  +G  +  D P+  +E+ +  +Y
Sbjct: 288  ---------RRALTSPERWEIRQLIASGAASIDDYPELKDEIPINTSYLTAKRDDGSIVN 338

Query: 1237 -------------------------LVEDEPDFLRGYG-KGGAEIEPVKVVKNPDGSLAQ 1338
                                       +D P FL+    KG  + E  K+ K P G + +
Sbjct: 339  GNTEKVDSKLEEQQRDETDEIDVELNTDDGPKFLKDQQVKGAKKYEMPKITKVPRGFMNR 398

Query: 1339 AALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNK 1518
            +A+      ++ +E K++ +RE +   +K  S +    DP    +    S +E +   N+
Sbjct: 399  SAINGSNAIRDHREEKLRKKREIEQQIRKQQSFD----DPTKNKKD---SRNEIQMLKNQ 451

Query: 1519 MKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETG 1698
            +  + EW K+       +YG+RT+L +  QR++LP++A++  L++A+ DNQ LV+VGETG
Sbjct: 452  LI-VTEWEKN-RMNESISYGKRTSLPISAQRQTLPVYAMRSELIQAVRDNQFLVIVGETG 509

Query: 1699 SGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDC 1878
            SGKTTQ+TQY  E G    G IGCTQPRRVAA+SVAKRVAEE GCK+G DVGYTIRFED
Sbjct: 510  SGKTTQITQYLDEEGFSNYGMIGCTQPRRVAAVSVAKRVAEEVGCKVGHDVGYTIRFEDV 569

Query: 1879 TSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPEL 2058
            T  DT IKYMTDGML RE L+DP++S YS+IMLDEAHERT+ TDVLF LLK AA KRPEL
Sbjct: 570  TGPDTRIKYMTDGMLQREALLDPEMSKYSVIMLDEAHERTVATDVLFALLKKAAIKRPEL 629

Query: 2059 KLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTE 2238
            K+I+TSATL+S KFSEYFL  PI  IPG+TFPVE+LY++ P+ DY+EAA   V+ IH+ E
Sbjct: 630  KVIVTSATLNSAKFSEYFLNCPIINIPGKTFPVEVLYSQTPQMDYIEAALDCVIDIHINE 689

Query: 2239 PPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAG 2418
             PGD+LVFLTGQEEID+ CE+LY+R+K++G  + EL+ILPVY ALPSE+Q++IF+P P G
Sbjct: 690  GPGDILVFLTGQEEIDSCCEILYDRVKTLGDSIGELLILPVYSALPSEIQSKIFEPTPKG 749

Query: 2419 KRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRA 2598
             RKVV ATNIAETS+TIDGI+YVVDPGF K  IYN ++G++ L+V+PISQA A QR GRA
Sbjct: 750  SRKVVFATNIAETSITIDGIYYVVDPGFAKINIYNARAGIEQLIVSPISQAQANQRKGRA 809

Query: 2599 GRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPL 2778
            GRTGPGKCYRLYTE AF +EML   VPEIQR NL+ T+L LKAMGIN+L+ FDFMD PP
Sbjct: 810  GRTGPGKCYRLYTESAFYNEMLENTVPEIQRQNLSHTILMLKAMGINDLLKFDFMDPPPK 869

Query: 2779 DSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAM 2958
            + M+ AL  L+ L +LD +G LT LG+ M+ FP++P+LS+ L+ SVD  CS+E++TI++M
Sbjct: 870  NLMLNALTELYHLQSLDDEGKLTNLGKEMSLFPMDPTLSRSLLSSVDNQCSDEIVTIISM 929

Query: 2959 LNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRS 3138
            L+VQN+FYRPK++Q  AD KKAKFH P GDHLTLL VY  W+  ++S+ +C  NF+  R
Sbjct: 930  LSVQNVFYRPKDRQLEADSKKAKFHHPYGDHLTLLNVYTRWQQANYSEQYCKTNFLHFRH 989

Query: 3139 MKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQ 3318
            +KRA+D++ Q+  I  +  L ++SC  D   ++K   SGFF NAAKRD Q GY+T+  G
Sbjct: 990  LKRARDVKSQISMIFKKIGLKLISCHSDPDLIRKTFVSGFFMNAAKRDSQVGYKTINGGT 1049

Query: 3319 NVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLST 3498
             V IHPSS+ + ++ E+V+YH +V+T++EYM +VT+I+P+WL+E AP F+K GD+   S
Sbjct: 1050 EVGIHPSSSLYGKEYEYVMYHSIVLTSREYMSQVTSIEPQWLLEVAPHFYKAGDAESQS- 1108

Query: 3499 FKRNQKIDPLFDKYA-DANAWRITRVKK 3579
             ++  KI PL +K+A D N+WR++ +++
Sbjct: 1109 -RKKAKIIPLHNKFAKDQNSWRLSSIRQ 1135


>gi|227517|prf||1705293A RNA helicase-like protein
          Length = 1144

 Score =  925 bits (2391), Expect = 0.0
 Identities = 488/988 (49%), Positives = 675/988 (67%), Gaps = 29/988 (2%)
 Frame = +1

Query: 703  KIYDGRVNSIQSFGAFITLEGFRQKQ-EGLVHISQIRNERVQTVADVLKRGENVKVKVNK 879
            K+Y+G+V +I +FG F+ + G R K  +GLVHIS++ ++R     DV+++G+++ V+V K
Sbjct: 179  KVYEGKVRNITTFGCFVQIFGTRMKNCDGLVHISEMSDQRTLDPHDVVRQGQHIFVEVIK 238

Query: 880  IEN-GKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGVGQGP 1056
            I+N GKISLSMK +DQ+SGE +  R T+   D    R R+  A TS  M  +
Sbjct: 239  IQNNGKISLSMKNIDQHSGE-IRKRNTESVED----RGRSNDAHTSRNMKNKIK------ 287

Query: 1057 STSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXX 1236
                     R  +++PERWE+RQ+  +G  +  D P+  +E+ +  +Y
Sbjct: 288  ---------RRALTSPERWEIRQLIASGAASIDDYPELKDEIPINTSYLTAKRDDGSIVN 338

Query: 1237 -------------------------LVEDEPDFLRGYG-KGGAEIEPVKVVKNPDGSLAQ 1338
                                       +D P FL+    KG  + E  K+ K P G + +
Sbjct: 339  GNTEKVDSKLEEQQRDETDEIDVELNTDDGPKFLKDQQVKGAKKYEMPKITKVPRGFMNR 398

Query: 1339 AALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNK 1518
            +A+      ++ +E K++ +RE +   +K  S +    DP    +    S +E +   N+
Sbjct: 399  SAINGSNAIRDHREEKLRKKREIEQQIRKQQSFD----DPTKNKKD---SRNEIQMLKNQ 451

Query: 1519 MKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETG 1698
            +  + EW K+       +YG+RT+L +  QR++LP++A++  L++A+ DNQ LV+VGETG
Sbjct: 452  LI-VTEWEKN-RMNESISYGKRTSLPISAQRQTLPVYAMRSELIQAVRDNQFLVIVGETG 509

Query: 1699 SGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDC 1878
            SGKTTQ+TQY  E G    G IGCTQPRRVA +SVAKRVAEE GCK+G DVGYTIRFED
Sbjct: 510  SGKTTQITQYLDEEGFSNYGMIGCTQPRRVA-VSVAKRVAEEVGCKVGHDVGYTIRFEDV 568

Query: 1879 TSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPEL 2058
            T  DT IKYMTDGML RE L+DP++S YS+IMLDEAHERT+ TDVLF LLK AA KRPEL
Sbjct: 569  TGPDTRIKYMTDGMLQREALLDPEMSKYSVIMLDEAHERTVATDVLFALLKKAAIKRPEL 628

Query: 2059 KLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTE 2238
            K+I+TSATL+S KFSEYFL  PI  IPG+TFPVE+LY++ P+ DY+EAA   V+ IH+ E
Sbjct: 629  KVIVTSATLNSAKFSEYFLNCPIINIPGKTFPVEVLYSQTPQMDYIEAALDCVIDIHINE 688

Query: 2239 PPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAG 2418
             PGD+LVFLTGQEEID+ CE+LY+R+K++G  + EL+ILPVY ALPSE+Q++IF+P P G
Sbjct: 689  GPGDILVFLTGQEEIDSCCEILYDRVKTLGDSIGELLILPVYSALPSEIQSKIFEPTPKG 748

Query: 2419 KRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRA 2598
             RKVV ATNIAETS+TIDGI+YVVDPGF K  IYN ++G++ L+V+PISQA A QR GRA
Sbjct: 749  SRKVVFATNIAETSITIDGIYYVVDPGFAKINIYNARAGIEQLIVSPISQAQANQRKGRA 808

Query: 2599 GRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPL 2778
            GRTGPGKCYRLYTE AF +EML   VPEIQR NL+ T+L LKAMGIN+L+ FDFMD PP
Sbjct: 809  GRTGPGKCYRLYTESAFYNEMLENTVPEIQRQNLSHTILMLKAMGINDLLKFDFMDPPPK 868

Query: 2779 DSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAM 2958
            + M+ AL  L+ L +LD +G LT LG+ M+ FP++P+LS+ L+ SVD  CS+E++TI++M
Sbjct: 869  NLMLNALTELYHLQSLDDEGKLTNLGKEMSLFPMDPTLSRSLLSSVDNQCSDEIVTIISM 928

Query: 2959 LNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRS 3138
            L+VQN+FYRPK++Q  AD KKAKFH P GDHLTLL VY  W+  ++S+ +C  NF+  R
Sbjct: 929  LSVQNVFYRPKDRQLEADSKKAKFHHPYGDHLTLLNVYTRWQQANYSEQYCKTNFLHFRH 988

Query: 3139 MKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQ 3318
            +KRA+D++ Q+  I  +  L ++SC  D   ++K   SGFF NAAKRD Q GY+T+  G
Sbjct: 989  LKRARDVKSQISMIFKKIGLKLISCHSDPDLIRKTFVSGFFMNAAKRDSQVGYKTINGGT 1048

Query: 3319 NVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLST 3498
             V IHPSS+ + ++ E+V+YH +V+T++EYM +VT+I+P+WL+E AP F+K GD+   S
Sbjct: 1049 EVGIHPSSSLYGKEYEYVMYHSIVLTSREYMSQVTSIEPQWLLEVAPHFYKAGDAESQS- 1107

Query: 3499 FKRNQKIDPLFDKYA-DANAWRITRVKK 3579
             ++  KI PL +K+A D N+WR++ +++
Sbjct: 1108 -RKKAKIIPLHNKFAKDQNSWRLSSIRQ 1134


>gi|45184843|ref|NP_982561.1| AAR020Wp [Eremothecium gossypii]
 gi|44980452|gb|AAS50385.1| AAR020Wp [Eremothecium gossypii]
          Length = 1112

 Score =  910 bits (2351), Expect = 0.0
 Identities = 483/971 (49%), Positives = 649/971 (66%), Gaps = 11/971 (1%)
 Frame = +1

Query: 700  GKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNERVQTVADVLKRGENVKVKVNK 879
            GKIY   + +I+ FG F  + G ++  EGL+HISQ+ + RV +  DV+  G++V VK+ K
Sbjct: 183  GKIYRAVIRNIKPFGCFARVLGTKRSCEGLIHISQLSHSRVGSPNDVVSVGDHVYVKITK 242

Query: 880  IE-NGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGVGQGP 1056
            ++ NGK+SLSM+EVDQ +G+                                    G+
Sbjct: 243  VQDNGKLSLSMREVDQATGQTATVNR------------------------------GRSD 272

Query: 1057 STSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXX 1236
              ++     R ++S+PERWE+RQM  +GV +  D P+  EE+  L+
Sbjct: 273  ERTV----YRRQLSSPERWEIRQMIQSGVSSIDDYPELKEELSHLQQQTQVAGSKHSNES 328

Query: 1237 --------LVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQ 1392
                      E EP FL G+     + E   +VK P GSL   A+    L +E ++ K+
Sbjct: 329  DELIDVELNTEHEPKFLSGHTATAKKPELPTIVKLPKGSLNNTAMTGSKLLQEHRQEKLA 388

Query: 1393 AQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKAT 1572
             Q+  D           R+L  +        S  + K   +K + +  W +   A  K T
Sbjct: 389  LQKSTD--------KKERLLRELDD------SGHKKKAFEDKQRALTAWERKRMAE-KVT 433

Query: 1573 YGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGR 1752
            YG+RTNLS+ +QRESLP+F +++ L+ A+ DNQ LV+VGETGSGKTTQ+TQY  E G
Sbjct: 434  YGKRTNLSIKQQRESLPVFKMRETLVSAIRDNQFLVIVGETGSGKTTQITQYLDEEGFSV 493

Query: 1753 RGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRE 1932
             G IGCTQPRRVAA+SVAKRV+EE GCKLG DVGYTIRFED TS+ T IKYMTDGML  E
Sbjct: 494  GGMIGCTQPRRVAAVSVAKRVSEEMGCKLGEDVGYTIRFEDQTSRKTRIKYMTDGMLQVE 553

Query: 1933 CLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYF 2112
             L+DP +S YS+IMLDEAHERT+ TDVLF LLK AA KRP+L++I+TSATLDS KFS+YF
Sbjct: 554  ALLDPTMSRYSVIMLDEAHERTVSTDVLFSLLKQAALKRPDLRVIVTSATLDSEKFSKYF 613

Query: 2113 LEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTS 2292
            L+ P+  I G+TFPV+++Y+  P+ DY+EAA  TVM+IH+ E PGD+LVFLT QEEID
Sbjct: 614  LDCPVIKISGKTFPVDVIYSETPQLDYIEAALDTVMEIHINESPGDILVFLTSQEEIDAC 673

Query: 2293 CEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTID 2472
            CE+LYER++++   + EL+ILPVY ALPSE+Q++IF+P P G RKV+ ATNIAETS+TID
Sbjct: 674  CEILYERVQALKETIQELLILPVYSALPSEVQSKIFEPTPKGSRKVIFATNIAETSITID 733

Query: 2473 GIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFR 2652
            GI+YVVDPG+ K  IYNPK G++ LVV+PISQ+ A QR GRAGRTGPGKCYRL+TE AF
Sbjct: 734  GIYYVVDPGYAKSNIYNPKIGIEQLVVSPISQSQADQRKGRAGRTGPGKCYRLFTEAAFH 793

Query: 2653 DEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDG 2832
             EM+P  VPEIQR NL  T+L LKAMGIN+L++FDFMD PP  SM+ AL  L+ L ALD
Sbjct: 794  REMVPNSVPEIQRQNLEHTILMLKAMGINDLLNFDFMDPPPRSSMVHALEALYNLQALDE 853

Query: 2833 DGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEK-QDHA 3009
            DG LT+LG+RM++FP+EP+LSK LI SV+ GCS+E+LTI+AML+VQN+FYRPK+K Q+
Sbjct: 854  DGYLTQLGKRMSQFPMEPALSKSLIASVEQGCSDEILTIIAMLSVQNVFYRPKDKIQETR 913

Query: 3010 DQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDR 3189
              KK  FH P GDHLTLL ++N W+ ++FS+ +C ENF+  R ++RA+D+++QL  I
Sbjct: 914  YSKKHGFHHPFGDHLTLLNIHNRWQENNFSKSFCAENFLHERHLRRAKDVKEQLKRIFKN 973

Query: 3190 HKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEW 3369
              L + SC  +V  ++K + SGFFRNAAKRDPQ GY+T+ D   V IHPSS  F ++ ++
Sbjct: 974  LDLPIRSCHGNVDLIRKTLVSGFFRNAAKRDPQVGYKTIVDETAVSIHPSSCLFGKECDY 1033

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKY-AD 3546
            V+YH LV+T+KEYM +VT ID KWL++       + D  +     R   + PL D   +D
Sbjct: 1034 VIYHSLVLTSKEYMSQVTLIDRKWLMDNDLPLDTLYDHFRRQA--RELHLVPLPDTVRSD 1091

Query: 3547 ANAWRITRVKK 3579
             ++WR++ +++
Sbjct: 1092 QDSWRLSSIRQ 1102


>gi|32398725|emb|CAD98685.1| pre-mRNA splicing factor ATP-dependent
            RNA helicase, probable [Cryptosporidium parvum]
          Length = 1005

 Score =  909 bits (2348), Expect = 0.0
 Identities = 462/841 (54%), Positives = 616/841 (72%), Gaps = 6/841 (0%)
 Frame = +1

Query: 1075 GKARVRISTP-ERWELRQMQGAGVLTATDMP-DFDEEMGVLRNYXXXXXXXXXXXXLVED 1248
            G  + R+S   E+WE+ Q+  +GV++  ++P D  +  G   ++            L
Sbjct: 171  GNKQERVSNDYEKWEIMQLLNSGVISRDEIPYDICDTTGDTIDFQNVEISTEIE--LRNY 228

Query: 1249 EPDFLRGYGKGGAEIEP-VKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQK 1425
            EP FLRG        +  ++VV NP+GSL +AA +   +++ER+E +   ++       +
Sbjct: 229  EPLFLRGQSIKKFNFDSSIQVVVNPEGSLNKAAELASNIARERREIRDFQEKTLIDSIPR 288

Query: 1426 GFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRT-NLSMV 1602
              +      +P +G ++ A SA      N++    PEW K    G   ++G++    S+
Sbjct: 289  DMNRPWEDPNPEAGERTIA-SALRGIGMNSQTT--PEW-KRQYLGKSLSFGKKNVTASIS 344

Query: 1603 EQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKI-GCTQP 1779
            EQR++LPI+ ++ +L++A+ +NQ++VV+GETGSGKTTQ+TQY  E G  + G I GCTQP
Sbjct: 345  EQRKNLPIYPMRDSLVDAIRNNQVIVVIGETGSGKTTQITQYLYEEGFCKDGGIIGCTQP 404

Query: 1780 RRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSG 1959
            RRVAA S+A+RVA+E GC LG+ VG+ IRFED T+ +T IKYMTDGMLLRE L D  LS
Sbjct: 405  RRVAATSIARRVAQEMGCTLGSTVGFAIRFEDITTPETKIKYMTDGMLLREALSDNCLSQ 464

Query: 1960 YSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIP 2139
            YS+IMLDEAHERTI TDVLFGLLK    KRP+ +LI+TSATL++ KFS YF+   IFTIP
Sbjct: 465  YSVIMLDEAHERTITTDVLFGLLKETCIKRPKFRLIVTSATLEADKFSAYFMNCNIFTIP 524

Query: 2140 GRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMK 2319
            GRTFPVEILY++EP  DY+EA  +TV+QIHL EPPGD+LVFLTGQEEID +C+ L+ERMK
Sbjct: 525  GRTFPVEILYSKEPVDDYVEATLVTVLQIHLREPPGDILVFLTGQEEIDNACQTLHERMK 584

Query: 2320 SM-GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDP 2496
             +     P LIILPVY + PSE+Q+ IF+ AP G RK VIATNIAE SLTIDGIF+VVDP
Sbjct: 585  RLENMKPPPLIILPVYSSQPSEIQSLIFEDAPPGCRKCVIATNIAEASLTIDGIFFVVDP 644

Query: 2497 GFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPV 2676
            GF K  ++N K+GMDSL VTPISQA+AKQRSGRAGRTGPGKCYRLYTE AF  EMLPT V
Sbjct: 645  GFSKMMVFNSKTGMDSLTVTPISQASAKQRSGRAGRTGPGKCYRLYTEAAFNTEMLPTTV 704

Query: 2677 PEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLG 2856
            PEIQRTNLA+T+L LKA+G+N+L++FDFMD PP  +++ AL TL  L ALD +G LT+LG
Sbjct: 705  PEIQRTNLANTVLLLKALGVNDLLNFDFMDPPPTTTLLIALETLFELGALDEEGFLTRLG 764

Query: 2857 RRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQ 3036
            R+MAE P+EP LSK+++ SVDLGCS+E++TI +ML+VQN+FYRPK+KQ  AD+KK+KF+
Sbjct: 765  RKMAELPMEPKLSKMVLSSVDLGCSDEIITITSMLSVQNVFYRPKDKQAQADRKKSKFYH 824

Query: 3037 PEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCG 3216
            P+GDHLT L VYNSWK   +S PWC+ENF+Q R++K AQD+RKQL+ I D++KL ++S
Sbjct: 825  PQGDHLTYLNVYNSWKKQRYSVPWCYENFLQSRALKGAQDVRKQLINIFDKYKLDIISAE 884

Query: 3217 RDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMT 3396
             D  +++KAIC+GFF N+ K+D QEGYR L D Q+VY+HPSS  F + PEW++YHELV T
Sbjct: 885  NDHDKIRKAICAGFFSNSCKKDSQEGYRNLVDNQHVYLHPSSTLFNKSPEWILYHELVFT 944

Query: 3397 TKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRITRVK 3576
            +KEY+R+   I P WLV+FAP+ F+  D  +LS  K+ +KI PL++KY D N+WR+++ +
Sbjct: 945  SKEYIRDCCTIKPHWLVDFAPNLFQFADQDQLSKRKKKEKIQPLYNKYEDPNSWRLSKRR 1004

Query: 3577 K 3579
            +
Sbjct: 1005 R 1005


>gi|50289563|ref|XP_447213.1| unnamed protein product [Candida
            glabrata]
 gi|49526522|emb|CAG60146.1| unnamed protein product [Candida glabrata
            CBS138]
          Length = 1135

 Score =  903 bits (2334), Expect = 0.0
 Identities = 480/978 (49%), Positives = 660/978 (67%), Gaps = 17/978 (1%)
 Frame = +1

Query: 697  IGKIYDGRVNSIQSFGAFITLEGFRQK-QEGLVHISQIRNERVQTVADVLKRGENVKVKV 873
            +GKIY G +  I  FG F+ +   +++  EGLVHIS++   +V+  +DV+K+G+ V VK+
Sbjct: 180  LGKIYKGIIKKIMPFGCFVQILHLKKECGEGLVHISELCKNKVRHPSDVVKQGQTVYVKI 239

Query: 874  NKI-ENGKISLSMKEVDQNSGEDLNPRETDLNPDAIGVRPRTPPASTSSWMNPEASGVGQ 1050
            +KI  NGKISLSM  +DQ SG++     TD++ +++ VR R                 G+
Sbjct: 240  SKIMTNGKISLSMINIDQVSGKE--KESTDVDVESLKVRGRP----------------GE 281

Query: 1051 GPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPD---FDEEMGVLR--NYXXXXX 1215
              S  I     + ++++PERWELRQ+  +G+ +  D P+   +D++  V    N
Sbjct: 282  KQSNPI----RKRKLTSPERWELRQLIASGMASIKDYPELLKYDQKEVVDHEGNNDKTED 337

Query: 1216 XXXXXXXLVE--------DEPDFLRGYGKG-GAEIEPVKVVKNPDGSLAQAALMQGALSK 1368
                   + E        D P FLR  GK    + E  K+  NP GSL +A      L
Sbjct: 338  QSDNINEIEEIDIERNPNDRPKFLRKEGKKVSKKYELPKLSNNPMGSLNRAGSQGSKLML 397

Query: 1369 ERKETKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKH 1548
            + +E K+Q ++    D ++      +I DP           D+ + +      +  W K
Sbjct: 398  QHREEKLQKKK----DIEEQIKQKRKIEDPTKDPLQIKKEIDDLRQQLT----VTSWEKK 449

Query: 1549 VTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQY 1728
             +   K +YG+++   +  QR+SLP++++++ LM  + +NQ LV+VGETGSGKTTQ+TQY
Sbjct: 450  KSRE-KVSYGKKSAKPISAQRKSLPVYSMREKLMSEIKNNQFLVIVGETGSGKTTQITQY 508

Query: 1729 AIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYM 1908
              + G  + G IGCTQPRRVAA SVA+RVAEE GCK+G +VGYTIRFE+ TS  T IKYM
Sbjct: 509  LDDEGFSKNGIIGCTQPRRVAAESVARRVAEEVGCKIGREVGYTIRFENVTSDVTRIKYM 568

Query: 1909 TDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLD 2088
            TDGML +E L+DP LS YS+IMLDEAHERTI TDVLF LLK AA KR +LK+I+TSATLD
Sbjct: 569  TDGMLQQEALLDPILSKYSVIMLDEAHERTIATDVLFALLKKAAMKRDDLKVIVTSATLD 628

Query: 2089 SVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLT 2268
            S KF+EYF   PI  IPG+TFPVE+LY++ P  DY+ ++   VM IH +E PGD+LVFLT
Sbjct: 629  SNKFAEYFNNCPIINIPGKTFPVEVLYSKTPTMDYIASSLDCVMDIHTSEGPGDILVFLT 688

Query: 2269 GQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNI 2448
            GQEEIDT CEVL+ER K MG  +  LIILPVY ALPSE+Q++IF+P P G RKV+ ATNI
Sbjct: 689  GQEEIDTCCEVLFERAKEMGDKIDPLIILPVYSALPSEIQSKIFEPTPRGSRKVIFATNI 748

Query: 2449 AETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYR 2628
            AETS+TIDGIFYVVDPGF K   Y+P++GM+ LVV PISQA A QR GRAGRTGPGKCYR
Sbjct: 749  AETSITIDGIFYVVDPGFSKVNTYSPRAGMEQLVVAPISQAQANQRKGRAGRTGPGKCYR 808

Query: 2629 LYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTL 2808
            LYTE ++++EMLP  +PEIQR NL  T+L LKAMGIN+L+ FDFMD PP   M+ AL  L
Sbjct: 809  LYTESSYQNEMLPNAIPEIQRQNLLHTILMLKAMGINDLLHFDFMDPPPKSLMVHALEEL 868

Query: 2809 HTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRP 2988
            + L ALD DG LTKLG+RM+ FP+EP+L++ L+ SV   CS+E++TI+AML+VQN+FYRP
Sbjct: 869  YHLQALDADGHLTKLGQRMSLFPMEPTLARALLSSVSNNCSDEMITIIAMLSVQNVFYRP 928

Query: 2989 KEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQ 3168
            K KQ  AD KKA+FH P GDHLTLL VYN W+  + S+ +C  NF+  R ++RA+D+++Q
Sbjct: 929  KNKQQEADGKKARFHHPYGDHLTLLNVYNRWERSNCSEDFCNTNFLHFRHLRRAKDVKRQ 988

Query: 3169 LLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSAC 3348
            +  I +R  L + SC  +   ++K + SGFF NAAKR+ + GY+T+  G  V IHPSSA
Sbjct: 989  ISMIFERLNLPITSCNENPEIIRKTLVSGFFLNAAKRETKSGYKTINGGTEVGIHPSSAL 1048

Query: 3349 FQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPL 3528
            + ++ E+V+YH L++TT+E+M +++ I+P+WL+E AP F+K+ D    S  ++  KI+PL
Sbjct: 1049 YGREYEYVIYHSLILTTREFMSQISGIEPQWLLEVAPHFYKVADENSQS--RKKTKIEPL 1106

Query: 3529 FDKYA-DANAWRITRVKK 3579
            F++++ D N+WR++  K+
Sbjct: 1107 FNRHSKDQNSWRLSSKKQ 1124


>gi|23508097|ref|NP_700767.1| RNA helicase, putative [Plasmodium
            falciparum 3D7]
 gi|23495160|gb|AAN35491.1| RNA helicase, putative [Plasmodium
            falciparum 3D7]
          Length = 1290

 Score =  900 bits (2326), Expect = 0.0
 Identities = 484/984 (49%), Positives = 660/984 (66%), Gaps = 23/984 (2%)
 Frame = +1

Query: 694  EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQI--RNERVQTVADVLKRGENVKV 867
            ++  I++G +N I  FG F++ +     +EGLVH + I    +RV  + +  KR   VKV
Sbjct: 327  KLNNIFNGTINKITDFGLFVSFKTNEGYKEGLVHATDILPNRKRVVNMNEKFKRNMKVKV 386

Query: 868  KVNKIENGKISLSMKEVDQNSG-----EDLNPRET-------DLNPDAIGVRPRTPPAST 1011
            KV  I N KISL+M EVDQ +G     +D+N  E        D+N D   ++ +
Sbjct: 387  KVKGIFNQKISLNMSEVDQKTGKNLVNDDMNKEEDNYISLFDDINEDFNDLKKKN----- 441

Query: 1012 SSWMNPEASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVL 1191
                   A+     P  ++         S   +WE++Q+  +GV+   ++ +  + + +
Sbjct: 442  -------ANVFKDDPKETLKYESVIKIQSDYSKWEIQQLIKSGVVFDENIRNEYKNLKI- 493

Query: 1192 RNYXXXXXXXXXXXXLVEDEPDFLRGYG-KGGAEIEPVKVVKNPDGSLAQAALMQGALSK 1368
             +             + E EP FL+G   K GA++ P++++ N +GSLA+A     AL+K
Sbjct: 494  -DEKIEDEEDIIEIEVNEKEPAFLKGQTTKAGAKLSPIQIIVNAEGSLAKAITTTSALAK 552

Query: 1369 ERKETKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKH 1548
            ERKE K   Q     +  K  S       P  G ++ A    E+     K  ++PEW K+
Sbjct: 553  ERKEQKQNEQNAIYDNIPKDISRPWEDPKPNLGERTIA----EALKNIGKNYDIPEWKKN 608

Query: 1549 VTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQY 1728
                   + G +  L + EQR  LPI+ LK +LM+A+  N +L+V+GETGSGKTTQ+ QY
Sbjct: 609  YN-NNNISVGVKNTLPINEQRSKLPIYNLKNDLMKAIEKNNVLIVIGETGSGKTTQIPQY 667

Query: 1729 AIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYM 1908
              EA    +G +GCTQPRRVAAMS+AKRV+EE+GC LG +VGY+IRF+DCTS DTIIKY+
Sbjct: 668  LHEANYTEKGIVGCTQPRRVAAMSIAKRVSEEFGCILGQEVGYSIRFDDCTSNDTIIKYL 727

Query: 1909 TDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLD 2088
            TDGMLLRE L D  L+ YS I+LDEAHERTI TD+LF LLK   RKR + KLI+TSATLD
Sbjct: 728  TDGMLLRETLSDTLLTKYSFIILDEAHERTISTDILFCLLKDVVRKRADFKLIVTSATLD 787

Query: 2089 SVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLT 2268
            + KFS YF  +PIFTIPG+ FPVEIL+++EPESDY+EA+ ITV+ IHL E PGD+LVFLT
Sbjct: 788  AEKFSTYFFNSPIFTIPGKIFPVEILHSKEPESDYVEASLITVLNIHLNEHPGDILVFLT 847

Query: 2269 GQEEIDTSCEVLYERMK---SMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIA 2439
            GQ+EI+T+CE+L+ERMK   SM P  P LIILP+Y +LPSEMQ+ IF+PAP G RK ++A
Sbjct: 848  GQDEINTACEILHERMKKLESMSP--PPLIILPIYSSLPSEMQSVIFEPAPPGCRKCILA 905

Query: 2440 TNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGK 2619
            TNIAE SLTIDGIF+V+DPGF K K Y+ K  MDSL+V PIS+A AKQR+GRAGRTGPGK
Sbjct: 906  TNIAEASLTIDGIFFVIDPGFCKIKKYDSKRDMDSLIVAPISKANAKQRAGRAGRTGPGK 965

Query: 2620 CYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITAL 2799
            CYRLYTE A+++EM    VPEIQR NL S +L LKA+GIN+ + FDFMD+P ++++I +L
Sbjct: 966  CYRLYTEEAYKNEMSEMSVPEIQRINLGSIVLLLKALGINDFLHFDFMDSPSVETLIHSL 1025

Query: 2800 NTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIF 2979
              L+ L ALD +G LTKLG++MA FP+EP+LSK+L+ S++  C+++V+TIV+ML+VQNIF
Sbjct: 1026 ENLYYLGALDDNGYLTKLGKKMANFPMEPNLSKILLTSLNFNCTDDVVTIVSMLSVQNIF 1085

Query: 2980 YRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDI 3159
            YRP+ K   AD+KK KF  P+GD +T L +YN WK + FS  WC ENFIQ R++KRAQD+
Sbjct: 1086 YRPQNKALLADKKKNKFIMPQGDLITYLNIYNKWKENSFSNYWCHENFIQSRALKRAQDV 1145

Query: 3160 RKQLLGIMDR--HKLLMVSCGRDVSR---VQKAICSGFFRNAAKRDPQEGYRTLTDGQNV 3324
            RKQ+L I ++  +++   +   D ++   + K+ICSG+F +  KRD Q+GY TL   Q V
Sbjct: 1146 RKQMLSIFEKYNYQVKKSTSKNDATKYVNICKSICSGYFNHVCKRDTQQGYTTLLTNQQV 1205

Query: 3325 YIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFK 3504
            +IHPSS  F + P +VVYHELV+T KEY+R+ T I P+WL++ AP+ F   D  K+S  K
Sbjct: 1206 FIHPSSTLFNKNPLFVVYHELVLTNKEYIRDCTIIQPQWLIQLAPNLFIPADEKKISKIK 1265

Query: 3505 RNQKIDPLFDKYADANAWRITRVK 3576
              +KI+PL + Y + NAWR++R K
Sbjct: 1266 LREKIEPLHNYYEEPNAWRLSRRK 1289


>gi|41053341|ref|NP_956318.1| DEAH (Asp-Glu-Ala-His) box polypeptide
            16; wu:fa91b12 [Danio rerio]
 gi|28278884|gb|AAH45393.1| DEAH (Asp-Glu-Ala-His) box polypeptide 16
            [Danio rerio]
          Length = 1054

 Score =  765 bits (1976), Expect = 0.0
 Identities = 379/643 (58%), Positives = 492/643 (75%), Gaps = 2/643 (0%)
 Frame = +1

Query: 1594 SMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGC 1770
            S+ E R SLPIF  +++L+ A+ D+QILV+ GETGSGKTTQ+ QY +E G  + G KIGC
Sbjct: 404  SIQEVRRSLPIFPYREDLLAAIGDHQILVIEGETGSGKTTQIPQYLLEEGYTKGGMKIGC 463

Query: 1771 TQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPD 1950
            TQPRRVAAMSVA RVA+E   KLG +VGY+IRFEDCTS+ TI+KYMTDGMLLRE L +PD
Sbjct: 464  TQPRRVAAMSVAARVAQEMSVKLGNEVGYSIRFEDCTSERTILKYMTDGMLLREFLTEPD 523

Query: 1951 LSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIF 2130
            L+ YS+I++DEAHERT+HTD+LFGL+K  AR RP+LK+++ SATLD+ +FS +F +AP+F
Sbjct: 524  LASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVF 583

Query: 2131 TIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYE 2310
             IPGR FPV+I YT+ PE+DYLEA  ++V+QIH+T+ PGDVLVFLTGQEEI+  CE+L E
Sbjct: 584  RIPGRRFPVDIYYTKAPEADYLEACVVSVLQIHVTQSPGDVLVFLTGQEEIEACCELLQE 643

Query: 2311 RMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVV 2490
            R + +G  + EL++LP+Y  LPS+MQ +IF+P P G RKVV+ATNIAETSLTIDGI YV+
Sbjct: 644  RCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVI 703

Query: 2491 DPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPT 2670
            DPGF KQK YN K+GM+SL+VTP S+A+A QR+GRAGR   GKC+RLYT  AF+ EM  T
Sbjct: 704  DPGFCKQKSYNAKTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEET 763

Query: 2671 PVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTK 2850
             VPEIQRTNL + +L LK++GIN+LI FDFMD PP ++++ AL  L+ L AL+  G LTK
Sbjct: 764  TVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTK 823

Query: 2851 LGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAK 3027
            LGRRMAE P++P LSK+++ S    CSEEVLTI AML+V N IFYRPK+K  HAD  +
Sbjct: 824  LGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMN 883

Query: 3028 FHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMV 3207
            F  P GDHL LL VY  W    +S  WCFENFIQ RSMKRA+D+R QL G+MDR ++ +
Sbjct: 884  FVVPGGDHLVLLNVYTQWVESGYSTQWCFENFIQFRSMKRARDVRDQLEGLMDRIEVELC 943

Query: 3208 SCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHEL 3387
            S   D   ++KA+ +G+F + A R  + GY+T+   Q VY+HP+S+ F++QP W++YHEL
Sbjct: 944  SSNGDSMPIRKAVTAGYFYHTA-RLSKGGYKTVKHQQTVYVHPNSSLFEEQPRWMIYHEL 1002

Query: 3388 VMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQK 3516
            V TTKE+MR+V  I+  WL+E AP ++K  +    S+ K  +K
Sbjct: 1003 VFTTKEFMRQVIEIESGWLLEVAPHYYKNKELEDSSSKKMPRK 1045


>gi|30794426|ref|NP_081263.1| DEAH (Asp-Glu-Ala-His) box polypeptide
            16; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 16 [Mus
            musculus]
 gi|14318701|gb|AAH09147.1| DEAH (Asp-Glu-Ala-His) box polypeptide 16
            [Mus musculus]
          Length = 1044

 Score =  756 bits (1953), Expect = 0.0
 Identities = 359/623 (57%), Positives = 484/623 (77%), Gaps = 2/623 (0%)
 Frame = +1

Query: 1609 RESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGCTQPRR 1785
            R SLP+F  ++ L+ A+ ++Q+L++ GETGSGKTTQ+ QY  E G  ++G KI CTQPRR
Sbjct: 399  RRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTKKGMKIACTQPRR 458

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVA RVA E G KLG +VGY+IRFEDCTS+ T+++YMTDGMLLRE L +PDL+ YS
Sbjct: 459  VAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYS 518

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
            ++M+DEAHERT+HTD+LFGL+K  AR RPELK+++ SATLD+ +FS +F +AP+F IPGR
Sbjct: 519  VVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATLDTARFSAFFDDAPVFRIPGR 578

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
             FPV+I YT+ PE+DYLEA  ++V+QIH+T+PPGD+LVFLTGQEEI+ +CE+L +R + +
Sbjct: 579  RFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRL 638

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
            G  + EL++LP+Y  LPS+MQ RIF P P G RKVV+ATNIAETSLTI+GI YV+DPGF
Sbjct: 639  GSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFC 698

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            KQK YNP++GM+SL VTP S+A+A QR+GRAGR   GKC+RLYT  A++ E+  T VPEI
Sbjct: 699  KQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEI 758

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRT+L + +L LK++GI++L+ FDF+D PP ++++ AL  L+ L AL+  G LT  GR+M
Sbjct: 759  QRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKM 818

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPE 3042
            AE P++P LSK+++ S    CSEE+LT+ AML+V N IFYRPK+K  HAD  +  F  P
Sbjct: 819  AELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPG 878

Query: 3043 GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRD 3222
            GDHL LL VY  W    +S  WC+ENF+Q RSM+RA+D+R+QL G+++R ++ + SC  D
Sbjct: 879  GDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLTSCQGD 938

Query: 3223 VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTK 3402
              RV+KAI SG+F + A R  + GYRT+   Q V+IHP+S+ F+QQP W++YHELV+TTK
Sbjct: 939  YVRVRKAITSGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTK 997

Query: 3403 EYMREVTAIDPKWLVEFAPSFFK 3471
            E+MR+V  I+  WL+E AP ++K
Sbjct: 998  EFMRQVLEIESSWLLEVAPHYYK 1020


>gi|22329903|ref|NP_174527.2| RNA helicase, putative [Arabidopsis
            thaliana]
 gi|18377729|gb|AAL67014.1| putative RNA helicase [Arabidopsis
            thaliana]
 gi|22136924|gb|AAM91806.1| putative RNA helicase [Arabidopsis
            thaliana]
          Length = 1044

 Score =  756 bits (1953), Expect = 0.0
 Identities = 366/628 (58%), Positives = 491/628 (77%), Gaps = 2/628 (0%)
 Frame = +1

Query: 1603 EQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPR 1782
            E R SLPI+  +  L++A+ ++Q+LV+VG+TGSGKTTQ+ QY  EAG  +RGK+GCTQPR
Sbjct: 399  EVRRSLPIYTYRDQLLKAVEEHQVLVIVGDTGSGKTTQIPQYLHEAGYTKRGKVGCTQPR 458

Query: 1783 RVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGY 1962
            RVAAMSVA RVA+E G KLG +VGY+IRFEDCTS  T++KYMTDGMLLRE L +PDL+ Y
Sbjct: 459  RVAAMSVAARVAQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLRELLGEPDLASY 518

Query: 1963 SLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPG 2142
            S++++DEAHERT+ TD+LFGL+K  AR RP+LKL+I+SAT+D+ KFS+YF  APIF+ PG
Sbjct: 519  SVVIVDEAHERTLSTDILFGLVKDIARFRPDLKLLISSATMDAEKFSDYFDTAPIFSFPG 578

Query: 2143 RTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKS 2322
            R +PVEI YT  PE+DY++AA +T++ IH+ EP GD+LVF TGQEEI+T+ E+L  R++
Sbjct: 579  RRYPVEINYTSAPEADYMDAAIVTILTIHVREPLGDILVFFTGQEEIETAEEILKHRIRG 638

Query: 2323 MGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGF 2502
            +G  + ELII P+Y  LPSE+Q +IF+P P G RKVV+ATNIAETSLTIDGI YVVDPGF
Sbjct: 639  LGTKIRELIICPIYANLPSELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVVDPGF 698

Query: 2503 VKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPE 2682
             K K YNP++GM+SL++TPIS+A+A QR+GRAGRT PGKCYRLYT   + +++    VPE
Sbjct: 699  SKMKSYNPRTGMESLLITPISKASATQRAGRAGRTSPGKCYRLYTAFNYNNDLEENTVPE 758

Query: 2683 IQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRR 2862
            +QRTNLAS +L LK++GI++LI+FDFMD PP ++++ +L  L  L AL+  G LTK GRR
Sbjct: 759  VQRTNLASVVLALKSLGIHDLINFDFMDPPPAEALVKSLELLFALGALNKLGELTKAGRR 818

Query: 2863 MAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNV-QNIFYRPKEKQDHADQKKAKFHQP 3039
            MAEFPL+P LSK++++S    CS+E+++I AML++  +IFYRPK+KQ HAD  +  FH
Sbjct: 819  MAEFPLDPMLSKMIVVSDKYKCSDEIISIAAMLSIGGSIFYRPKDKQVHADNARMNFHTG 878

Query: 3040 E-GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCG 3216
              GDH+ LL VY+SWK  +FS  WC+EN+IQVRSMKRA+DIR QL G+++R ++ + S
Sbjct: 879  NVGDHIALLKVYSSWKETNFSTQWCYENYIQVRSMKRARDIRDQLEGLLERVEIDISSNL 938

Query: 3217 RDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMT 3396
             ++  V+K+I +GFF + AK      YRT+   Q V+IHP+S   Q  P WVVYHELV+T
Sbjct: 939  NELDSVRKSIVAGFFPHTAKLQKNGSYRTVKHPQTVHIHPNSGLSQVLPRWVVYHELVLT 998

Query: 3397 TKEYMREVTAIDPKWLVEFAPSFFKIGD 3480
            +KEYMR+VT + P+WL+E AP ++++ D
Sbjct: 999  SKEYMRQVTELKPEWLIELAPHYYQLKD 1026


>gi|47059171|ref|NP_997661.1| DEAH (Asp-Glu-Ala-His) box polypeptide
            16 [Rattus norvegicus]
 gi|46237659|emb|CAE84034.1| DEAD/H (Asp-Glu-Ala-Asp/His) box
            polypeptide 16 [Rattus norvegicus]
          Length = 1044

 Score =  756 bits (1953), Expect = 0.0
 Identities = 359/623 (57%), Positives = 484/623 (77%), Gaps = 2/623 (0%)
 Frame = +1

Query: 1609 RESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGCTQPRR 1785
            R SLP+F  ++ L+ A+ ++Q+L++ GETGSGKTTQ+ QY  E G  ++G KI CTQPRR
Sbjct: 399  RRSLPVFPFREELLTAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTKKGMKIACTQPRR 458

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVA RVA E G KLG +VGY+IRFEDCTS+ T+++YMTDGMLLRE L +PDL+ YS
Sbjct: 459  VAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYS 518

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
            ++M+DEAHERT+HTD+LFGL+K  AR RPELK+++ SATLD+ +FS +F +AP+F IPGR
Sbjct: 519  VVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATLDTARFSAFFDDAPVFRIPGR 578

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
             FPV+I YT+ PE+DYLEA  ++V+QIH+T+PPGD+LVFLTGQEEI+ +CE+L +R + +
Sbjct: 579  RFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRL 638

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
            G  + EL++LP+Y  LPS+MQ RIF P P G RKVV+ATNIAETSLTI+GI YV+DPGF
Sbjct: 639  GSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFC 698

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            KQK YNP++GM+SL VTP S+A+A QR+GRAGR   GKC+RLYT  A++ E+  T VPEI
Sbjct: 699  KQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEI 758

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRT+L + +L LK++GI++L+ FDF+D PP ++++ AL  L+ L AL+  G LT  GR+M
Sbjct: 759  QRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKM 818

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPE 3042
            AE P++P LSK+++ S    CSEE+LT+ AML+V N IFYRPK+K  HAD  +  F  P
Sbjct: 819  AELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPG 878

Query: 3043 GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRD 3222
            GDHL LL VY  W    +S  WC+ENF+Q RSM+RA+D+R+QL G+++R ++ + SC  D
Sbjct: 879  GDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLTSCQGD 938

Query: 3223 VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTK 3402
              RV+KAI SG+F + A R  + GYRT+   Q V+IHP+S+ F+QQP W++YHELV+TTK
Sbjct: 939  YVRVRKAITSGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTK 997

Query: 3403 EYMREVTAIDPKWLVEFAPSFFK 3471
            E+MR+V  I+  WL+E AP ++K
Sbjct: 998  EFMRQVLEIESSWLLEVAPHYYK 1020


>gi|12044832|gb|AAG33228.2| DEAH-box RNA helicase [Chlamydomonas
            reinhardtii]
          Length = 1432

 Score =  754 bits (1948), Expect = 0.0
 Identities = 397/821 (48%), Positives = 545/821 (66%), Gaps = 17/821 (2%)
 Frame = +1

Query: 1111 WELRQMQGAGVLTATDMP-DFDEEMGVLRNYXXXXXXXXXXXXLVED-EPDFLRGYGKGG 1284
            WE  ++  +GV+   ++  DF++E                   LV D +P FL G
Sbjct: 564  WEENRLLTSGVVRLKEVSLDFNDE------------DEARVLLLVHDTKPPFLEGKVVNN 611

Query: 1285 AEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDPMS 1464
             + + V  +K+P   +A  A     L KE +E K +  + R    +   S  A I
Sbjct: 612  KQADIVLPLKDPTSDMAVIARKGSGLVKEVREKK-EKNKSRQRFWEVAGSKMAEITGLTD 670

Query: 1465 GNQSTAWSAD---------ESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRES 1617
                 A  A+         + +D     K+  ++  H+    +A      N ++ +QR S
Sbjct: 671  AEAQAAAEAEAARKAEDGGDGEDGEGSYKQANQFKNHMKKN-EANSDFSRNKTLEQQRRS 729

Query: 1618 LPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAM 1797
            LP++ ++  L++ + +NQ++VVVGETGSGKTTQMTQY  E G  + G IGCTQPRRVAAM
Sbjct: 730  LPVYGVRDELLQVIRENQVVVVVGETGSGKTTQMTQYLHEDGYTKYGTIGCTQPRRVAAM 789

Query: 1798 SVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIML 1977
            SVAKRV+EE G +LG  VGY+IRFEDCTS  TIIKYMTDG+LLRE LI+ D+  YS++++
Sbjct: 790  SVAKRVSEEMGVELGDQVGYSIRFEDCTSDKTIIKYMTDGVLLRETLINEDVDNYSVVVM 849

Query: 1978 DEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPV 2157
            DEAHER+++TDVLFG+LK    +R + KLI+TSATLD+ KFS++F   PIF IPGRTFPV
Sbjct: 850  DEAHERSLNTDVLFGILKRVVARRRDFKLIVTSATLDAQKFSDFFGSVPIFIIPGRTFPV 909

Query: 2158 EILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYER---MKSMG 2328
            ++L++R  + DY+EAA    + IHL +PPGD+L+F+TGQEEI+ +C  L ER   M+S G
Sbjct: 910  DVLWSRTVQEDYVEAAVKQAVTIHLRDPPGDILIFMTGQEEIEATCFSLAERLEHMRSGG 969

Query: 2329 PDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVK 2508
             ++PEL+ILP+Y  LPS++Q +IFD A  G RKV+++TNIAETSLT+DGI YV+D G+VK
Sbjct: 970  SEIPELLILPIYSQLPSDLQAKIFDKAEEGVRKVIVSTNIAETSLTVDGILYVIDTGYVK 1029

Query: 2509 QKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQ 2688
             K+YNPK GMD+L V PISQAAA QRSGRAGRTGPG CYRLYTE AFR EML   VPEIQ
Sbjct: 1030 MKVYNPKMGMDALQVFPISQAAAGQRSGRAGRTGPGTCYRLYTESAFRHEMLTMNVPEIQ 1089

Query: 2689 RTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMA 2868
            RTNLA+ +L LK++ +N+L++F FMD PP D+++ ++  L TL ALD  G LT LGR+M
Sbjct: 1090 RTNLANVVLLLKSLKVNDLLEFGFMDPPPRDNIVNSMYNLWTLGALDNTGGLTHLGRQMV 1149

Query: 2869 EFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGD 3048
            EFPL+P L+K+L+M   LGCS EVLT+V+ML+V  +F+RP ++ + +D  + KF  PE D
Sbjct: 1150 EFPLDPPLAKMLLMGAQLGCSNEVLTVVSMLSVPPVFFRPPDRAEESDAAREKFFVPESD 1209

Query: 3049 HLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVS 3228
            HLTLL VYN WKN+ +   WC  +++Q + +++A+++R+QL  IM +  L + S G D
Sbjct: 1210 HLTLLHVYNQWKNNGYRGDWCDRHYLQSKGLRKAKEVRQQLADIMQQCGLQLTSAGSDWD 1269

Query: 3229 RVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTK 3402
             V+KAICS +F+NAAK      Y     G   ++HPSSA +     P+++VYHELV TTK
Sbjct: 1270 IVRKAICSAYFQNAAKFKSVGEYVNARTGMPCHLHPSSALYGLGFTPDYIVYHELVFTTK 1329

Query: 3403 EYMREVTAIDPKWLVEFAPSFFKIGD-STKLSTFKRNQKID 3522
            EYM+ VTA++P+WL E  P FF + +    L   KR Q+ D
Sbjct: 1330 EYMQCVTAVEPEWLAELGPMFFSVKEVGGSLLESKRKQRAD 1370


>gi|41529171|dbj|BAD08431.1| DEAD/H (Asp-Glu-Ala-Asp/His) box
            polypeptide 16 [Sus scrofa]
 gi|41529184|dbj|BAD08443.1| DEAD/H (Asp-Glu-Ala-Asp/His) box
            polypeptide 16 [Sus scrofa]
          Length = 1045

 Score =  753 bits (1945), Expect = 0.0
 Identities = 358/623 (57%), Positives = 484/623 (77%), Gaps = 2/623 (0%)
 Frame = +1

Query: 1609 RESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGCTQPRR 1785
            R SLP+F  ++ L+ A+ ++QIL++ GETGSGKTTQ+ QY  E G  ++G KI CTQPRR
Sbjct: 400  RRSLPVFPFREELLAAVANHQILIIEGETGSGKTTQIPQYLFEEGYTQKGMKIACTQPRR 459

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVA RVA E G KLG +VGY+IRFEDCTS+ T+++YMTDGMLLRE L +PDL+ YS
Sbjct: 460  VAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYS 519

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
            ++M+DEAHERT+HTD+LFGL+K  AR RPELK+++ SATLD+ +FS +F +AP+F IPGR
Sbjct: 520  VVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATLDTARFSTFFDDAPVFRIPGR 579

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
             FPV+I YT+ PE+DYLEA  ++V+QIH+T+PPGD+LVFLTGQEEI+ +CE+L +R + +
Sbjct: 580  RFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRL 639

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
            G  + EL++LP+Y  LPS+MQ RIF P P G RKVV+ATNIAETSLTI+GI YV+DPGF
Sbjct: 640  GSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFC 699

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            KQK YNP++GM+SL VTP S+A+A QR+GRAGR   GKC+RLYT  A++ E+  T VPEI
Sbjct: 700  KQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEI 759

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRT+L + +L LK++GI++L+ FDF+D PP ++++ AL  L+ L AL+  G LT  GR+M
Sbjct: 760  QRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKM 819

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPE 3042
            AE P++P LSK+++ S    CSEE+LT+ AML+V N IFYRPK+K  HAD  +  F  P
Sbjct: 820  AELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPG 879

Query: 3043 GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRD 3222
            GDHL LL VY  W    +S  WC+ENF+Q RSM+RA+D+R+QL G+++R ++ + SC  D
Sbjct: 880  GDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGD 939

Query: 3223 VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTK 3402
              RV+KAI +G+F + A R  + GYRT+   Q V+IHP+S+ F++QP W++YHELV+TTK
Sbjct: 940  YIRVRKAITAGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEEQPRWLLYHELVLTTK 998

Query: 3403 EYMREVTAIDPKWLVEFAPSFFK 3471
            E+MR+V  I+  WL+E AP ++K
Sbjct: 999  EFMRQVLEIESSWLLEVAPHYYK 1021


>gi|26006959|sp|O60231|DD16_HUMAN Putative pre-mRNA splicing factor
            RNA helicase (ATP-dependent RNA helicase #3) (DEAH-box
            protein 16)
 gi|15277230|dbj|BAB63323.1| RNA helicase [Homo sapiens]
 gi|27544392|dbj|BAC54930.1| DEAD/H (Asp-Glu-Ala-Asp/His) box
            polypeptide 16 [Homo sapiens]
          Length = 1041

 Score =  753 bits (1944), Expect = 0.0
 Identities = 357/623 (57%), Positives = 483/623 (77%), Gaps = 2/623 (0%)
 Frame = +1

Query: 1609 RESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGCTQPRR 1785
            R SLP+F  ++ L+ A+ ++Q+L++ GETGSGKTTQ+ QY  E G   +G KI CTQPRR
Sbjct: 396  RRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRR 455

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVA RVA E G KLG +VGY+IRFEDCTS+ T+++YMTDGMLLRE L +PDL+ YS
Sbjct: 456  VAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYS 515

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
            ++M+DEAHERT+HTD+LFGL+K  AR RPELK+++ SAT+D+ +FS +F +AP+F IPGR
Sbjct: 516  VVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGR 575

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
             FPV+I YT+ PE+DYLEA  ++V+QIH+T+PPGD+LVFLTGQEEI+ +CE+L +R + +
Sbjct: 576  RFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRL 635

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
            G  + EL++LP+Y  LPS+MQ RIF P P G RKVV+ATNIAETSLTI+GI YV+DPGF
Sbjct: 636  GSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFC 695

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            KQK YNP++GM+SL VTP S+A+A QR+GRAGR   GKC+RLYT  A++ E+  T VPEI
Sbjct: 696  KQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEI 755

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRT+L + +L LK++GI++L+ FDF+D PP ++++ AL  L+ L AL+  G LT  GR+M
Sbjct: 756  QRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKM 815

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPE 3042
            AE P++P LSK+++ S    CSEE+LT+ AML+V N IFYRPK+K  HAD  +  F  P
Sbjct: 816  AELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPG 875

Query: 3043 GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRD 3222
            GDHL LL VY  W    +S  WC+ENF+Q RSM+RA+D+R+QL G+++R ++ + SC  D
Sbjct: 876  GDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGD 935

Query: 3223 VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTK 3402
              RV+KAI +G+F + A R  + GYRT+   Q V+IHP+S+ F+QQP W++YHELV+TTK
Sbjct: 936  YIRVRKAITAGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTK 994

Query: 3403 EYMREVTAIDPKWLVEFAPSFFK 3471
            E+MR+V  I+  WL+E AP ++K
Sbjct: 995  EFMRQVLEIESSWLLEVAPHYYK 1017


>gi|14250712|gb|AAH08825.1| DEAH (Asp-Glu-Ala-His) box polypeptide 16
            [Homo sapiens]
 gi|14424761|gb|AAH09392.1| DEAH (Asp-Glu-Ala-His) box polypeptide 16
            [Homo sapiens]
          Length = 1042

 Score =  753 bits (1944), Expect = 0.0
 Identities = 357/623 (57%), Positives = 483/623 (77%), Gaps = 2/623 (0%)
 Frame = +1

Query: 1609 RESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGCTQPRR 1785
            R SLP+F  ++ L+ A+ ++Q+L++ GETGSGKTTQ+ QY  E G   +G KI CTQPRR
Sbjct: 396  RRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRR 455

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVA RVA E G KLG +VGY+IRFEDCTS+ T+++YMTDGMLLRE L +PDL+ YS
Sbjct: 456  VAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYS 515

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
            ++M+DEAHERT+HTD+LFGL+K  AR RPELK+++ SAT+D+ +FS +F +AP+F IPGR
Sbjct: 516  VVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGR 575

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
             FPV+I YT+ PE+DYLEA  ++V+QIH+T+PPGD+LVFLTGQEEI+ +CE+L +R + +
Sbjct: 576  RFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRL 635

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
            G  + EL++LP+Y  LPS+MQ RIF P P G RKVV+ATNIAETSLTI+GI YV+DPGF
Sbjct: 636  GSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFC 695

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            KQK YNP++GM+SL VTP S+A+A QR+GRAGR   GKC+RLYT  A++ E+  T VPEI
Sbjct: 696  KQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEI 755

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRT+L + +L LK++GI++L+ FDF+D PP ++++ AL  L+ L AL+  G LT  GR+M
Sbjct: 756  QRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKM 815

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPE 3042
            AE P++P LSK+++ S    CSEE+LT+ AML+V N IFYRPK+K  HAD  +  F  P
Sbjct: 816  AELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPG 875

Query: 3043 GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRD 3222
            GDHL LL VY  W    +S  WC+ENF+Q RSM+RA+D+R+QL G+++R ++ + SC  D
Sbjct: 876  GDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGD 935

Query: 3223 VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTK 3402
              RV+KAI +G+F + A R  + GYRT+   Q V+IHP+S+ F+QQP W++YHELV+TTK
Sbjct: 936  YIRVRKAITAGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTK 994

Query: 3403 EYMREVTAIDPKWLVEFAPSFFK 3471
            E+MR+V  I+  WL+E AP ++K
Sbjct: 995  EFMRQVLEIESSWLLEVAPHYYK 1017


>gi|38502930|sp|Q7YR39|DD16_PANTR Putative pre-mRNA splicing factor
            RNA helicase (ATP-dependent RNA helicase #3) (DEAH-box
            protein 16)
 gi|32127787|dbj|BAC78177.1| RNA helicase [Pan troglodytes]
          Length = 1044

 Score =  753 bits (1944), Expect = 0.0
 Identities = 357/623 (57%), Positives = 483/623 (77%), Gaps = 2/623 (0%)
 Frame = +1

Query: 1609 RESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGCTQPRR 1785
            R SLP+F  ++ L+ A+ ++Q+L++ GETGSGKTTQ+ QY  E G   +G KI CTQPRR
Sbjct: 399  RRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRR 458

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVA RVA E G KLG +VGY+IRFEDCTS+ T+++YMTDGMLLRE L +PDL+ YS
Sbjct: 459  VAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYS 518

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
            ++M+DEAHERT+HTD+LFGL+K  AR RPELK+++ SAT+D+ +FS +F +AP+F IPGR
Sbjct: 519  VVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGR 578

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
             FPV+I YT+ PE+DYLEA  ++V+QIH+T+PPGD+LVFLTGQEEI+ +CE+L +R + +
Sbjct: 579  RFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRL 638

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
            G  + EL++LP+Y  LPS+MQ RIF P P G RKVV+ATNIAETSLTI+GI YV+DPGF
Sbjct: 639  GSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFC 698

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            KQK YNP++GM+SL VTP S+A+A QR+GRAGR   GKC+RLYT  A++ E+  T VPEI
Sbjct: 699  KQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEI 758

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRT+L + +L LK++GI++L+ FDF+D PP ++++ AL  L+ L AL+  G LT  GR+M
Sbjct: 759  QRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKM 818

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPE 3042
            AE P++P LSK+++ S    CSEE+LT+ AML+V N IFYRPK+K  HAD  +  F  P
Sbjct: 819  AELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPG 878

Query: 3043 GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRD 3222
            GDHL LL VY  W    +S  WC+ENF+Q RSM+RA+D+R+QL G+++R ++ + SC  D
Sbjct: 879  GDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGD 938

Query: 3223 VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTK 3402
              RV+KAI +G+F + A R  + GYRT+   Q V+IHP+S+ F+QQP W++YHELV+TTK
Sbjct: 939  YIRVRKAITAGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTK 997

Query: 3403 EYMREVTAIDPKWLVEFAPSFFK 3471
            E+MR+V  I+  WL+E AP ++K
Sbjct: 998  EFMRQVLEIESSWLLEVAPHYYK 1020


>gi|40788293|dbj|BAA25503.2| KIAA0577 protein [Homo sapiens]
          Length = 1043

 Score =  753 bits (1944), Expect = 0.0
 Identities = 357/623 (57%), Positives = 483/623 (77%), Gaps = 2/623 (0%)
 Frame = +1

Query: 1609 RESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGCTQPRR 1785
            R SLP+F  ++ L+ A+ ++Q+L++ GETGSGKTTQ+ QY  E G   +G KI CTQPRR
Sbjct: 398  RRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRR 457

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVA RVA E G KLG +VGY+IRFEDCTS+ T+++YMTDGMLLRE L +PDL+ YS
Sbjct: 458  VAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYS 517

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
            ++M+DEAHERT+HTD+LFGL+K  AR RPELK+++ SAT+D+ +FS +F +AP+F IPGR
Sbjct: 518  VVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGR 577

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
             FPV+I YT+ PE+DYLEA  ++V+QIH+T+PPGD+LVFLTGQEEI+ +CE+L +R + +
Sbjct: 578  RFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRL 637

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
            G  + EL++LP+Y  LPS+MQ RIF P P G RKVV+ATNIAETSLTI+GI YV+DPGF
Sbjct: 638  GSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFC 697

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            KQK YNP++GM+SL VTP S+A+A QR+GRAGR   GKC+RLYT  A++ E+  T VPEI
Sbjct: 698  KQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEI 757

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRT+L + +L LK++GI++L+ FDF+D PP ++++ AL  L+ L AL+  G LT  GR+M
Sbjct: 758  QRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKM 817

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPE 3042
            AE P++P LSK+++ S    CSEE+LT+ AML+V N IFYRPK+K  HAD  +  F  P
Sbjct: 818  AELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPG 877

Query: 3043 GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRD 3222
            GDHL LL VY  W    +S  WC+ENF+Q RSM+RA+D+R+QL G+++R ++ + SC  D
Sbjct: 878  GDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGD 937

Query: 3223 VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTK 3402
              RV+KAI +G+F + A R  + GYRT+   Q V+IHP+S+ F+QQP W++YHELV+TTK
Sbjct: 938  YIRVRKAITAGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTK 996

Query: 3403 EYMREVTAIDPKWLVEFAPSFFK 3471
            E+MR+V  I+  WL+E AP ++K
Sbjct: 997  EFMRQVLEIESSWLLEVAPHYYK 1019


>gi|19921526|ref|NP_609946.1| CG10689-PA [Drosophila melanogaster]
 gi|7298547|gb|AAF53766.1| CG10689-PA [Drosophila melanogaster]
 gi|16769318|gb|AAL28878.1| LD25692p [Drosophila melanogaster]
          Length = 894

 Score =  750 bits (1936), Expect = 0.0
 Identities = 367/644 (56%), Positives = 491/644 (75%), Gaps = 5/644 (0%)
 Frame = +1

Query: 1570 TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLG 1749
            T   R  L++ E R SLP++  K++L+ A+ ++Q+L++ GETGSGKTTQ+ QY +EAG
Sbjct: 236  TEKERKRLTLDETRRSLPVYPFKEDLIAAVKEHQVLIIEGETGSGKTTQVPQYLVEAGFT 295

Query: 1750 RRGK-IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLL 1926
            +  K IGCTQPRRVAAMSVA RVAEE G KLG +VGY+IRFEDCTS  TI+KYMTDG L
Sbjct: 296  KDKKMIGCTQPRRVAAMSVAARVAEEMGVKLGNEVGYSIRFEDCTSDRTILKYMTDGTLH 355

Query: 1927 RECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSE 2106
            RE L +PDL+ YS++++DEAHERT+HTD+LFGL+K  AR RPELKL+I+SATLD+ KFS
Sbjct: 356  REFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIARFRPELKLLISSATLDAEKFSA 415

Query: 2107 YFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEID 2286
            +F +APIF IPGR +PV+I YT+ PE+DY++A  ++V+QIH T+P GD+LVFLTGQ+EI+
Sbjct: 416  FFDDAPIFRIPGRRYPVDIFYTKAPEADYIDACCVSVLQIHATQPLGDILVFLTGQDEIE 475

Query: 2287 TSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLT 2466
            T  EVL++R+K +G  + ELI++PVY  LPS+MQ +IF+P P   RKV++ATNIAETSLT
Sbjct: 476  TCQEVLHDRVKRLGSKIRELIVIPVYANLPSDMQAKIFEPTPPNARKVILATNIAETSLT 535

Query: 2467 IDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERA 2646
            ID I YV+DPGF KQ  +N ++GM+SL+V PIS+A+A QR+GRAGRT PGKC+RLYT  A
Sbjct: 536  IDNIIYVIDPGFAKQNNFNSRTGMESLMVVPISKASANQRAGRAGRTAPGKCFRLYTAWA 595

Query: 2647 FRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSAL 2826
            ++ E+    VPEIQR NL + +L LKA+GIN+LI FDF+D PP ++++ AL  L+ L AL
Sbjct: 596  YKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGAL 655

Query: 2827 DGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQD 3003
            +  G LTKLGRRMAEFP++P + K+L+ S    CSEE++TI AML+V + IFYRPK+K
Sbjct: 656  NHHGELTKLGRRMAEFPVDPMMGKMLLASEKYKCSEEMVTIAAMLSVNSAIFYRPKDKII 715

Query: 3004 HADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIM 3183
            HAD  +  F+   GDHL+LL VYN W    +S  WC+ENFIQ RSMKRA+D+R+QL+G+M
Sbjct: 716  HADTARKNFNHMHGDHLSLLQVYNQWAETDYSTQWCYENFIQYRSMKRARDVREQLVGLM 775

Query: 3184 DRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQP 3363
             R ++ MVSC  +   V+KA  +G+F + A+      Y+T+   Q V IHP+S+ F++ P
Sbjct: 776  QRVEIDMVSCLPETVNVRKAATAGYFYHVARLSKGGHYKTIKHNQTVMIHPNSSLFEELP 835

Query: 3364 EWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFK---IGDST 3486
             WV+YHELV T+KEYMR+V  I+ KWL+E AP ++K   + DST
Sbjct: 836  RWVLYHELVFTSKEYMRQVIEIESKWLLEVAPHYYKAKELEDST 879


>gi|25513513|pir||C86450 F5D14.27 protein - Arabidopsis thaliana
 gi|8920625|gb|AAF81347.1| Strong similarity to an unknown pre-mRNA
            splicing factor RNA helicase At2g35340 gi|3608155 from
            Arabidopsis thaliana BAC T32F12 gb|AC005314.  ESTs
            gb|AV566249 and gb|AI998735 come from this gene
          Length = 1090

 Score =  750 bits (1936), Expect = 0.0
 Identities = 369/650 (56%), Positives = 495/650 (75%), Gaps = 18/650 (2%)
 Frame = +1

Query: 1603 EQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPR 1782
            E R SLPI+  +  L++A+ ++Q+LV+VG+TGSGKTTQ+ QY  EAG  +RGK+GCTQPR
Sbjct: 415  EVRRSLPIYTYRDQLLKAVEEHQVLVIVGDTGSGKTTQIPQYLHEAGYTKRGKVGCTQPR 474

Query: 1783 RVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGY 1962
            RVAAMSVA RVA+E G KLG +VGY+IRFEDCTS  T++KYMTDGMLLRE L +PDL+ Y
Sbjct: 475  RVAAMSVAARVAQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLRELLGEPDLASY 534

Query: 1963 SLIMLDEAHERTIHTDVLFGLLKAA----------------ARKRPELKLIITSATLDSV 2094
            S++++DEAHERT+ TD+LFGL+KA+                AR RP+LKL+I+SAT+D+
Sbjct: 535  SVVIVDEAHERTLSTDILFGLVKASRFSCTMSLLTCVTRDIARFRPDLKLLISSATMDAE 594

Query: 2095 KFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQ 2274
            KFS+YF  APIF+ PGR +PVEI YT  PE+DY++AA +T++ IH+ EP GD+LVF TGQ
Sbjct: 595  KFSDYFDTAPIFSFPGRRYPVEINYTSAPEADYMDAAIVTILTIHVREPLGDILVFFTGQ 654

Query: 2275 EEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAE 2454
            EEI+T+ E+L  R++ +G  + ELII P+Y  LPSE+Q +IF+P P G RKVV+ATNIAE
Sbjct: 655  EEIETAEEILKHRIRGLGTKIRELIICPIYANLPSELQAKIFEPTPEGARKVVLATNIAE 714

Query: 2455 TSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLY 2634
            TSLTIDGI YVVDPGF K K YNP++GM+SL++TPIS+A+A QR+GRAGRT PGKCYRLY
Sbjct: 715  TSLTIDGIKYVVDPGFSKMKSYNPRTGMESLLITPISKASATQRAGRAGRTSPGKCYRLY 774

Query: 2635 TERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHT 2814
            T   + +++    VPE+QRTNLAS +L LK++GI++LI+FDFMD PP ++++ +L  L
Sbjct: 775  TAFNYNNDLEENTVPEVQRTNLASVVLALKSLGIHDLINFDFMDPPPAEALVKSLELLFA 834

Query: 2815 LSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNV-QNIFYRPK 2991
            L AL+  G LTK GRRMAEFPL+P LSK++++S    CS+E+++I AML++  +IFYRPK
Sbjct: 835  LGALNKLGELTKAGRRMAEFPLDPMLSKMIVVSDKYKCSDEIISIAAMLSIGGSIFYRPK 894

Query: 2992 EKQDHADQKKAKFHQPE-GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQ 3168
            +KQ HAD  +  FH    GDH+ LL VY+SWK  +FS  WC+EN+IQVRSMKRA+DIR Q
Sbjct: 895  DKQVHADNARMNFHTGNVGDHIALLKVYSSWKETNFSTQWCYENYIQVRSMKRARDIRDQ 954

Query: 3169 LLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSAC 3348
            L G+++R ++ + S   ++  V+K+I +GFF + AK      YRT+   Q V+IHP+S
Sbjct: 955  LEGLLERVEIDISSNLNELDSVRKSIVAGFFPHTAKLQKNGSYRTVKHPQTVHIHPNSGL 1014

Query: 3349 FQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLST 3498
             Q  P WVVYHELV+T+KEYMR+VT + P+WL+E AP ++++ D    ST
Sbjct: 1015 SQVLPRWVVYHELVLTSKEYMRQVTELKPEWLIELAPHYYQLKDVEDEST 1064


>gi|39591365|emb|CAE73419.1| Hypothetical protein CBG20862
            [Caenorhabditis briggsae]
          Length = 1007

 Score =  748 bits (1932), Expect = 0.0
 Identities = 370/654 (56%), Positives = 496/654 (75%), Gaps = 3/654 (0%)
 Frame = +1

Query: 1564 KATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAG 1743
            K T   +  +S+ E R SLP++A ++  +EA+ ++Q+L++ GETGSGKTTQ+ QY  EAG
Sbjct: 345  KETEAEKRKMSIAEVRRSLPVYAFREAFIEAVREHQVLIIEGETGSGKTTQLPQYLYEAG 404

Query: 1744 LGRRGK-IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGM 1920
                GK IGCTQPRRVAAMSVA RVA+E GCKLGT VGY+IRFEDCTS+ T++KYMTDGM
Sbjct: 405  FCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGM 464

Query: 1921 LLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKF 2100
            LLRE L +PDL+ YS++M+DEAHERT+HTD+LFGL+K  AR RP+LKL+I+SATLD+ KF
Sbjct: 465  LLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRPDLKLLISSATLDAEKF 524

Query: 2101 SEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEP-PGDVLVFLTGQE 2277
            S +F +APIF IPGR FPV+I YT+ PE+DYL+AA +TVMQIHLT+P PGD+LVFLTGQE
Sbjct: 525  SGFFDDAPIFRIPGRRFPVDIYYTQAPEADYLDAAIVTVMQIHLTQPLPGDILVFLTGQE 584

Query: 2278 EIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAET 2457
            EI+T  E L ER K++G  + ELI LPVY  LPS++Q +IF+P P   RKVV+ATNIAET
Sbjct: 585  EIETLQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATNIAET 644

Query: 2458 SLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYT 2637
            S+TIDGI YV+DPGF KQ  ++ +SG++ L V  IS+AA+ QR+GRAGRTGPGKC+RLYT
Sbjct: 645  SVTIDGISYVIDPGFSKQNSFDARSGVEHLHVVTISKAASNQRAGRAGRTGPGKCFRLYT 704

Query: 2638 ERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTL 2817
              AF +E+   P+PEIQRTNL + +L LK++GI++L+ FDF+D PP ++++ AL  L+ L
Sbjct: 705  AWAFNNELEDQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYAL 764

Query: 2818 SALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQ-NIFYRPKE 2994
             AL+  G LTKLGRRMAEFP +P +SK++I S    CSEE++TI AML+    +FYRPK
Sbjct: 765  GALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYECSEEIVTIAAMLSCNAAVFYRPKA 824

Query: 2995 KQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLL 3174
            +  HAD  +  F  P GDH+TL+ VYN W+  +FSQ WC EN++Q R+MKRA+D+R QL+
Sbjct: 825  QVIHADSARKGFWSPAGDHITLMNVYNKWQESNFSQRWCVENYVQHRTMKRARDVRDQLV 884

Query: 3175 GIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQ 3354
            G+++R ++ + S   D  +++KAI +G+F N +K D    Y+T+      Y HP+S  F+
Sbjct: 885  GLLERVEIELKS-STDTIKIRKAITAGYFYNVSKLDNSGLYKTVKHKHTTYPHPNSCLFE 943

Query: 3355 QQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQK 3516
            + P WVVY+ELV T+KE+MRE++ I+  WL+E AP ++K G   + ST K+  K
Sbjct: 944  ETPRWVVYYELVFTSKEFMREMSEIESSWLLEVAPHYYK-GRELEDSTNKKMPK 996


>gi|25408373|pir||D84767 probable pre-mRNA splicing factor RNA
            helicase [imported] - Arabidopsis thaliana
 gi|3608155|gb|AAC36188.1| putative pre-mRNA splicing factor RNA
            helicase [Arabidopsis thaliana]
          Length = 1087

 Score =  746 bits (1927), Expect = 0.0
 Identities = 379/715 (53%), Positives = 513/715 (71%), Gaps = 5/715 (0%)
 Frame = +1

Query: 1351 QGALSKERKETKIQAQRERDM---DTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKM 1521
            QG++ +E K   +  QR RDM   +    F+      D    N +  + A   +  +N
Sbjct: 364  QGSVDQE-KRFAVSVQRYRDMGSAEKMNPFAEQEAWEDHQIENAALKFGAKNKEVSDNYE 422

Query: 1522 KEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGS 1701
                + +  + A   A           E R++LPI+  +  L+ A+ D+Q+L++VGETGS
Sbjct: 423  FVFEDQIDFIKASVLAGDN--------EDRKALPIYTYRDQLLNAVKDHQVLIIVGETGS 474

Query: 1702 GKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCT 1881
            GKTTQ+ QY  EAG  + GK+GCTQPRRVAAMSVA RVA+E G KLG +VGY+IRFEDCT
Sbjct: 475  GKTTQIPQYLHEAGYTKLGKVGCTQPRRVAAMSVAARVAQEMGGKLGHEVGYSIRFEDCT 534

Query: 1882 SQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELK 2061
            S+ TI+KYMTDGMLLRE L +PDL  YS+I++DEAHERT+ TD+LFGL+K  AR RP+LK
Sbjct: 535  SEKTILKYMTDGMLLRELLGEPDLGSYSVIIVDEAHERTLRTDILFGLVKDIARARPDLK 594

Query: 2062 LIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEP 2241
            L+I+SAT+D+ KFS++F +APIF  PGR +PV+I +T  PE+DY++AA  TV+ IH+ EP
Sbjct: 595  LLISSATMDAEKFSDFFDQAPIFRFPGRRYPVDICFTTAPEADYMDAAITTVLTIHVKEP 654

Query: 2242 PGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGK 2421
             GDVLVFL GQEEI+   E L  +++ +G  + ELII P+Y  LPSE+Q +IF+P P G
Sbjct: 655  LGDVLVFLPGQEEIEAVEENLKHKIRGLGTKIRELIICPIYANLPSELQAKIFEPTPEGA 714

Query: 2422 RKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAG 2601
            RKVV+ATNIAETSLTIDGI YVVDPGF K K YNP++GM+SL+VTPIS+A+A QR+GRAG
Sbjct: 715  RKVVLATNIAETSLTIDGIKYVVDPGFSKMKSYNPRTGMESLLVTPISKASATQRTGRAG 774

Query: 2602 RTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLD 2781
            RT PGKCYRLYT   + +++    VPEIQRTNLAS +L LK++GI+NL++FDFMD PP +
Sbjct: 775  RTSPGKCYRLYTAFNYYNDLEDNTVPEIQRTNLASVVLSLKSLGIHNLLNFDFMDPPPSE 834

Query: 2782 SMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAML 2961
            ++I +L  L  L AL+  G LTK GRRMAEFPL+P LSK++++S    CS+E+++I AML
Sbjct: 835  ALIKSLELLFALGALNQLGELTKAGRRMAEFPLDPMLSKMIVVSDKYKCSDEIISIAAML 894

Query: 2962 NV-QNIFYRPKEKQDHADQKKAKFHQPE-GDHLTLLAVYNSWKNHHFSQPWCFENFIQVR 3135
            ++  +IFYRPK+KQ HAD     FH    GDH+  L +YNSWK  ++S  WC+EN+IQVR
Sbjct: 895  SIGPSIFYRPKDKQVHADNAMKNFHVGNVGDHIAFLKIYNSWKETNYSTQWCYENYIQVR 954

Query: 3136 SMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDG 3315
            SMKRA+DIR QL G+++R ++ + S   ++  ++K+I +GFF + AK      YRT+
Sbjct: 955  SMKRARDIRDQLEGLLERVEIDVSSNANELDSIRKSIVAGFFPHTAKLQKNGSYRTVKHP 1014

Query: 3316 QNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGD 3480
            Q V+IHP+S   Q  P WVVYH+LV+T+KEYMR+VT + P+WL+E AP ++++ D
Sbjct: 1015 QTVHIHPASGLSQVLPRWVVYHQLVLTSKEYMRQVTELKPEWLIEIAPHYYQLKD 1069


>gi|42569631|ref|NP_181077.2| RNA helicase, putative [Arabidopsis
            thaliana]
          Length = 1110

 Score =  746 bits (1926), Expect = 0.0
 Identities = 380/730 (52%), Positives = 520/730 (71%), Gaps = 20/730 (2%)
 Frame = +1

Query: 1351 QGALSKERKETKIQAQRERDM---DTQKGFSSNARILDPMSGNQSTAWSADESKDRNNK- 1518
            QG++ +E K   +  QR RDM   +    F+      D    N +  + A   +  +N
Sbjct: 364  QGSVDQE-KRFAVSVQRYRDMGSAEKMNPFAEQEAWEDHQIENAALKFGAKNKEVSDNYE 422

Query: 1519 --MKEMPEWLKHVTAGG------------KATYGRRTNLSMVEQRESLPIFALKKNLMEA 1656
               ++  +++K     G            + + G+     + E R++LPI+  +  L+ A
Sbjct: 423  FVFEDQIDFIKASVLAGDNYEDEMHAKPSQDSAGKSAFHMLQEDRKALPIYTYRDQLLNA 482

Query: 1657 MIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCK 1836
            + D+Q+L++VGETGSGKTTQ+ QY  EAG  + GK+GCTQPRRVAAMSVA RVA+E G K
Sbjct: 483  VKDHQVLIIVGETGSGKTTQIPQYLHEAGYTKLGKVGCTQPRRVAAMSVAARVAQEMGGK 542

Query: 1837 LGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVL 2016
            LG +VGY+IRFEDCTS+ TI+KYMTDGMLLRE L +PDL  YS+I++DEAHERT+ TD+L
Sbjct: 543  LGHEVGYSIRFEDCTSEKTILKYMTDGMLLRELLGEPDLGSYSVIIVDEAHERTLRTDIL 602

Query: 2017 FGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYL 2196
            FGL+K  AR RP+LKL+I+SAT+D+ KFS++F +APIF  PGR +PV+I +T  PE+DY+
Sbjct: 603  FGLVKDIARARPDLKLLISSATMDAEKFSDFFDQAPIFRFPGRRYPVDICFTTAPEADYM 662

Query: 2197 EAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALP 2376
            +AA  TV+ IH+ EP GDVLVFL GQEEI+   E L  +++ +G  + ELII P+Y  LP
Sbjct: 663  DAAITTVLTIHVKEPLGDVLVFLPGQEEIEAVEENLKHKIRGLGTKIRELIICPIYANLP 722

Query: 2377 SEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVT 2556
            SE+Q +IF+P P G RKVV+ATNIAETSLTIDGI YVVDPGF K K YNP++GM+SL+VT
Sbjct: 723  SELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVVDPGFSKMKSYNPRTGMESLLVT 782

Query: 2557 PISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGI 2736
            PIS+A+A QR+GRAGRT PGKCYRLYT   + +++    VPEIQRTNLAS +L LK++GI
Sbjct: 783  PISKASATQRTGRAGRTSPGKCYRLYTAFNYYNDLEDNTVPEIQRTNLASVVLSLKSLGI 842

Query: 2737 NNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSV 2916
            +NL++FDFMD PP +++I +L  L  L AL+  G LTK GRRMAEFPL+P LSK++++S
Sbjct: 843  HNLLNFDFMDPPPSEALIKSLELLFALGALNQLGELTKAGRRMAEFPLDPMLSKMIVVSD 902

Query: 2917 DLGCSEEVLTIVAMLNV-QNIFYRPKEKQDHADQKKAKFHQPE-GDHLTLLAVYNSWKNH 3090
               CS+E+++I AML++  +IFYRPK+KQ HAD     FH    GDH+  L +YNSWK
Sbjct: 903  KYKCSDEIISIAAMLSIGPSIFYRPKDKQVHADNAMKNFHVGNVGDHIAFLKIYNSWKET 962

Query: 3091 HFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNA 3270
            ++S  WC+EN+IQVRSMKRA+DIR QL G+++R ++ + S   ++  ++K+I +GFF +
Sbjct: 963  NYSTQWCYENYIQVRSMKRARDIRDQLEGLLERVEIDVSSNANELDSIRKSIVAGFFPHT 1022

Query: 3271 AKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVE 3450
            AK      YRT+   Q V+IHP+S   Q  P WVVYH+LV+T+KEYMR+VT + P+WL+E
Sbjct: 1023 AKLQKNGSYRTVKHPQTVHIHPASGLSQVLPRWVVYHQLVLTSKEYMRQVTELKPEWLIE 1082

Query: 3451 FAPSFFKIGD 3480
             AP ++++ D
Sbjct: 1083 IAPHYYQLKD 1092


>gi|4503293|ref|NP_003578.1| DEAH (Asp-Glu-Ala-His) box polypeptide
            16; ATP-dependent RNA helicase #3; DEAD/H box 16; DEAD/H
            (Asp-Glu-Ala-Asp/His) box polypeptide 16 [Homo sapiens]
 gi|3107913|dbj|BAA25908.1| ATP-dependent RNA helicase #3 [Homo
            sapiens]
          Length = 1041

 Score =  744 bits (1921), Expect = 0.0
 Identities = 354/623 (56%), Positives = 479/623 (76%), Gaps = 2/623 (0%)
 Frame = +1

Query: 1609 RESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGCTQPRR 1785
            R SLP+F  ++ L+ A+ ++Q+L++ GETGSGKTTQ+ QY  E G   +G KI CTQPRR
Sbjct: 396  RRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRR 455

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVA RVA E G KLG +VGY+IRFEDCTS+ T+++YMTDGMLLRE L +PDL+ YS
Sbjct: 456  VAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYS 515

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
            ++M+DEAHERT+HTD+LFGL+K  AR RPELK+++ SAT+D+ +FS +F +AP+F IPGR
Sbjct: 516  VVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGR 575

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
             FPV+I YT+ PE+DYLEA  ++V+QIH+T+PPGD+LVFLTGQEEI+ +CE+L +  + +
Sbjct: 576  RFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDPCRRL 635

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
            G  + EL++LP+Y  LPS+MQ RIF P P G RKVV+ATNIAETS TI+GI YV+DPGF
Sbjct: 636  GSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSPTIEGIIYVLDPGFC 695

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            KQK YNP++GM+SL VTP S+A+A QR+GRAGR   GKC+RLYT  A++ E+  T VPEI
Sbjct: 696  KQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEI 755

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRT+L + +L LK++GI++L+ FDF+D PP ++++  L  L+ L AL+  G LT  GR+M
Sbjct: 756  QRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLTLEQLYALGALNHLGELTTSGRKM 815

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPE 3042
            AE P++P LSK+++ S    CSEE+LT+ AML+V N IFYRPK+K  HAD  +  F  P
Sbjct: 816  AELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPG 875

Query: 3043 GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRD 3222
            GDHL LL VY  W    +S  WC ENF+Q RSM+RA+D+R+QL G+++R ++ + SC  D
Sbjct: 876  GDHLVLLNVYTQWAESGYSSQWCCENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGD 935

Query: 3223 VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTK 3402
              RV+KAI +G+F + A R  + GYRT+   Q V+IHP+S+ F+QQP W++YHELV+TTK
Sbjct: 936  YIRVRKAITAGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTK 994

Query: 3403 EYMREVTAIDPKWLVEFAPSFFK 3471
            E+MR+V  I+  WL+E AP ++K
Sbjct: 995  EFMRQVLEIESSWLLEVAPHYYK 1017


>gi|47218748|emb|CAG02734.1| unnamed protein product [Tetraodon
            nigroviridis]
          Length = 916

 Score =  740 bits (1911), Expect = 0.0
 Identities = 380/710 (53%), Positives = 502/710 (70%), Gaps = 34/710 (4%)
 Frame = +1

Query: 1489 ADESKDRNNKMKEMPEWLKHVTAGGKA-TYGRRTNLSMVEQRESLPIFALKKNLMEAMID 1665
            A E ++R N+   MPE  +       A +       SM E R SLPIF  +++L+ A+ +
Sbjct: 200  AKEEEERKNRYY-MPEETRRKDQDAPALSQAELKKQSMQEVRRSLPIFPYREDLLSAIGE 258

Query: 1666 NQILVVVGETGSGKTTQMTQYAIEAGLGRRGK-IGCTQPRRVAAMSVAKRVAEEYGCKLG 1842
            +QILV+ GETGSGKTTQ+ QY  E G  R GK IGCTQPRRVAAMSVA RVA+E   KLG
Sbjct: 259  HQILVIEGETGSGKTTQIPQYLFEQGYTRDGKKIGCTQPRRVAAMSVAARVAQEMSVKLG 318

Query: 1843 TDV-------------------------------GYTIRFEDCTSQDTIIKYMTDGMLLR 1929
             +V                               GY+IRFEDCTS+ T++KYMTDGMLLR
Sbjct: 319  NEVSRWTKATQSSYAMVNERTHGWRNEPRCLLQVGYSIRFEDCTSERTVLKYMTDGMLLR 378

Query: 1930 ECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEY 2109
            E L +PDL+ YS+I++DEAHERT+HTD+LFGL+K  AR R +LK+++ SATLD+ +FS +
Sbjct: 379  EFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRADLKVLVASATLDTERFSRF 438

Query: 2110 FLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDT 2289
            F +AP+F IPGR FPV+I YT+ PE+DYLEA  ++V+QIH+T+P GD+LVFLTGQEEI+
Sbjct: 439  FDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPTGDILVFLTGQEEIEA 498

Query: 2290 SCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTI 2469
             CE+L +R + +G  + EL+ILP+Y  LPS+MQ +IF P P G RKVV+ATNIAETSLTI
Sbjct: 499  CCEMLQDRCRRLGSKIAELVILPIYANLPSDMQAKIFTPTPPGARKVVVATNIAETSLTI 558

Query: 2470 DGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAF 2649
            DGI YV+DPGF KQK YN ++GM+SL+VTP S+A+A QR+GRAGR   GKC+RLYT  AF
Sbjct: 559  DGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAF 618

Query: 2650 RDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALD 2829
            + EM  T VPEIQRTNL + +L LK++GIN+L+ FDFMD PP ++++ AL  L+ L AL+
Sbjct: 619  KHEMEETTVPEIQRTNLGNVVLLLKSLGINDLVHFDFMDPPPHETLVLALEQLYALGALN 678

Query: 2830 GDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDH 3006
              G LTKLGRRMAE P++P LSK+++ S    CS EVLTI AML+V N IFYRPK+K  H
Sbjct: 679  HLGELTKLGRRMAELPVDPMLSKMILASEQYKCSNEVLTIAAMLSVNNSIFYRPKDKVVH 738

Query: 3007 ADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMD 3186
            AD  +  F  P GDHL LL VYN W    +S  WC+ENFIQ RSM+RA+D+R QL G+MD
Sbjct: 739  ADNARMNFVVPGGDHLVLLNVYNQWVESGYSTQWCYENFIQFRSMRRARDVRDQLEGLMD 798

Query: 3187 RHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPE 3366
            R ++ +VS   D   ++KA+ +G+F + A R  + GY+T+   Q V++HP+S+ F++ P
Sbjct: 799  RIEVEVVSSQGDNVPIRKAVTAGYFYHTA-RLSKGGYKTVKHQQTVFVHPNSSLFEELPR 857

Query: 3367 WVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQK 3516
            W++YHELV TTKE+MR+V  I+  WL+E AP ++K  +    S+ K  +K
Sbjct: 858  WIIYHELVFTTKEFMRQVIEIESGWLLEVAPHYYKSKELEDNSSKKMPRK 907


>gi|32422967|ref|XP_331927.1| hypothetical protein [Neurospora crassa]
 gi|28926916|gb|EAA35877.1| hypothetical protein [Neurospora crassa]
          Length = 1005

 Score =  737 bits (1903), Expect = 0.0
 Identities = 386/836 (46%), Positives = 553/836 (65%), Gaps = 10/836 (1%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDM-PDFDEEMGVLRNYXXXXXXXXXXXXLVED-EPDFLRGYGK 1278
            + WE  +M  +GV    D+  DF+++    R +            LV D  P FL G
Sbjct: 152  DAWETNRMLTSGVAQRRDLGQDFEDDQEGTRVHL-----------LVHDLRPPFLDGRTI 200

Query: 1279 GGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDP 1458
               +++PV  V++    +A  A     + +ER+      QRER    Q+        L
Sbjct: 201  FTKQLDPVPAVRDSQSDMAIFARKGSKVVRERR-----TQRERQRQAQEATKVAGTALGN 255

Query: 1459 MSG------NQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESL 1620
            + G      + +   + +E   ++  M +  E +K        +  +    S+ EQRE L
Sbjct: 256  LMGVKEEDTDSALPIAVEEEAGKSKNMNKFSEHMKENEGASNFSQSK----SLKEQREFL 311

Query: 1621 PIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMS 1800
            P FA++++L+  + DNQ+++V+GETGSGKTTQ+TQ+  E G G+ G IGCTQPRRVAAMS
Sbjct: 312  PAFAVREDLLRVIRDNQVVIVIGETGSGKTTQLTQFLYEDGYGKTGMIGCTQPRRVAAMS 371

Query: 1801 VAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLD 1980
            VAKRVAEE   KLG+ VGY IRFEDCTS+DT+IKYMTDG+LLRE L +PDL  YS +++D
Sbjct: 372  VAKRVAEEMEVKLGSTVGYAIRFEDCTSKDTVIKYMTDGVLLRESLNEPDLDRYSCVIMD 431

Query: 1981 EAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVE 2160
            EAHER ++TDVL GL K   ++R +LKLI+TSAT+++ +FS+++  AP FTIPGRTFPV+
Sbjct: 432  EAHERALNTDVLMGLFKKILQRRRDLKLIVTSATMNAKRFSDFYGGAPEFTIPGRTFPVD 491

Query: 2161 ILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVP 2340
            I++ R P  DY++ A   V+ IH+ +P GD+LVF+TGQE+I+ +CE++ ER+ ++  D P
Sbjct: 492  IMFHRSPVEDYVDQAVQQVLAIHVGKPAGDILVFMTGQEDIEVTCELIRERLDALN-DPP 550

Query: 2341 ELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIY 2520
            +L ILP+Y  +P+++Q +IFD A  G RKV++ATNIAETSLT+DGI YVVD G+ K K+Y
Sbjct: 551  KLSILPIYSQMPADLQAKIFDRAAPGVRKVIVATNIAETSLTVDGIMYVVDAGYSKLKVY 610

Query: 2521 NPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNL 2700
            NP+ GMD+L +TPISQA A QR+GRAGRTGPG+ Y L+TE+AF++EM    +PEIQRTNL
Sbjct: 611  NPRMGMDTLQITPISQANAMQRAGRAGRTGPGQAYHLFTEKAFKEEMYMQTIPEIQRTNL 670

Query: 2701 ASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPL 2880
            ++T+L LK++G+ +L+DFDFMD PP D++ T+L  L  L ALD  G LT LGR+M  FP+
Sbjct: 671  SNTVLLLKSLGVKDLLDFDFMDPPPQDTISTSLFDLWALGALDNLGELTDLGRKMNAFPM 730

Query: 2881 EPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTL 3060
            +P L+KLLI S + GCSEE++TIV+ML+V N+FYRPKE+Q+ +D  + KF  PE DHLT
Sbjct: 731  DPPLAKLLITSEEYGCSEEMVTIVSMLSVPNVFYRPKERQEESDAAREKFFVPESDHLTY 790

Query: 3061 LAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQK 3240
            L VY  WK + ++  WC  +F+  +S++RA+++R+QLL IM    + M SCG D   ++K
Sbjct: 791  LHVYTQWKANGYNDGWCVRHFLHSKSLRRAKEVREQLLDIMKMQNMKMTSCGTDWDVIRK 850

Query: 3241 AICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTKEYMR 3414
             ICSG++  AAK      Y  L     V +HP+SA +     P++VVYHEL++T+KEYM
Sbjct: 851  CICSGYYHQAAKVKGIGEYINLRTSVTVQLHPTSALYGLGFLPDYVVYHELILTSKEYMS 910

Query: 3415 EVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWRITRVKKR 3582
             VT++DP WL +    F+ + +    +  KR  + +  F++  +  A R+   KKR
Sbjct: 911  TVTSVDPHWLADLGGVFYSVKEKGYSAREKRITETE--FNRRMEIEA-RMAADKKR 963


>gi|38424010|dbj|BAD01767.1| RNA helicase-like [Oryza sativa (japonica
            cultivar-group)]
          Length = 1066

 Score =  736 bits (1899), Expect = 0.0
 Identities = 364/656 (55%), Positives = 488/656 (73%), Gaps = 22/656 (3%)
 Frame = +1

Query: 1603 EQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPR 1782
            ++R++LPI+  +  L++A+ + Q++V+VGETGSGKTTQ+ QY  EAG   +GK+ CTQPR
Sbjct: 412  DERKTLPIYKFRDELLKAVEEYQVIVIVGETGSGKTTQIPQYLHEAGYTAKGKVACTQPR 471

Query: 1783 RVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGY 1962
            RVAAMSVA RV++E G KLG +VGY+IRFEDCTS+ T+IKYMTDGMLLRE L +PDL+ Y
Sbjct: 472  RVAAMSVAARVSQEMGVKLGHEVGYSIRFEDCTSEKTLIKYMTDGMLLREFLGEPDLASY 531

Query: 1963 SLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPG 2142
            S++M+DEAHERT+ TD+LFGL+K  +R RP+LKL+I+SATLD+ KFS+YF  APIF IPG
Sbjct: 532  SVVMVDEAHERTLSTDILFGLVKDISRFRPDLKLLISSATLDAEKFSDYFDSAPIFKIPG 591

Query: 2143 RTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKS 2322
            R +PVE+ YT+ PE+DY++AA +TV+QIH+T+PPGD+LVFLTGQEEI+T  E+L  R +
Sbjct: 592  RRYPVEVHYTKAPEADYIDAAIVTVLQIHVTQPPGDILVFLTGQEEIETIDEILKHRTRG 651

Query: 2323 MGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGF 2502
            +G  + EL+I P+Y  LP+E+Q +IF+P P G RKVV+ATNIAETSLTIDGI YVVDPGF
Sbjct: 652  LGTKIAELLICPIYANLPTELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVVDPGF 711

Query: 2503 VKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPE 2682
             K K YNP++GM+SL++ PIS+A+A QR+GR+GRTGPGKC+RLYT   +  ++    VPE
Sbjct: 712  CKIKSYNPRTGMESLLINPISKASANQRAGRSGRTGPGKCFRLYTSYNYMHDLEDNTVPE 771

Query: 2683 IQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRR 2862
            IQRTNLA+ +L LK++GI++L++FDFMD PP ++++ AL  L  LSAL+  G LTK GRR
Sbjct: 772  IQRTNLANVVLTLKSLGIHDLVNFDFMDPPPSEALLKALEQLFALSALNSRGELTKTGRR 831

Query: 2863 MAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQP 3039
            MAEFPL+P LSK+++ S    CS+EV++I +ML+V N IFYRPK+KQ HAD  +  FH
Sbjct: 832  MAEFPLDPMLSKMIVASEKYKCSDEVISIASMLSVGNSIFYRPKDKQVHADNARLNFHTG 891

Query: 3040 E-GDHLTLLAVYNSWKNHHFSQPWCFENFIQ--------------------VRSMKRAQD 3156
              GDH+ LL VYNSWK   +S  WC+EN+IQ                    VRSMKRA+D
Sbjct: 892  NVGDHIALLNVYNSWKETDYSTQWCYENYIQSPNGKYQLFEGCQLQNIVILVRSMKRARD 951

Query: 3157 IRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHP 3336
            IR QL G+++R ++ + S   D+  ++KAI SGFF ++++      YRT+ + Q V
Sbjct: 952  IRDQLEGLLERVEIEISSNASDLDAIKKAITSGFFHHSSRLQKNGSYRTVKNPQTVL--- 1008

Query: 3337 SSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFK 3504
                    P WV+YHELV+TTKEYMR+VT + P WLVE AP ++++ D     T K
Sbjct: 1009 --------PRWVIYHELVLTTKEYMRQVTELKPDWLVEIAPHYYQLKDVDDTGTKK 1056


>gi|17531507|ref|NP_497027.1| sex determining protein, Masculinisation
            Of Germline MOG-4 (114.3 kD) (mog-4) [Caenorhabditis
            elegans]
 gi|3915519|sp|O45244|MOG4_CAEEL Probable pre-mRNA splicing factor
            ATP-dependent RNA helicase mog-4 (Sex determination
            protein mog-4) (Masculinization of germ line protein 4)
 gi|7446118|pir||T18832 probable RNA helicase - Caenorhabditis elegans
 gi|3873886|emb|CAB03819.1| Hypothetical protein C04H5.6
            [Caenorhabditis elegans]
 gi|3873945|emb|CAB03845.1| Hypothetical protein C04H5.6
            [Caenorhabditis elegans]
 gi|9864172|gb|AAG01333.1| sex determining protein MOG-4
            [Caenorhabditis elegans]
          Length = 1008

 Score =  735 bits (1898), Expect = 0.0
 Identities = 360/637 (56%), Positives = 484/637 (75%), Gaps = 3/637 (0%)
 Frame = +1

Query: 1570 TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLG 1749
            T   +  +S+ E R+SLP++A +   +EA+ ++Q+L++ GETGSGKTTQ+ QY  EAG
Sbjct: 348  TEAEKKKMSIEETRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQYLYEAGFC 407

Query: 1750 RRGK-IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLL 1926
              GK IGCTQPRRVAAMSVA RVA+E GCKLGT VGY+IRFEDCTS+ T++KYMTDGMLL
Sbjct: 408  EGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLL 467

Query: 1927 RECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSE 2106
            RE L +PDL+ YS++M+DEAHERT+HTD+LFGL+K  AR R +LKL+I+SATLD+ KFS
Sbjct: 468  REFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSS 527

Query: 2107 YFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEP-PGDVLVFLTGQEEI 2283
            +F +APIF IPGR FPV+I YT+ PE+DY++AA +T+MQIHLT+P PGD+LVFLTGQEEI
Sbjct: 528  FFDDAPIFRIPGRRFPVDIYYTQAPEADYVDAAIVTIMQIHLTQPLPGDILVFLTGQEEI 587

Query: 2284 DTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSL 2463
            +T  E L ER K++G  + ELI LPVY  LPS++Q +IF+P P   RKVV+ATNIAETS+
Sbjct: 588  ETVQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATNIAETSV 647

Query: 2464 TIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTER 2643
            TIDGI YV+DPGF KQ  ++ +SG++ L V  IS+AAA QR+GRAGRTGPGKC+RLYT
Sbjct: 648  TIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAW 707

Query: 2644 AFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSA 2823
            A++ E+   P+PEIQRTNL + +L LK++GI++L+ FDF+D PP ++++ AL  L+ L A
Sbjct: 708  AYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGA 767

Query: 2824 LDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQ-NIFYRPKEKQ 3000
            L+  G LTKLGRRMAEFP +P +SK++I S    CSEE++TI AML+    +FYRPK +
Sbjct: 768  LNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYECSEEIVTIAAMLSCNAAVFYRPKAQV 827

Query: 3001 DHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGI 3180
             HAD  +  F  P GDH+TL+ VYN W+   FSQ WC EN++Q R+MKRA+D+R QL+G+
Sbjct: 828  IHADSARKGFWSPAGDHITLMNVYNKWQESSFSQRWCVENYVQHRTMKRARDVRDQLVGL 887

Query: 3181 MDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQ 3360
            ++R ++   S   D  +++KAI +G+F N +K D    Y+T+      + HP+S  F++
Sbjct: 888  LERVEIETKS-STDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFEET 946

Query: 3361 PEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFK 3471
            P WVVY ELV T+KE+MRE++ I+  WL+E AP ++K
Sbjct: 947  PRWVVYFELVFTSKEFMREMSEIESGWLLEVAPHYYK 983


>gi|48926654|gb|AAT47443.1| putative DEAD/DEAH RNA helicase [Oryza
            sativa (japonica cultivar-group)]
          Length = 1070

 Score =  734 bits (1895), Expect = 0.0
 Identities = 363/637 (56%), Positives = 489/637 (75%), Gaps = 8/637 (1%)
 Frame = +1

Query: 1594 SMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGL--GRRGKIG 1767
            ++ ++R++LP++ LK +L++A+ ++++L+VVGETGSGKTTQ+ QY  E G   G R K+
Sbjct: 396  TLQDERKTLPVYKLKDDLLKAIDEHKVLIVVGETGSGKTTQIPQYLHEVGYTAGGRKKVA 455

Query: 1768 CTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDP 1947
            CTQPRRVAAMSVA RVAEE G KLG +VGY+IRFEDCTS+ T+IKYMTDGMLLRE L +P
Sbjct: 456  CTQPRRVAAMSVAARVAEEMGVKLGHEVGYSIRFEDCTSEKTVIKYMTDGMLLREFLGEP 515

Query: 1948 DLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPI 2127
            DL  YS++++DEAHERT+ TD+LFGL+K  AR RP++KL+I+SATL++ KFS++F  AP+
Sbjct: 516  DLGSYSVVVVDEAHERTLATDILFGLVKDIARLRPDMKLLISSATLNADKFSDFFDAAPV 575

Query: 2128 FTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPG--DVLVFLTGQEEIDTSCEV 2301
            F IPGR F V I YT  PE+DY++AA +TV+Q+H+TEPPG  D+L+FLTGQEEI+T  E+
Sbjct: 576  FRIPGRRFEVGIHYTVAPEADYIDAAVVTVLQLHVTEPPGGGDILLFLTGQEEIETVEEI 635

Query: 2302 LYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIF 2481
            L  R++ +G  V EL+I P+Y  LP+E+Q +IF+PAPAG RKVV+ATNIAETSLTIDGI
Sbjct: 636  LRHRLRVLGGKVAELVICPIYANLPAELQAKIFEPAPAGARKVVLATNIAETSLTIDGIK 695

Query: 2482 YVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEM 2661
            YVVDPGF K K YNP++GM+SL+V P+S+A+A+QR+GR+GRTGPG+C+RLYTE  F  ++
Sbjct: 696  YVVDPGFCKVKSYNPRTGMESLLVAPVSRASAEQRAGRSGRTGPGECFRLYTEYNFVSDL 755

Query: 2662 LPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGL 2841
                VPEIQR+NLAS +L LKA+GIN+L+ FDFMD PP +S++ AL  L  L AL+  G
Sbjct: 756  DDDAVPEIQRSNLASVVLALKALGINDLVGFDFMDPPPAESLLRALEELFALGALNSRGE 815

Query: 2842 LTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQK 3018
            LTK GRRMAEFPL+P LSK ++ S   GCSEEV+TI AML+  N +FYRP++K+ HAD
Sbjct: 816  LTKTGRRMAEFPLDPMLSKAIVASERYGCSEEVITIAAMLSAGNAVFYRPRDKRVHADAA 875

Query: 3019 KAKFHQPE-GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHK 3195
            +  FH    GDH+ LL VYN+W    +S  WC E+F+Q R+M+RA+D+R QL  +++R +
Sbjct: 876  RRAFHAGNAGDHVALLNVYNAWAESGYSPQWCRESFVQHRTMRRARDVRDQLGALLERVE 935

Query: 3196 LLMVSC--GRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEW 3369
            +   S   G D+  V+KA+ +G+FR+AA+      YR +   Q V++HPSS   Q  P W
Sbjct: 936  IAPCSSAGGGDLDAVRKAVTAGYFRHAARLQRDGSYRAVKSRQTVFVHPSSGVAQAPPRW 995

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGD 3480
             +YHELV+TTKEYMR+VT + P+WLVE AP +++  D
Sbjct: 996  ALYHELVLTTKEYMRQVTELKPEWLVEIAPHYYERKD 1032


>gi|482230|pir||S41025 hypothetical protein K03H1.2 - Caenorhabditis
            elegans
          Length = 1451

 Score =  734 bits (1895), Expect = 0.0
 Identities = 377/796 (47%), Positives = 532/796 (66%), Gaps = 3/796 (0%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDEPDFLRGYGKGG 1284
            E WE  ++  +GV+   D     E   +  +             +V   P FL G
Sbjct: 283  ELWENNRLHRSGVVAMAD-----ELSSIFEDETDENRVTILVQNIV---PPFLDGRIVFT 334

Query: 1285 AEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDPMS 1464
             + +P+  V +    +A +A       ++R+E +    R++  D     + + ++ + M
Sbjct: 335  KQAQPIIPVVDTTCDMAVSAARGSVAVRKRREVE---DRKKAQDKHWELAGS-KLGNLMG 390

Query: 1465 GNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKKN 1644
              +    +AD   D +   KE  ++  H+    +A        S+ +QRE LP+FA ++
Sbjct: 391  VKEKKDETADPEDDDSGNYKESHQFASHMK-DNEAVSDFAMEKSIKQQREYLPVFACRQK 449

Query: 1645 LMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEE 1824
            +M  + +N ++++VGETGSGKTTQ+ QY +E G G  G IGCTQPRRVAAMSVA+RVA+E
Sbjct: 450  MMNVIRENNVVIIVGETGSGKTTQLAQYLLEDGFGDSGLIGCTQPRRVAAMSVARRVADE 509

Query: 1825 YGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIH 2004
             G  LG DVGY IRFEDCTS+ TIIKYMTDG+LLRECL D  L  YS I++DEAHER+++
Sbjct: 510  MGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLN 569

Query: 2005 TDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFL-EAPIFTIPGRTFPVEILYTREP 2181
            TDVLFGLL+    KR +LKLI+TSAT+D+ KF+++F    P FTIPGRTFPVE+ + R P
Sbjct: 570  TDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTP 629

Query: 2182 ESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPV 2361
              DY++AA    + IHL    GD+L+F+ GQE+I+ +CE++ E++  +  + P L +LP+
Sbjct: 630  VEDYVDAAVKQAVTIHLGGMDGDILIFMPGQEDIECTCEMIKEKLGELD-EAPPLAVLPI 688

Query: 2362 YGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMD 2541
            Y  LPS++Q +IF  AP G RK ++ATNIAETSLT+DGI +V+DPGF K K+YNP+ GMD
Sbjct: 689  YSQLPSDLQAKIFQRAPGGMRKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMD 748

Query: 2542 SLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQL 2721
            +L + P+SQA+A QR+GRAGRTGPG+CYRLYTER F+DE+L + VPEIQRTNLA+ +L L
Sbjct: 749  ALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLL 808

Query: 2722 KAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKL 2901
            K++G+++L+ F FMDAPP D+M+ ++  L TL ALD  G LT +GR+M EFPL+P+LSK+
Sbjct: 809  KSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKM 868

Query: 2902 LIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSW 3081
            LIMS ++GCS+EVLTIV+ML+V  IF+RPK +++ AD KK KF  PE DHLT L VY  W
Sbjct: 869  LIMSAEMGCSDEVLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQW 928

Query: 3082 KNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFF 3261
            + H +S  WC +N++ V+++K+ +++R QL  IM   KL ++S G +   V+K ICS +F
Sbjct: 929  RTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQDLKLPLISNGSEWDIVRKCICSAYF 988

Query: 3262 RNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTKEYMREVTAIDP 3435
             NAA+      Y  +  G   ++HP+SA F     P++VVYHEL+MT KEYM+ VTA+D
Sbjct: 989  HNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYMQCVTAVDA 1048

Query: 3436 KWLVEFAPSFFKIGDS 3483
             WL E  P F+ I +S
Sbjct: 1049 IWLAELGPMFYSIKES 1064


>gi|17554326|ref|NP_499212.1| sex determination DEAH box protein,
            similar to pre-mRNA splicing factor ATP-dependent RNA
            helicase., Masculinisation Of Germline MOG-1 (129.4 kD)
            (mog-1) [Caenorhabditis elegans]
 gi|732174|sp|P34498|MOG1_CAEEL Probable pre-mRNA splicing factor
            ATP-dependent RNA helicase mog-1 (Sex determination
            protein mog-1) (Masculinization of germ line protein 1)
 gi|25395953|pir||F88570 protein K03H1.2 [imported] - Caenorhabditis
            elegans
 gi|3878176|emb|CAA82662.1| Hypothetical protein K03H1.2
            [Caenorhabditis elegans]
 gi|4249768|gb|AAD13795.1| sex determination protein MOG-1
            [Caenorhabditis elegans]
          Length = 1131

 Score =  734 bits (1895), Expect = 0.0
 Identities = 377/796 (47%), Positives = 532/796 (66%), Gaps = 3/796 (0%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDEPDFLRGYGKGG 1284
            E WE  ++  +GV+   D     E   +  +             +V   P FL G
Sbjct: 283  ELWENNRLHRSGVVAMAD-----ELSSIFEDETDENRVTILVQNIV---PPFLDGRIVFT 334

Query: 1285 AEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDPMS 1464
             + +P+  V +    +A +A       ++R+E +    R++  D     + + ++ + M
Sbjct: 335  KQAQPIIPVVDTTCDMAVSAARGSVAVRKRREVE---DRKKAQDKHWELAGS-KLGNLMG 390

Query: 1465 GNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKKN 1644
              +    +AD   D +   KE  ++  H+    +A        S+ +QRE LP+FA ++
Sbjct: 391  VKEKKDETADPEDDDSGNYKESHQFASHMK-DNEAVSDFAMEKSIKQQREYLPVFACRQK 449

Query: 1645 LMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEE 1824
            +M  + +N ++++VGETGSGKTTQ+ QY +E G G  G IGCTQPRRVAAMSVA+RVA+E
Sbjct: 450  MMNVIRENNVVIIVGETGSGKTTQLAQYLLEDGFGDSGLIGCTQPRRVAAMSVARRVADE 509

Query: 1825 YGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIH 2004
             G  LG DVGY IRFEDCTS+ TIIKYMTDG+LLRECL D  L  YS I++DEAHER+++
Sbjct: 510  MGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLN 569

Query: 2005 TDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFL-EAPIFTIPGRTFPVEILYTREP 2181
            TDVLFGLL+    KR +LKLI+TSAT+D+ KF+++F    P FTIPGRTFPVE+ + R P
Sbjct: 570  TDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTP 629

Query: 2182 ESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPV 2361
              DY++AA    + IHL    GD+L+F+ GQE+I+ +CE++ E++  +  + P L +LP+
Sbjct: 630  VEDYVDAAVKQAVTIHLGGMDGDILIFMPGQEDIECTCEMIKEKLGELD-EAPPLAVLPI 688

Query: 2362 YGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMD 2541
            Y  LPS++Q +IF  AP G RK ++ATNIAETSLT+DGI +V+DPGF K K+YNP+ GMD
Sbjct: 689  YSQLPSDLQAKIFQRAPGGMRKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMD 748

Query: 2542 SLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQL 2721
            +L + P+SQA+A QR+GRAGRTGPG+CYRLYTER F+DE+L + VPEIQRTNLA+ +L L
Sbjct: 749  ALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLL 808

Query: 2722 KAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKL 2901
            K++G+++L+ F FMDAPP D+M+ ++  L TL ALD  G LT +GR+M EFPL+P+LSK+
Sbjct: 809  KSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKM 868

Query: 2902 LIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSW 3081
            LIMS ++GCS+EVLTIV+ML+V  IF+RPK +++ AD KK KF  PE DHLT L VY  W
Sbjct: 869  LIMSAEMGCSDEVLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQW 928

Query: 3082 KNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFF 3261
            + H +S  WC +N++ V+++K+ +++R QL  IM   KL ++S G +   V+K ICS +F
Sbjct: 929  RTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQDLKLPLISNGSEWDIVRKCICSAYF 988

Query: 3262 RNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTKEYMREVTAIDP 3435
             NAA+      Y  +  G   ++HP+SA F     P++VVYHEL+MT KEYM+ VTA+D
Sbjct: 989  HNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYMQCVTAVDA 1048

Query: 3436 KWLVEFAPSFFKIGDS 3483
             WL E  P F+ I +S
Sbjct: 1049 IWLAELGPMFYSIKES 1064


>gi|46107130|ref|XP_380624.1| hypothetical protein FG00448.1
            [Gibberella zeae PH-1]
 gi|42544308|gb|EAA67151.1| hypothetical protein FG00448.1 [Gibberella
            zeae PH-1]
          Length = 968

 Score =  733 bits (1893), Expect = 0.0
 Identities = 383/854 (44%), Positives = 553/854 (63%), Gaps = 9/854 (1%)
 Frame = +1

Query: 973  AIGVRPRTPPASTSSWMNPEASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTA 1152
            + G     P AS  +W   +         +     +   R    + WE  +M  +GV
Sbjct: 68   SFGDDTHNPFASYGAWEGQQQEAARHEKMSIRFDARREQRNRDNDAWETNRMLQSGVAQR 127

Query: 1153 TDMP-DFDEEMGVLRNYXXXXXXXXXXXXLVED-EPDFLRGYGKGGAEIEPVKVVKNPDG 1326
             DM  DF ++    R +            L+ D  P FL+G      ++EPV  VK+P
Sbjct: 128  RDMASDFVDDDDSTRVHL-----------LIHDLRPPFLKGRTIFTKQLEPVPAVKDPQS 176

Query: 1327 SLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDPM------SGNQSTAWS 1488
             +A  +     + KE ++     QRER    ++  S     L  +       G+ +
Sbjct: 177  HMAVFSRKGSKVVKEARQ-----QRERQRQAKEATSMTGTTLGNIMGAKEDDGDSALPVP 231

Query: 1489 ADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDN 1668
            A++      K  +  E LK        +  +    ++ EQRE LP FA++++L+  + +N
Sbjct: 232  AEDDAQPERKGNKFSEHLKKTDGASNFSQSK----TLREQREYLPAFAVREDLLRVIREN 287

Query: 1669 QILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTD 1848
            Q+++ VGETGSGKTTQ+TQ+  E G G+ G IGCTQPRRVAAMSVAKRVAEE   KLG+
Sbjct: 288  QVVICVGETGSGKTTQLTQFLQEDGYGKTGMIGCTQPRRVAAMSVAKRVAEEMEVKLGST 347

Query: 1849 VGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLL 2028
            VGY IRFEDCTS++T+IKYMTDG+LLRE L +PDL  YS +++DEAHER ++TD+L GL
Sbjct: 348  VGYAIRFEDCTSKETVIKYMTDGVLLRESLNEPDLDRYSCVIMDEAHERALNTDILMGLF 407

Query: 2029 KAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAH 2208
            K   ++R +LKLI+TSAT++S +FS++F  AP F IPGRTFPV++++ R P  DY++ A
Sbjct: 408  KKILQRRRDLKLIVTSATMNSKRFSDFFGGAPEFIIPGRTFPVDVMFHRSPVEDYVDQAV 467

Query: 2209 ITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQ 2388
              V+ IH++  PGD+LVF+TGQE+I+ +CE++ +R+ ++  D P+L ILP+Y  +P+++Q
Sbjct: 468  HQVLSIHVSMGPGDILVFMTGQEDIEITCELVQKRLDALN-DPPKLSILPIYSQMPADLQ 526

Query: 2389 TRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQ 2568
             +IFD A  G RK ++ATNIAETSLT+DGI YVVD G+ K K+YNPK GMD+L +TPISQ
Sbjct: 527  AKIFDKAAPGVRKCIVATNIAETSLTVDGIKYVVDAGYSKMKVYNPKIGMDTLQITPISQ 586

Query: 2569 AAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLI 2748
            A A QRSGRAGRTGPGK +RLY+E+ F++++    +PEIQRTNLA+T+L LK++G+ +L+
Sbjct: 587  ANASQRSGRAGRTGPGKAFRLYSEKEFKEDLYLQTIPEIQRTNLANTVLMLKSLGVKDLL 646

Query: 2749 DFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGC 2928
            DFDFMD PP D++ T++  L  L ALD  G LT+LG++M+ FP++PSLSKLLI + + GC
Sbjct: 647  DFDFMDPPPQDTITTSMFDLWALGALDNLGELTELGKKMSHFPMDPSLSKLLITAEEYGC 706

Query: 2929 SEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPW 3108
            SEE++TIV+ML+V N+FYRPKE+Q+ AD  + KF   E DHLT L VY +WK + +S  W
Sbjct: 707  SEEMITIVSMLSVPNVFYRPKERQEEADAAREKFWVHESDHLTYLQVYTNWKANGYSDGW 766

Query: 3109 CFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQ 3288
            C ++F+  +S++RA++IR+QLL I+   K+ + SCG D   V+K ICSG++  AAK
Sbjct: 767  CVKHFLHPKSLRRAKEIREQLLDIIRMQKMTLTSCGIDWDIVRKCICSGYYHQAAKYKGS 826

Query: 3289 EGYRTLTDGQNVYIHPSSACFQ-QQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSF 3465
              Y  L     V +HP+SA +    P+++VYHEL++T+K Y+  VTA+DP WL +    F
Sbjct: 827  GEYINLRTNLGVQLHPTSALYAGHPPDYIVYHELILTSKVYVSTVTAVDPHWLADLGDVF 886

Query: 3466 FKIGDSTKLSTFKR 3507
            + + +    +  KR
Sbjct: 887  YSLKEKGYSARDKR 900


>gi|18859729|ref|NP_572947.1| CG32604-PA [Drosophila melanogaster]
 gi|16184298|gb|AAL13782.1| LD24737p [Drosophila melanogaster]
 gi|22832718|gb|AAF48351.2| CG32604-PA [Drosophila melanogaster]
          Length = 1222

 Score =  732 bits (1889), Expect = 0.0
 Identities = 388/818 (47%), Positives = 539/818 (65%), Gaps = 10/818 (1%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDM-PDFDEEMGVLRNYXXXXXXXXXXXXLVEDE-PDFLRGYGK 1278
            E WE  +M  +GV+T   +  DFDEE                   LV    P FL G
Sbjct: 374  ELWERNRMLTSGVVTLISVNDDFDEE------------ALERVHLLVHHIIPPFLDGRIV 421

Query: 1279 GGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDP 1458
               + EPV  VK+P   +A  A    AL +  +E     Q+ER    +K +  +   L
Sbjct: 422  FTKQPEPVVPVKDPTSDMALLARKGSALVRNYRE-----QKERRKAQKKHWELSGTKLGN 476

Query: 1459 MSGNQSTA----WSADESKDRNNKMKEMP--EWLKHVTAGGKATYGRRTNLSMVEQRESL 1620
            + G Q          D+ KD+ +  K+    + ++    GGK+ + R+  +S  EQR  L
Sbjct: 477  IMGVQRPQDEDDMRFDKEKDKADYRKDQKFADHMRDQDTGGKSDFSRKKTIS--EQRRFL 534

Query: 1621 PIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMS 1800
            P+FA ++ L+  + +N ++++VGETGSGKTTQ+TQY  E G  +RG IGCTQPRRVAAMS
Sbjct: 535  PVFASRQELLNVIRENSVIIIVGETGSGKTTQLTQYLHEDGYSKRGMIGCTQPRRVAAMS 594

Query: 1801 VAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLD 1980
            VAKRV++E   +LG DVGY IRFEDCTS+ T+IKYMTDG+LLRE L DP+L  YS I++D
Sbjct: 595  VAKRVSDEMDTQLGEDVGYAIRFEDCTSERTVIKYMTDGILLRESLRDPELDSYSAIIMD 654

Query: 1981 EAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVE 2160
            EAHER++ TDVLFGLL+    +R +LKLI+TSAT+DS KF+ +F   P FTIPGRTFPV+
Sbjct: 655  EAHERSLSTDVLFGLLREIVARRHDLKLIVTSATMDSSKFATFFGNVPTFTIPGRTFPVD 714

Query: 2161 ILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVP 2340
            +++++    DY+E+A    +Q+HLT   GD+L+F+ GQE+I+ +CEVL ER+  +  + P
Sbjct: 715  VMFSKNTCEDYVESAVKQALQVHLTPNEGDMLIFMPGQEDIEVTCEVLEERLAEID-NAP 773

Query: 2341 ELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIY 2520
             L ILP+Y  LPS++Q +IF  +  G RK V+ATNIAETSLT+DGI YV+D G+ K K+Y
Sbjct: 774  ALSILPIYSQLPSDLQAKIFQKSSDGLRKCVVATNIAETSLTVDGIIYVIDSGYCKLKVY 833

Query: 2521 NPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNL 2700
            NP+ GMD+L + PISQA A QRSGRAGRTGPG+ YRLYT+R ++DE+L   VPEIQRTNL
Sbjct: 834  NPRIGMDALQIYPISQANANQRSGRAGRTGPGQAYRLYTQRQYKDELLALTVPEIQRTNL 893

Query: 2701 ASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPL 2880
            A+T+L LK++G+ +L+ F FMD PP D+++ +L  L  L ALD  G LT LGR+MAEFPL
Sbjct: 894  ANTVLLLKSLGVVDLLQFHFMDPPPQDNILNSLYQLWILGALDHTGALTTLGRQMAEFPL 953

Query: 2881 EPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTL 3060
            +P   ++LI++  +GCS EVL IV+ML+V +IFYRPK ++D AD  + KF +PE DHLT
Sbjct: 954  DPPQCQMLIVACRMGCSAEVLIIVSMLSVPSIFYRPKGREDEADGVREKFQRPESDHLTY 1013

Query: 3061 LAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQK 3240
            L VY  W+ +++S  WC E+FI +++M++ +++R+QL  IM +  L ++SCG D   V+K
Sbjct: 1014 LNVYQQWRQNNYSSTWCNEHFIHIKAMRKVREVRQQLKDIMTQQNLSVISCGIDWDIVRK 1073

Query: 3241 AICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF--QQQPEWVVYHELVMTTKEYMR 3414
             ICS +F  AA+      Y  L  G   ++HP+SA +     P++VVYHEL+MT KEYM+
Sbjct: 1074 CICSAYFYQAARLKGIGEYVNLRTGMPCHLHPTSALYGLGTTPDYVVYHELIMTAKEYMQ 1133

Query: 3415 EVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPL 3528
              TA+D  WL E  P FF + +S +    K+ Q  + L
Sbjct: 1134 CATAVDGYWLAELGPMFFSVKESGRSGREKKKQAAEHL 1171


>gi|31238776|ref|XP_319843.1| ENSANGP00000025250 [Anopheles gambiae]
 gi|30174315|gb|EAA43377.1| ENSANGP00000025250 [Anopheles gambiae str.
            PEST]
          Length = 873

 Score =  728 bits (1880), Expect = 0.0
 Identities = 352/636 (55%), Positives = 481/636 (75%), Gaps = 2/636 (0%)
 Frame = +1

Query: 1570 TYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLG 1749
            T  +R  +++ E +++LPI+  K++L+ A+  + IL++ GETGSGKTTQ+ QY  EAG
Sbjct: 217  TEAQRKKMTIEETQKTLPIYPFKEDLIAAIQAHNILIIEGETGSGKTTQIPQYLYEAGFT 276

Query: 1750 RRGK-IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLL 1926
              GK IGCTQPRRVAAMSVA RVAEE   KLG +VGY+IRFEDCTS+ T+IKYMTDG L
Sbjct: 277  NEGKKIGCTQPRRVAAMSVAARVAEEMAVKLGNEVGYSIRFEDCTSERTVIKYMTDGTLH 336

Query: 1927 RECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSE 2106
            RE L +PDL+ Y+++++DEAHERT+HTD+LFGL+K  AR R +LKL+I+SATLD+ KFS+
Sbjct: 337  REFLSEPDLASYAVMIIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSD 396

Query: 2107 YFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEID 2286
            +F +APIF IPGR +PV+I YT+ PE+DY++A  ++V+QIH T+P GD+LVFLTGQEEI+
Sbjct: 397  FFDKAPIFRIPGRRYPVDIFYTKAPEADYIDACVVSVLQIHATQPLGDILVFLTGQEEIE 456

Query: 2287 TSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLT 2466
               E+L +R+K +G  + EL+ILP+Y  LP++MQ +IF+P P   RKV++ATNIAETSLT
Sbjct: 457  ACQEMLQDRVKRLGSKLKELLILPIYANLPTDMQAKIFEPTPPNARKVILATNIAETSLT 516

Query: 2467 IDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERA 2646
            ID I YV+DPGF KQ  +N ++GM++L+V PIS+A+A QR+GRAGR  PGKC+RLYT  A
Sbjct: 517  IDNIIYVIDPGFAKQNNFNSRTGMETLLVVPISKASANQRAGRAGRVAPGKCFRLYTAWA 576

Query: 2647 FRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSAL 2826
            + +E+    VPEIQR NL + +L LK +GI++L+ FDF+D PP  ++I AL  L+ L AL
Sbjct: 577  YNNELEDNTVPEIQRINLGNAVLMLKTLGIHDLLHFDFLDPPPHQTLILALEQLYALGAL 636

Query: 2827 DGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQD 3003
            +  G LTKLGRRMAEFP++P ++K+L+ S    CSEE+++I AML+V   IFYRPK+K
Sbjct: 637  NHHGELTKLGRRMAEFPVDPMMAKMLLASEKYKCSEEIVSIAAMLSVNGAIFYRPKDKII 696

Query: 3004 HADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIM 3183
            HAD  +  F+   GDHL+L+ VYN W    +S  WC+ENFIQ RSMKRA+D+R+QL+G+M
Sbjct: 697  HADTARKNFNHRHGDHLSLMQVYNQWVESDYSTQWCYENFIQYRSMKRARDVREQLVGLM 756

Query: 3184 DRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQP 3363
             R ++ MVS   D + V+KAI +G+F + A+      Y+T+   Q+V IHP+SA F+  P
Sbjct: 757  QRVEIEMVSGESDTTNVRKAITAGYFYHVARLSKSGNYKTVKHNQDVMIHPNSALFEDLP 816

Query: 3364 EWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFK 3471
             W++YHELV TTKE+MR V  I+ KWL+E AP ++K
Sbjct: 817  RWLLYHELVFTTKEFMRSVIEIESKWLLEVAPHYYK 852


>gi|33146483|dbj|BAC79592.1| putative DEAH-box RNA helicase [Oryza
            sativa (japonica cultivar-group)]
          Length = 1280

 Score =  728 bits (1879), Expect = 0.0
 Identities = 385/815 (47%), Positives = 542/815 (66%), Gaps = 10/815 (1%)
 Frame = +1

Query: 1108 RWELRQMQGAGVLTATDMP-DFDEEMGVLRNYXXXXXXXXXXXXLVED-EPDFLRGYGKG 1281
            +WE RQ+  +G +  T++  +FD+E                   LV D +P FL G
Sbjct: 423  QWEDRQLLRSGAVRGTEVQTEFDDE------------DERKVILLVHDTKPPFLDGRVVF 470

Query: 1282 GAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILD-P 1458
              + EPV  +K+P   +A  A    AL +E +E K    + R    +   S    IL
Sbjct: 471  TKQAEPVMPLKDPTSDMAIVARKGSALVREIRE-KQSMNKSRQRFWELAGSKLGNILGVE 529

Query: 1459 MSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALK 1638
             +  Q  A +A          KE  ++ +H+    +A      + S+ +QR+ LPIF ++
Sbjct: 530  KTAEQVDADTATVGDQGEIDFKEEAKFSQHMKVKAEAVSDFAKSKSLSQQRQYLPIFTVR 589

Query: 1639 KNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVA 1818
             +L++ + +NQ++VVVGETGSGKTTQ+TQY  E G    G +GCTQPRRVAAMSVAKRV+
Sbjct: 590  DDLLQVVRENQVVVVVGETGSGKTTQLTQYLHEDGYTTTGIVGCTQPRRVAAMSVAKRVS 649

Query: 1819 EEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERT 1998
            EE   +LG  VGY IRFED TS +TIIKYMTDG+LLRE L D DL  Y +I++DEAHER+
Sbjct: 650  EEMETELGHKVGYAIRFEDMTSPNTIIKYMTDGVLLRETLKDADLDKYRVIVMDEAHERS 709

Query: 1999 IHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTRE 2178
            ++TDVLFG+LK    +R + KLI+TSATL++ KFS++F   P+F IPGRTFPV I++++
Sbjct: 710  LNTDVLFGILKKVVARRRDFKLIVTSATLNADKFSKFFGGVPVFHIPGRTFPVNIMFSKT 769

Query: 2179 PESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMK----SMGPDVPEL 2346
            P  DY+EAA    M IH+T  PGD+L+F+TGQEEI+ +C  L ER++    S    VP+L
Sbjct: 770  PCEDYVEAAVKQAMTIHITSGPGDILIFMTGQEEIEATCYALAERLEQLISSSTKTVPKL 829

Query: 2347 IILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNP 2526
             ILP+Y  LP+++Q +IF  A  G RK ++ATNIAETSLT+DGIFYV+D G+ K K+YNP
Sbjct: 830  SILPIYSQLPADLQAKIFQKAEEGTRKCIVATNIAETSLTVDGIFYVIDTGYGKMKVYNP 889

Query: 2527 KSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLAS 2706
            + GMD+L V P+S+AAA QR+GRAGRTGPG CYRL+TE A+++EMLP PVPEIQRTNL +
Sbjct: 890  RMGMDALQVFPVSRAAADQRAGRAGRTGPGTCYRLFTESAYQNEMLPNPVPEIQRTNLGN 949

Query: 2707 TLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEP 2886
             +L LK++ + NL+DFDFMD PP ++++ ++  L  L AL+  G LT +G +M EFPL+P
Sbjct: 950  VVLLLKSLKVENLLDFDFMDPPPQENILNSMYQLWVLGALNNVGALTVIGWKMVEFPLDP 1009

Query: 2887 SLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLA 3066
            +L+K+L+M   L C +EVLTIV+ML+V ++F+RPK++ + +D  + KF  PE DHLTLL
Sbjct: 1010 TLAKMLLMGEQLECLDEVLTIVSMLSVPSVFFRPKDRAEESDAAREKFFVPESDHLTLLN 1069

Query: 3067 VYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAI 3246
            VY  WK++ +   WC ++F+ V+ +++A+++R QLL I+   K+ + SC  +   V+KAI
Sbjct: 1070 VYLQWKSNQYRGDWCNDHFLHVKGLRKAREVRSQLLDILKTLKIPLTSCHMEWDVVRKAI 1129

Query: 3247 CSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF--QQQPEWVVYHELVMTTKEYMREV 3420
            CS +F NAA+      Y    +G   ++HPSSA +     P++VVYHELV+TTKEYM+ V
Sbjct: 1130 CSAYFHNAARLKGVGEYVNCRNGMPCHLHPSSALYGLGYTPDYVVYHELVLTTKEYMQCV 1189

Query: 3421 TAIDPKWLVEFAPSFFKIGDS-TKLSTFKRNQKID 3522
            TA+DP+WL E  P FF + ++ T L   K+ QK D
Sbjct: 1190 TAVDPQWLAELGPMFFSVKETDTSLLDHKKRQKED 1224


>gi|39590709|emb|CAE65079.1| Hypothetical protein CBG09937
            [Caenorhabditis briggsae]
          Length = 965

 Score =  727 bits (1876), Expect = 0.0
 Identities = 361/717 (50%), Positives = 507/717 (70%), Gaps = 9/717 (1%)
 Frame = +1

Query: 1399 RERDMDTQKGFS------SNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAG 1560
            R R+M+ +K         + +++ + M   +    +A+   D +   KE  ++  H+
Sbjct: 197  RRREMEDRKKAQDKHWELAGSKLGNLMGVKEKPDETANPEDDDSGNYKESHQFASHMK-D 255

Query: 1561 GKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEA 1740
             +A        ++ +QRE LP+FA ++ +M  + +N ++++VGETGSGKTTQ+ QY +E
Sbjct: 256  NEAVSDFAMEKTIKQQREYLPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLED 315

Query: 1741 GLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGM 1920
            G G  G IGCTQPRRVAAMSVA+RVA+E G +LG DVGY IRFEDCTS+ TIIKYMTDG+
Sbjct: 316  GFGEAGLIGCTQPRRVAAMSVARRVADEMGVELGQDVGYAIRFEDCTSEKTIIKYMTDGI 375

Query: 1921 LLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKF 2100
            LLRECL D  L  YS I++DEAHER+++TDVLFGLL+    KR +LKLI+TSAT+D+ KF
Sbjct: 376  LLRECLGDGTLDQYSAIIMDEAHERSLNTDVLFGLLREVVAKRSDLKLIVTSATMDADKF 435

Query: 2101 SEYFL-EAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQE 2277
            +++F    P FTIPGRTFPVE+ + R P  DY++AA    + IHL    GD+L+F+ GQE
Sbjct: 436  ADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVTIHLGAMDGDILIFMPGQE 495

Query: 2278 EIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAET 2457
            +I+ +CE++ E++  +  + P L +LP+Y  LPS++Q +IF  AP G RK ++ATNIAET
Sbjct: 496  DIECTCEMIKEKLGELD-EAPPLAVLPIYSQLPSDLQAKIFQRAPGGMRKAIVATNIAET 554

Query: 2458 SLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYT 2637
            SLT+DGI +V+DPGF K K+YNP+ GMD+L + P+SQA+A QR+GRAGRTGPG+CYRLYT
Sbjct: 555  SLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYT 614

Query: 2638 ERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTL 2817
            ER F+DE+L + VPEIQRTNLA+ +L LK++ +++L+ F FMDAPP D+M+ ++  L TL
Sbjct: 615  ERQFKDELLRSTVPEIQRTNLANVVLLLKSLNVDDLLKFHFMDAPPQDNMLNSMYQLWTL 674

Query: 2818 SALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEK 2997
             ALD  G LT +GR+M EFPL+P+LSK+LI+S ++GCS+EVLTIV+ML+V  IF+RPK +
Sbjct: 675  GALDNTGQLTPMGRKMVEFPLDPTLSKMLIVSAEMGCSDEVLTIVSMLSVPAIFFRPKGR 734

Query: 2998 QDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLG 3177
            ++ AD KK KF  PE DHLT L VY  W+ H +S  WC +N++ V+++K+ +++R QL
Sbjct: 735  EEEADAKKEKFQVPESDHLTFLNVYLQWREHKYSAKWCADNYLHVKALKKVREVRAQLKE 794

Query: 3178 IMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ 3357
            IM   KL +VS G +   V+K ICS +F NAA+      Y  +  G   ++HP+SA F
Sbjct: 795  IMQDLKLPIVSNGNEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALFGM 854

Query: 3358 --QPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKID 3522
               P++VVYHEL+MT KEYM+ VTA+D  WL E  P F+ I +S +    +R QK++
Sbjct: 855  GFMPDYVVYHELIMTAKEYMQCVTAVDAIWLAELGPMFYSIKESKQ---SRREQKME 908


>gi|31220358|ref|XP_316912.1| ENSANGP00000011076 [Anopheles gambiae]
 gi|21300030|gb|EAA12175.1| ENSANGP00000011076 [Anopheles gambiae str.
            PEST]
          Length = 1183

 Score =  723 bits (1865), Expect = 0.0
 Identities = 387/812 (47%), Positives = 533/812 (64%), Gaps = 6/812 (0%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDM-PDFDEEMGVLRNYXXXXXXXXXXXXLVEDEPDFLRGYGKG 1281
            E WE  ++  +GV+ + ++  DFDEE                   +    P FL G
Sbjct: 341  ELWEKNRLLTSGVVMSVNVNEDFDEE-----------ALERVHLLVHHTVPPFLDGRIVF 389

Query: 1282 GAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDPM 1461
              + EPV  V+ P   +A  A    AL +  +E K + +R +    Q G +    I+
Sbjct: 390  TKQPEPVVPVREPTSDMAINARKGSALVRTYRELK-ERKRAQAKHWQLGGTKLGNIMGVA 448

Query: 1462 SGN--QSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFAL 1635
                 Q  A   DE+ D     K    +  H+  G K  +  R   ++ +QR SLP+FA+
Sbjct: 449  KDKDEQDPADGDDEAYDSRKDQK----YADHI-GGEKGEFAPRRK-TIQQQRRSLPVFAV 502

Query: 1636 KKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRV 1815
            +++L+  + +N I+++VGETGSGKTTQ+TQY  E G  R G IGCTQPRRVAAMSVAKRV
Sbjct: 503  RQDLLNIIRENSIIIIVGETGSGKTTQLTQYLHEDGYSRHGMIGCTQPRRVAAMSVAKRV 562

Query: 1816 AEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHER 1995
            ++E  C LG +VGY IRFEDCTS+ T+IKYMTDG+LLRE L D +L GYS+I++DEAHER
Sbjct: 563  SDEMDCSLGQEVGYAIRFEDCTSEKTVIKYMTDGILLRESLRDKELDGYSVIIMDEAHER 622

Query: 1996 TIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTR 2175
            ++ TDVLFGLL+    KR +LKLI+TSAT+D+ KFS +F   P FTIPGRTFPV++ Y +
Sbjct: 623  SLSTDVLFGLLREIVAKRRDLKLIVTSATMDAGKFSNFFGNVPTFTIPGRTFPVDVFYGK 682

Query: 2176 EPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIIL 2355
                DY++ A   V+QIHL    GD+LVF+ GQE+I+ +CEVL ER+  +  + PEL IL
Sbjct: 683  NVCEDYVDGAVKQVLQIHLQPTEGDILVFMPGQEDIEVTCEVLAERLGEID-NAPELSIL 741

Query: 2356 PVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSG 2535
            P+Y  LPS++Q +IF  +  G RK V+ATNIAETSLT+DGI YV+D G+ K K+YNP+ G
Sbjct: 742  PIYSQLPSDLQAKIFHRSADGTRKCVVATNIAETSLTVDGITYVIDSGYCKLKVYNPRIG 801

Query: 2536 MDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLL 2715
            MD+L + PISQA A QRSGRAGRTGPG+ +RLYTER ++DE+L   VPEIQRTNLA+T+L
Sbjct: 802  MDALQIYPISQANANQRSGRAGRTGPGQAFRLYTERQYKDELLHLTVPEIQRTNLANTVL 861

Query: 2716 QLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLS 2895
             LK++G+++L+ F FMD PP D+++ +L  L  L ALD  G LT LGR+MAEFPL+P
Sbjct: 862  LLKSLGVSDLLQFHFMDPPPQDNILNSLYQLWILGALDHTGALTPLGRQMAEFPLDPPQC 921

Query: 2896 KLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYN 3075
            ++LI++ ++GCSEE+L IV+ML+V +IFYRPK +++ AD  + KF  PE DHLT L VY
Sbjct: 922  QMLIVANEMGCSEEILIIVSMLSVPSIFYRPKGREEEADSVREKFQVPESDHLTYLNVYQ 981

Query: 3076 SWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGI-MDRHKLLMVSCGRDVSRVQKAICS 3252
             WK + +S  WC E+FI V++M++ +++R+QL  I   + +L + SCG D   V+K ICS
Sbjct: 982  QWKMNKYSGSWCNEHFIHVKAMRKVREVRQQLKDIYSQQQRLTLKSCGTDWDVVRKCICS 1041

Query: 3253 GFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF--QQQPEWVVYHELVMTTKEYMREVTA 3426
             +F  AA+      Y  L  G   ++HP+SA +     P++VVYHEL+MT KEYM+  TA
Sbjct: 1042 AYFYQAARLKGIGEYVNLRTGMPCHLHPTSALYGLGTTPDYVVYHELIMTAKEYMQCATA 1101

Query: 3427 IDPKWLVEFAPSFFKIGDSTKLSTFKRNQKID 3522
            +D  WL E  P FF + ++ K    KR Q ++
Sbjct: 1102 VDGYWLAELGPMFFSVKETGKSGRDKRRQAVE 1133


>gi|49093416|ref|XP_408169.1| hypothetical protein AN4032.2
            [Aspergillus nidulans FGSC A4]
 gi|40740313|gb|EAA59503.1| hypothetical protein AN4032.2 [Aspergillus
            nidulans FGSC A4]
          Length = 924

 Score =  721 bits (1861), Expect = 0.0
 Identities = 377/795 (47%), Positives = 536/795 (67%), Gaps = 5/795 (0%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVED-EPDFLRGYGKG 1281
            + WE  +M  +GV       DFD +      +            LV D  P FL G
Sbjct: 29   DNWETNRMLTSGV---AQRRDFDGD------FLPEDEEGTRVHLLVHDLRPPFLDGRTIF 79

Query: 1282 GAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFS-SNARILDP 1458
              ++EPV  V++P   +A  +     + ++R++ + + ++ ++  T  G +  N   +
Sbjct: 80   TKQLEPVSAVRDPQSDMAVFSRKGSRVVRDRRQQRERQKQAQEATTVAGTALGNLMGVKE 139

Query: 1459 MSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALK 1638
              G+ + A   +E     NK       +K    GG++++ +   L   EQRE LP FA++
Sbjct: 140  DEGDTAVAMPVEEVYKGGNKFAHH---MKKQDEGGQSSFSKSKTLR--EQREFLPAFAVR 194

Query: 1639 KNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVA 1818
            ++L+  + DNQ++VVVGETGSGKTTQ+TQ+  E G  + G IGCTQPRRVAAMSVAKRV+
Sbjct: 195  EDLLRVIRDNQVVVVVGETGSGKTTQLTQFLYEDGYAKFGMIGCTQPRRVAAMSVAKRVS 254

Query: 1819 EEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERT 1998
            EE    LG  VGY IRFEDCT  +T IKYMTDG+LLRE L+  DL  YS I++DEAHER
Sbjct: 255  EEMEVDLGDLVGYAIRFEDCTGPNTAIKYMTDGVLLRESLVQTDLDKYSCIIMDEAHERA 314

Query: 1999 IHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTRE 2178
            ++TDVL GLLK    +R +LKLI+TSAT+++ +FS +F  AP F IPGRTFPV++ ++R
Sbjct: 315  LNTDVLMGLLKKILARRRDLKLIVTSATMNAERFSRFFGGAPEFIIPGRTFPVDVHFSRT 374

Query: 2179 PESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILP 2358
            P  DY+++A   V+ IH+++ PGD+LVF+TGQE+I+ +CE++ ER+K +  D P+L ILP
Sbjct: 375  PCEDYVDSAVKQVLAIHVSQGPGDILVFMTGQEDIEATCELVDERLKLLN-DPPKLSILP 433

Query: 2359 VYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGM 2538
            +Y  +P+E Q +IF+ A  G RKV++ATNIAETSLT+DGI +VVD G+ K K+YNPK GM
Sbjct: 434  IYSQMPAEQQAKIFERAAPGVRKVIVATNIAETSLTVDGIMFVVDSGYSKLKVYNPKMGM 493

Query: 2539 DSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQ 2718
            D+L +TPISQA A QRSGRAGRTGPGK YRLYTE A+++EM    +PEIQRT+L++T+L
Sbjct: 494  DTLQITPISQANANQRSGRAGRTGPGKAYRLYTEVAYKNEMYLQTIPEIQRTSLSNTVLL 553

Query: 2719 LKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSK 2898
            LK++G+ +L+DFDFMD PP +++ T+L  L +L ALD  G LT LGR+M  FP++P L+K
Sbjct: 554  LKSLGVKDLLDFDFMDPPPQETISTSLFELWSLGALDNLGDLTHLGRQMTPFPMDPPLAK 613

Query: 2899 LLIMSVD-LGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYN 3075
            L+I + +  GCSEE+LTIV+ML+V N+FYRPKE+Q+ +D  + KF  PE DHLTLL VY
Sbjct: 614  LIITAAEQYGCSEEMLTIVSMLSVPNVFYRPKERQEESDAAREKFFVPESDHLTLLHVYT 673

Query: 3076 SWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSG 3255
             WK++ +S  WC ++F+  ++++RA+++R QL  IM   KL ++SCG D   ++K ICSG
Sbjct: 674  QWKSNGYSDHWCTKHFLHAKTLRRAKEVRDQLNDIMVMQKLPLISCGTDWDEIRKCICSG 733

Query: 3256 FFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF--QQQPEWVVYHELVMTTKEYMREVTAI 3429
            F+  AA+      +  L    ++ +HP+SA +     PE+VVYHEL++T+KEYM  VTA+
Sbjct: 734  FYHQAARVKGIGEFINLRTSVSMALHPTSALYGLGYVPEYVVYHELILTSKEYMSTVTAV 793

Query: 3430 DPKWLVEFAPSFFKI 3474
            DP WL E    F+ +
Sbjct: 794  DPHWLAELGGVFYSV 808


>gi|50550331|ref|XP_502638.1| hypothetical protein [Yarrowia
            lipolytica]
 gi|49648506|emb|CAG80826.1| unnamed protein product [Yarrowia
            lipolytica CLIB99]
          Length = 1035

 Score =  721 bits (1861), Expect = 0.0
 Identities = 361/706 (51%), Positives = 497/706 (70%), Gaps = 8/706 (1%)
 Frame = +1

Query: 1399 RERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPE--WLKHVTAGGKAT 1572
            RE+  +  K       + DP    Q+  ++AD  +D+ +K K   E   LK +    K
Sbjct: 326  REKTHEKDKEEDKYEFVFDP---RQAIKFTADTDEDKGSKSKSEAEKAMLKQIEDAKKHA 382

Query: 1573 YGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGR 1752
                   S+ E R+SLP++  +  ++ A+ D+Q+LV+VGETGSGKTTQ+ QY  EAG  +
Sbjct: 383  K------SIDEVRKSLPVYKYRDEILGAIKDHQVLVIVGETGSGKTTQLPQYLHEAGYTQ 436

Query: 1753 RGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRE 1932
            RG +GCTQPRRVAAM+VA RVAEE GC++G  VGY IRFED TS+ T+IKYMTDGMLLRE
Sbjct: 437  RGMVGCTQPRRVAAMAVATRVAEEVGCRIGQQVGYNIRFEDKTSEKTVIKYMTDGMLLRE 496

Query: 1933 CLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYF 2112
             L DP+LSGYS +M+DEAHERT+HTDV+ GLLK  AR RPELKLII+SAT+++ KFS YF
Sbjct: 497  FLTDPELSGYSALMIDEAHERTLHTDVVLGLLKDIARARPELKLIISSATMNAKKFSAYF 556

Query: 2113 LEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTS 2292
             + PIF +PGR FPV + +T +PE++YL AA  TVMQIH T+  GD+LVFLTGQ+EI+
Sbjct: 557  NDCPIFQVPGRRFPVAVHHTEKPEANYLHAAITTVMQIHATQGKGDILVFLTGQDEIENM 616

Query: 2293 CEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTID 2472
             E L E ++ +G   P +I+ P+Y  LP+E+Q RIFDP P G RKVV+ATNIAETS+TID
Sbjct: 617  AENLQETIRKLGSKCPPMIVCPIYANLPAELQARIFDPTPEGSRKVVLATNIAETSITID 676

Query: 2473 GIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFR 2652
            GI YV+DPGFVK+ ++NPK+GM+SL+VTP SQA+++QR GRAGR GPG C+RLYT+RAF
Sbjct: 677  GIVYVIDPGFVKENVFNPKTGMESLIVTPCSQASSEQRRGRAGRVGPGMCFRLYTKRAFE 736

Query: 2653 DEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDG 2832
             E+ P   PEI R+NL   +L L ++GI N++ F+FMD PP D++I AL  L+ L A++
Sbjct: 737  SELPPNTTPEILRSNLCGVVLMLMSLGIVNILSFEFMDPPPKDTLIKALELLYALGAIND 796

Query: 2833 DGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAML-NVQNIFYRPKEKQDHA 3009
             G  TK+GR+MAEFP +P L++ ++ S    C+ EVL+IV+ML    ++F+RPK+K+  A
Sbjct: 797  KGQPTKIGRQMAEFPTDPMLARAILASEKYQCTSEVLSIVSMLGEAASLFFRPKDKKMAA 856

Query: 3010 DQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDR 3189
            D+ +  F +P GDHLTLL V+  W    +SQ W  +NF+Q +S+ RA+D+R QL  + DR
Sbjct: 857  DRAREMFTKPGGDHLTLLEVFRQWSLADYSQQWAKDNFMQYKSLTRARDVRDQLYNLCDR 916

Query: 3190 HKLLMVSCGRDV----SRVQKAICSGFFRNAAKRD-PQEGYRTLTDGQNVYIHPSSACFQ 3354
             ++       ++    + +QKA+ +GFF NAA+ +   + Y+T+   Q VYIHPSS
Sbjct: 917  VEIDPEVSAAELEDPQTAIQKALTAGFFPNAARLNRGGDSYKTVKSNQTVYIHPSSVLHL 976

Query: 3355 QQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKL 3492
            Q+P+W++YHELV+T+KEYMR    ++P+WL E AP F+K  D  ++
Sbjct: 977  QRPKWLLYHELVLTSKEYMRNCMPLEPQWLTEVAPHFYKEADIERM 1022


>gi|15239967|ref|NP_196805.1| RNA helicase, putative [Arabidopsis
            thaliana]
 gi|11358630|pir||T49915 pre-mRNA splicing factor ATP-dependent RNA
            helicase-like protein - Arabidopsis thaliana
 gi|7630057|emb|CAB88265.1| pre-mRNA splicing factor ATP-dependent RNA
            helicase-like protein [Arabidopsis thaliana]
          Length = 1226

 Score =  721 bits (1860), Expect = 0.0
 Identities = 384/813 (47%), Positives = 537/813 (65%), Gaps = 10/813 (1%)
 Frame = +1

Query: 1108 RWELRQMQGAGVLTATDMP-DFDEEMGVLRNYXXXXXXXXXXXXLVED-EPDFLRGYGKG 1281
            +WE RQ+  +G +  T++  +FD E                   LV D +P FL G
Sbjct: 374  QWEDRQLLRSGAVRGTEVQTEFDSE------------EERKAILLVHDTKPPFLDGRVVY 421

Query: 1282 GAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILD-P 1458
              + EPV  VK+P   +A  +     L KE +E K  A + R    +   S+   IL
Sbjct: 422  TKQAEPVMPVKDPTSDMAIISRKGSGLVKEIRE-KQSANKSRQRFWELAGSNLGNILGIE 480

Query: 1459 MSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALK 1638
             S  Q  A +A    D     K   ++ +H+  G +A      + +M EQR+ LPIF+++
Sbjct: 481  KSAEQIDADTAVVGDDGEVDFKGEAKFAQHMKKG-EAVSEFAMSKTMAEQRQYLPIFSVR 539

Query: 1639 KNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVA 1818
              L++ + +NQ++VVVGETGSGKTTQ+TQ     G    G +GCTQPRRVAAMSVAKRV+
Sbjct: 540  DELLQVIRENQVIVVVGETGSGKTTQLTQ----DGYTINGIVGCTQPRRVAAMSVAKRVS 595

Query: 1819 EEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERT 1998
            EE   +LG  +GY IRFED T  +T+IKYMTDG+LLRE L D DL  Y ++++DEAHER+
Sbjct: 596  EEMETELGDKIGYAIRFEDVTGPNTVIKYMTDGVLLRETLKDSDLDKYRVVVMDEAHERS 655

Query: 1999 IHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTRE 2178
            ++TDVLFG+LK    +R + KLI+TSATL++ KFS +F   PIF IPGRTFPV ILY++
Sbjct: 656  LNTDVLFGILKKVVARRRDFKLIVTSATLNAQKFSNFFGSVPIFNIPGRTFPVNILYSKT 715

Query: 2179 PESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMK----SMGPDVPEL 2346
            P  DY+EAA    M IH+T PPGD+L+F+TGQ+EI+ +C  L ERM+    S   ++  L
Sbjct: 716  PCEDYVEAAVKQAMTIHITSPPGDILIFMTGQDEIEAACFSLKERMEQLVSSSSREITNL 775

Query: 2347 IILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNP 2526
            +ILP+Y  LP+++Q +IF     G RK ++ATNIAETSLT+DGI+YV+D G+ K K++NP
Sbjct: 776  LILPIYSQLPADLQAKIFQKPEDGARKCIVATNIAETSLTVDGIYYVIDTGYGKMKVFNP 835

Query: 2527 KSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLAS 2706
            + GMD+L V PIS+AA+ QR+GRAGRTGPG CYRLYTE A+ +EMLP+PVPEIQRTNL +
Sbjct: 836  RMGMDALQVFPISRAASDQRAGRAGRTGPGTCYRLYTESAYLNEMLPSPVPEIQRTNLGN 895

Query: 2707 TLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEP 2886
             +L LK++ I+NL+DFDFMD PP ++++ ++  L  L AL+  G LT LG +M EFPL+P
Sbjct: 896  VVLLLKSLKIDNLLDFDFMDPPPQENILNSMYQLWVLGALNNVGGLTDLGWKMVEFPLDP 955

Query: 2887 SLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLA 3066
             L+K+L+M   L C +EVLTIV+ML+V ++F+RPKE+ + +D  + KF  PE DHLTLL
Sbjct: 956  PLAKMLLMGERLDCIDEVLTIVSMLSVPSVFFRPKERAEESDAAREKFFVPESDHLTLLN 1015

Query: 3067 VYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAI 3246
            VY  WK H +   WC ++++QV+ +++A+++R QLL I+ + K+ + SCG D   V+KAI
Sbjct: 1016 VYQQWKEHDYRGDWCNDHYLQVKGLRKAREVRSQLLDILKQLKIELRSCGPDWDIVRKAI 1075

Query: 3247 CSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF--QQQPEWVVYHELVMTTKEYMREV 3420
            CS +F N+A+      Y     G   ++HPSSA +     P++VVYHEL++TTKEYM+
Sbjct: 1076 CSAYFHNSARLKGVGEYVNCRTGMPCHLHPSSALYGLGYTPDYVVYHELILTTKEYMQCA 1135

Query: 3421 TAIDPKWLVEFAPSFFKIGDS-TKLSTFKRNQK 3516
            T+++P WL E  P FF + DS T +   K+ QK
Sbjct: 1136 TSVEPHWLAELGPMFFSVKDSDTSMLEHKKKQK 1168


>gi|50259106|gb|EAL21783.1| hypothetical protein CNBC4850
            [Cryptococcus neoformans var. neoformans B-3501A]
          Length = 1075

 Score =  720 bits (1859), Expect = 0.0
 Identities = 357/652 (54%), Positives = 489/652 (74%), Gaps = 8/652 (1%)
 Frame = +1

Query: 1594 SMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGC 1770
            S+ E R SLPI+  +  L+EA+ ++Q+LVVV ETGSGKTTQ+ QY  EAG  + G K+GC
Sbjct: 416  SIQETRNSLPIYEFRDELLEAIAEHQVLVVVAETGSGKTTQLPQYLYEAGYCKNGMKVGC 475

Query: 1771 TQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPD 1950
            TQPRRVAAMSVA RVAEE G +LG +VGY+IRFED TS  T +KYMTDGMLLRE L DP+
Sbjct: 476  TQPRRVAAMSVAARVAEEMGVRLGQEVGYSIRFEDMTSDKTALKYMTDGMLLREFLTDPE 535

Query: 1951 LSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIF 2130
            LS YS +++DEAHERT+ TD+LFGL+K  AR RP+L+L+I+SATL++ KF+++F +APIF
Sbjct: 536  LSTYSALVIDEAHERTLSTDILFGLVKDIARFRPDLRLLISSATLNAQKFADFFDQAPIF 595

Query: 2131 TIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYE 2310
             +PGR FPV++ YT++PE++Y+ AA  T++QIH T+P GD+L+FLTGQ+EI+ + E L E
Sbjct: 596  DVPGRRFPVDMFYTQQPEANYMHAAVTTILQIHTTQPKGDILLFLTGQDEIEAAEESLKE 655

Query: 2311 RMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVV 2490
             M ++G  VPELII P+Y  LPSEMQ++IF+P P G RKVV+ATNIAETS+TIDG+ YV+
Sbjct: 656  TMYALGDKVPELIIAPIYANLPSEMQSKIFEPTPEGARKVVLATNIAETSITIDGVVYVI 715

Query: 2491 DPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPT 2670
            DPGFVKQ  YNPK+GM SLVV PIS+A+A+QR+GRAGR GPGK +RLYT+ AF++E+L
Sbjct: 716  DPGFVKQNNYNPKTGMSSLVVEPISRASAQQRAGRAGRVGPGKAFRLYTKWAFKNELLQD 775

Query: 2671 PVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTK 2850
             +PEIQRTNL+  +L LK++GIN++++FDF+D PP D++I +   L+ L AL+  G LT+
Sbjct: 776  TIPEIQRTNLSMVVLMLKSLGINDVLNFDFLDKPPADTIIRSFELLYALGALNHKGELTR 835

Query: 2851 LGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQ-NIFYRPKEKQDHADQKKAK 3027
            LGRRMAEFP++P LSK +I S +  C+ EVLTI++ML    ++ YRPK+K+ HAD+
Sbjct: 836  LGRRMAEFPVDPMLSKAIINSENYKCTHEVLTIISMLQESGSLLYRPKDKRVHADKAHKN 895

Query: 3028 FHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMV 3207
            F +  GDH TLL ++  W   ++SQ +C+ENF+Q +S+ R +DIR QL  + DR ++++
Sbjct: 896  FIKSGGDHFTLLNIFEQWAESNYSQQFCYENFVQFKSLCRVRDIRDQLAQLCDRVEVVIE 955

Query: 3208 SCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSAC--FQQQPEWVVYH 3381
            S   DV  VQKAI +G+F N A+ D   GYRT  +  +VY+HPSS     Q  P +++Y+
Sbjct: 956  STPNDVVPVQKAITAGYFYNTARIDRGGGYRTTKNNHSVYLHPSSCLIGMQPPPRFILYY 1015

Query: 3382 ELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKL----STFKRNQKIDP 3525
            ELV+T+KEYMR+   I+  WL E AP +F   +  +L    S  K  ++I+P
Sbjct: 1016 ELVLTSKEYMRQCMPIEGSWLSELAPHYFNKSEIDQLMGSASKVKMPKRIEP 1067


>gi|47230418|emb|CAF99611.1| unnamed protein product [Tetraodon
            nigroviridis]
          Length = 1359

 Score =  719 bits (1857), Expect = 0.0
 Identities = 377/804 (46%), Positives = 531/804 (65%), Gaps = 9/804 (1%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDMP-DFDEEMGVLRNYXXXXXXXXXXXXLVED-EPDFLRGYGK 1278
            ERWE  +M  +GV+   ++  DF+E+                   LV +  P FL G
Sbjct: 407  ERWETNRMLTSGVVQRLEVDEDFEED------------NAAKVHLLVHNLVPPFLDGRIV 454

Query: 1279 GGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDP 1458
               + EPV  VK+P   +A  +     L ++ +E     Q+ER     K +      L
Sbjct: 455  FTKQPEPVIPVKDPTSDMAIISRKGSQLVRKHRE-----QKERKKAQHKHWELAGTKLGD 509

Query: 1459 MSGNQS-----TAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLP 1623
            + G Q              +D     K   ++ +H+    +A        S++EQR+ LP
Sbjct: 510  IMGIQKKEEEDVCGGKPVGEDGKVDYKAEQKFAEHMKEKTEARSEFAKKKSLLEQRQYLP 569

Query: 1624 IFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSV 1803
            IFA+++ L+  + DN I++VVGETGSGKTTQ+TQY  E G    G +GCTQPRRVAAMSV
Sbjct: 570  IFAVRQQLLNIIRDNNIVIVVGETGSGKTTQLTQYLHEDGYTSYGMVGCTQPRRVAAMSV 629

Query: 1804 AKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDE 1983
            AKRV+EE G  LG +VGY IRFEDCTS+ T+IKYMTDG+LLRE L + DL  YS +++DE
Sbjct: 630  AKRVSEEIGTNLGDEVGYAIRFEDCTSEKTLIKYMTDGILLRESLRESDLDHYSAVIMDE 689

Query: 1984 AHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEI 2163
            AHER+++TDVLFGLL+    +R +LKLI+TSAT+DS KF+ +F   PIF IPGRTFPV++
Sbjct: 690  AHERSLNTDVLFGLLREVVSRRTDLKLIVTSATMDSDKFAAFFGNVPIFHIPGRTFPVDV 749

Query: 2164 LYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPE 2343
            L+++ P+ DY+EAA    +QIHL+   GD+L+F+ GQE+I+ + + + ER++ +  + P
Sbjct: 750  LFSKTPQEDYVEAAVKQALQIHLSGLIGDILIFMPGQEDIEVTSDQIVERLEEL-ENAPP 808

Query: 2344 LIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYN 2523
            L +LP+Y  LPS++Q +IF  AP G RK ++ATNIAETSLT+DGI YVVD G+ K K++N
Sbjct: 809  LAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMYVVDSGYCKLKVFN 868

Query: 2524 PKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLA 2703
            P+ GMD+L V PISQA A QRSGRAGRTGPG+CYRLYT+ A+++EML T +PEIQRTNLA
Sbjct: 869  PRIGMDALQVFPISQANANQRSGRAGRTGPGQCYRLYTQSAYKNEMLTTTIPEIQRTNLA 928

Query: 2704 STLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLE 2883
            + +L LK++G+ +L+ F FMD PP D+M+ ++  L  L ALD  G LT  GR M EFPL+
Sbjct: 929  NVVLLLKSLGVQDLLLFHFMDPPPEDNMLNSMYQLWILGALDNTGALTPTGRLMVEFPLD 988

Query: 2884 PSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLL 3063
            P+LSK+LI+S D+GCS ++L IV+ML+V  IFYRPK +++ +DQ + KF  PE DHLT L
Sbjct: 989  PALSKMLIVSCDMGCSADILIIVSMLSVPAIFYRPKGREEESDQVREKFSVPESDHLTYL 1048

Query: 3064 AVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKA 3243
             VY  WKN+++S  WC ++FI  ++M++ +++R QL  IM + K+ +VS G D   ++K
Sbjct: 1049 NVYMQWKNNNYSSIWCNDHFIHTKAMRKVREVRSQLKDIMVQQKMNLVSSGSDWDIIRKC 1108

Query: 3244 ICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTKEYMRE 3417
            IC+ +F  AAK      Y  +  G   ++HP+S+ F     P++++YHELVMTTKEYM+
Sbjct: 1109 ICAAYFHQAAKLKGIGEYVNVRTGMPCHLHPTSSLFGMGYTPDYIIYHELVMTTKEYMQC 1168

Query: 3418 VTAIDPKWLVEFAPSFFKIGDSTK 3489
            VTA+D +WL E  P F+ +  + K
Sbjct: 1169 VTAVDGEWLAELGPMFYSVKQAGK 1192


>gi|41053698|ref|NP_957170.1| hypothetical protein MGC63517 [Danio
            rerio]
 gi|39644987|gb|AAH63744.1| Hypothetical protein MGC63517 [Danio
            rerio]
          Length = 1258

 Score =  718 bits (1853), Expect = 0.0
 Identities = 373/800 (46%), Positives = 526/800 (65%), Gaps = 5/800 (0%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDEPDFLRGYGKGG 1284
            ERWE  +M  +GV+   ++ +  EE    R +                 P FL G
Sbjct: 404  ERWETNRMLTSGVVQRLEVDEDFEEDNAARVHLLVHNLV----------PPFLDGRIVFT 453

Query: 1285 AEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDPMS 1464
             + EPV  VK+    +A  +     L +  +E     Q+ER     K +      L  +
Sbjct: 454  KQPEPVIPVKDATSDMAIISRKGSQLVRRHRE-----QKERKKAQHKHWELAGTKLGDIM 508

Query: 1465 GNQSTAWSADES---KDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFAL 1635
            G Q      D     +D     +   ++  H+    +A+       +++EQR+ LPIFA+
Sbjct: 509  GIQKKEDGGDSKAVGEDGKVDYRAEQKFADHMKEKSEASSDFAKKKTLLEQRQYLPIFAV 568

Query: 1636 KKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRV 1815
            ++ L+  + DN I++VVGETGSGKTTQ+TQY  E G    G +GCTQPRRVAAMSVAKRV
Sbjct: 569  RQQLLNIIRDNNIVIVVGETGSGKTTQLTQYLHEDGYTSYGMVGCTQPRRVAAMSVAKRV 628

Query: 1816 AEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHER 1995
            +EE    LG +VGY IRFEDCTS+ T+IKYMTDG+LLRE L + DL  YS +++DEAHER
Sbjct: 629  SEEMNSNLGEEVGYAIRFEDCTSEKTMIKYMTDGILLRESLRESDLDHYSAVIMDEAHER 688

Query: 1996 TIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTR 2175
            +++TDVLFGLL+    +R +LKLI+TSAT+DS KF+ +F   PIF IPGRTFPV+IL+++
Sbjct: 689  SLNTDVLFGLLREVVSRRSDLKLIVTSATMDSDKFASFFGNVPIFHIPGRTFPVDILFSK 748

Query: 2176 EPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIIL 2355
             P+ DY+EAA    +QIHL+   GD+L+F+ GQE+I+ + + + ER+  +  + P L +L
Sbjct: 749  TPQEDYVEAAVKQALQIHLSGMVGDILIFMPGQEDIEVTSDQIVERLADL-ENAPALAVL 807

Query: 2356 PVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSG 2535
            P+Y  LPS++Q +IF  AP G RK ++ATNIAETSLT+DGI +VVD G+ K K++NP+ G
Sbjct: 808  PIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVVDSGYCKLKVFNPRIG 867

Query: 2536 MDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLL 2715
            MD+L V PISQA A QR+GRAGRTGPG+CYRLYT+ AF++EML T +PEIQRTNLA+ +L
Sbjct: 868  MDALQVYPISQANANQRAGRAGRTGPGQCYRLYTQSAFKNEMLTTTIPEIQRTNLANVVL 927

Query: 2716 QLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLS 2895
             LK++G+ +L+ F FMD PP D+M+ ++  L  L ALD  G LT  GR M EFPL+P+LS
Sbjct: 928  LLKSLGVQDLLLFHFMDPPPEDNMLNSMYQLWILGALDNTGALTPTGRLMVEFPLDPALS 987

Query: 2896 KLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYN 3075
            K+LI+S D+ CS ++L IV+ML+V +IFYRPK +++ +DQ + KF  PE DHLT L VY
Sbjct: 988  KMLIVSCDMSCSADILIIVSMLSVPSIFYRPKGREEESDQVREKFSVPESDHLTYLNVYL 1047

Query: 3076 SWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSG 3255
             WKN+++S  WC ++FI  ++M++ +++R QL  IM + K+ ++SCG D   ++K IC+
Sbjct: 1048 QWKNNNYSSIWCNDHFIHTKAMRKVREVRAQLKDIMVQQKMNLISCGSDWDVIRKCICAA 1107

Query: 3256 FFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTKEYMREVTAI 3429
            +F  AAK      Y  +  G   ++HP+SA F     P++++YHELVMTTKEYM+ VTA+
Sbjct: 1108 YFHQAAKLKGIGEYVNVRTGMPCHLHPTSALFGMGYTPDYIIYHELVMTTKEYMQCVTAV 1167

Query: 3430 DPKWLVEFAPSFFKIGDSTK 3489
            D +WL E  P F+ I  + K
Sbjct: 1168 DGEWLAELGPMFYSIKHAGK 1187


>gi|15235842|ref|NP_193401.1| RNA helicase, putative [Arabidopsis
            thaliana]
 gi|7446041|pir||A71434 probable RNA helicase - Arabidopsis thaliana
 gi|2245023|emb|CAB10443.1| RNA helicase [Arabidopsis thaliana]
 gi|7268418|emb|CAB78710.1| RNA helicase [Arabidopsis thaliana]
          Length = 883

 Score =  718 bits (1853), Expect = 0.0
 Identities = 364/681 (53%), Positives = 488/681 (71%), Gaps = 5/681 (0%)
 Frame = +1

Query: 1552 TAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYA 1731
            T   +  Y +       E RE LPI   ++ L++ + +NQ+LV+VGETGSGKTTQ+ QY
Sbjct: 200  TGKHRGCYSKTAAEKAREGREFLPIHGYREELLKLIEENQVLVIVGETGSGKTTQIPQYL 259

Query: 1732 IEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMT 1911
             EAG  +RGKIGCTQPRRVAAMSVA RVA+E G KLG +VGY+IRFEDCTS+ T+IKYMT
Sbjct: 260  QEAGYTKRGKIGCTQPRRVAAMSVASRVAQEVGVKLGHEVGYSIRFEDCTSEKTVIKYMT 319

Query: 1912 DGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDS 2091
            DGMLLRE LI+P L  YS+I++DEAHERT+ TD+LF L+K  A+ RP+L+LII+SATL++
Sbjct: 320  DGMLLRELLIEPKLDSYSVIIIDEAHERTLSTDILFALVKDVAKVRPDLRLIISSATLEA 379

Query: 2092 VKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTG 2271
             KFSEYF  A I+ IPGR +PVE L+ + PE DYLE    TV+QIH TE  GD+LVFLTG
Sbjct: 380  KKFSEYFDSARIYLIPGRRYPVEKLFRKCPEPDYLETVIRTVVQIHQTEAIGDILVFLTG 439

Query: 2272 QEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIA 2451
            QEEI+T    L  RM  +G    E+II P+Y  LP+ +Q ++F+PAP G RKVV+ATNIA
Sbjct: 440  QEEIETVETNLKRRMMDLGTKGSEIIICPIYSNLPTPLQAKVFEPAPKGTRKVVLATNIA 499

Query: 2452 ETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRL 2631
            ETSLTIDG+ YV+DPG+ K   YNP++GM+SL+VTPIS+A+A QR+GR+GRTGPGKC+RL
Sbjct: 500  ETSLTIDGVKYVIDPGYCKINSYNPRTGMESLLVTPISKASAAQRAGRSGRTGPGKCFRL 559

Query: 2632 YTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLH 2811
            Y  +    ++ PT +PEIQR NLAS +L LK++GI ++ +FDFMD PP ++++ AL  L+
Sbjct: 560  YNIK----DLEPTTIPEIQRANLASVVLTLKSLGIQDVFNFDFMDPPPENALLKALELLY 615

Query: 2812 TLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRP 2988
             L ALD  G +TK+G RM EFP++P LSK+++ S    CS+E++TI AML+V N +FYRP
Sbjct: 616  ALGALDEIGEITKVGERMVEFPVDPMLSKMIVGSEKYKCSKEIITIAAMLSVGNSVFYRP 675

Query: 2989 KEKQDHADQKKAKFHQPE---GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDI 3159
            K +Q  AD+ +  F++     GDH+ LL VYNSWK  ++S  WC E FIQ +SMKRA+DI
Sbjct: 676  KNQQVFADKARMDFYEDTENVGDHIALLRVYNSWKEENYSTQWCCEKFIQSKSMKRARDI 735

Query: 3160 RKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPS 3339
            R QLLG++++  + + S   D+  ++KAI +GFF ++AK      YR + + Q VY+HP+
Sbjct: 736  RDQLLGLLNKIGVELTSNPNDLDAIKKAILAGFFPHSAKLQKNGSYRRVKEPQTVYVHPN 795

Query: 3340 SACFQQQP-EWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQK 3516
            S  F   P +W+VYHELV+TTKEYMR  T + P+WL+E AP ++K+ D       K  ++
Sbjct: 796  SGLFGASPSKWLVYHELVLTTKEYMRHTTEMKPEWLIEIAPHYYKLKDIEDTRPKKTQRR 855

Query: 3517 IDPLFDKYADANAWRITRVKK 3579
            I+       D N  + TR  K
Sbjct: 856  IEEASTSKVDTN--KKTRTSK 874


>gi|3024898|sp|Q92620|PR16_HUMAN Pre-mRNA splicing factor
            ATP-dependent RNA helicase PRP16 (ATP-dependent RNA
            helicase DHX38) (DEAH-box protein 38)
 gi|3123906|gb|AAC39729.1| pre-mRNA splicing factor [Homo sapiens]
          Length = 1227

 Score =  716 bits (1848), Expect = 0.0
 Identities = 371/798 (46%), Positives = 530/798 (65%), Gaps = 3/798 (0%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDEPDFLRGYGKGG 1284
            ERWE  +M  +GV+   ++ +  EE    + +                 P FL G
Sbjct: 375  ERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLV----------PPFLDGRIVFT 424

Query: 1285 AEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFS-SNARILDPM 1461
             + EPV  VK+    LA  A       ++ +E     Q+ER     K +  +  ++ D M
Sbjct: 425  KQPEPVIPVKDATSDLAIIARKGSQTVRKHRE-----QKERKKAQHKHWELAGTKLGDIM 479

Query: 1462 SGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKK 1641
               +        ++D     +   ++  H+    +A+       S++EQR+ LPIFA+++
Sbjct: 480  GVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSILEQRQYLPIFAVQQ 539

Query: 1642 NLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAE 1821
             L+  + DN I++VVGETGSGKTTQ+TQY  E G    G IGCTQPRRVAAMSVAKRV+E
Sbjct: 540  ELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSE 599

Query: 1822 EYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTI 2001
            E G  LG +VGY IRFEDCTS++T+IKYMTDG+LLRE L + DL  YS I++DEAHER++
Sbjct: 600  EMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAIIMDEAHERSL 659

Query: 2002 HTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREP 2181
            +TDVLFGLL+    +R +LKLI+TSAT+D+ KF+ +F   PIF IPGRTFPV+IL+++ P
Sbjct: 660  NTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTP 719

Query: 2182 ESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPV 2361
            + DY+EAA    +Q+HL+  PGD+L+F+ GQE+I+ + + + E ++ +  + P L +LP+
Sbjct: 720  QEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEEL-ENAPALAVLPI 778

Query: 2362 YGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMD 2541
            Y  LPS++Q +IF  AP G RK ++ATNIAETSLT+DGI +V+D G+ K K++NP+ GMD
Sbjct: 779  YSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMD 838

Query: 2542 SLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQL 2721
            +L + PISQA A QRSGRAGRTGPG+C+RLYT+ A+++E+L T VPEIQRTNLA+ +L L
Sbjct: 839  ALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLL 898

Query: 2722 KAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKL 2901
            K++G+ +L+ F FMD PP D+M+ ++  L  L ALD  G LT  GR M EFPL+P+LSK+
Sbjct: 899  KSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKM 958

Query: 2902 LIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSW 3081
            LI+S D+GCS E+L IV+ML+V  IFYRPK +++ +DQ + KF  PE DHLT L VY  W
Sbjct: 959  LIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQW 1018

Query: 3082 KNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFF 3261
            KN+++S  WC ++FI  ++M++ +++R QL  IM + ++ + SCG D   V+K IC+ +F
Sbjct: 1019 KNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYF 1078

Query: 3262 RNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTKEYMREVTAIDP 3435
              AAK      Y  +  G   ++HP+S+ F     P+++VYHELVMTTKEYM+ VTA+D
Sbjct: 1079 HQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDG 1138

Query: 3436 KWLVEFAPSFFKIGDSTK 3489
            +WL E  P F+ +  + K
Sbjct: 1139 EWLAELGPMFYSVKQAGK 1156


>gi|17999539|ref|NP_054722.2| DEAH (Asp-Glu-Ala-His) box polypeptide
            38; pre-mRNA splicing factor ATP-dependent RNA helicase
            PRP16; PRP16 homolog of S.cerevisiae; DEAD/H
            (Asp-Glu-Ala-Asp/His) box polypeptide 38 [Homo sapiens]
 gi|3337389|gb|AAC27431.1| pre-mRNA splicing factor (PRP16)(KIAA0224)
            [Homo sapiens]
 gi|13278975|gb|AAH04235.1| DEAH (Asp-Glu-Ala-His) box polypeptide 38
            [Homo sapiens]
 gi|14249919|gb|AAH08340.1| DEAH (Asp-Glu-Ala-His) box polypeptide 38
            [Homo sapiens]
          Length = 1227

 Score =  716 bits (1848), Expect = 0.0
 Identities = 371/798 (46%), Positives = 530/798 (65%), Gaps = 3/798 (0%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDEPDFLRGYGKGG 1284
            ERWE  +M  +GV+   ++ +  EE    + +                 P FL G
Sbjct: 375  ERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLV----------PPFLDGRIVFT 424

Query: 1285 AEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFS-SNARILDPM 1461
             + EPV  VK+    LA  A       ++ +E     Q+ER     K +  +  ++ D M
Sbjct: 425  KQPEPVIPVKDATSDLAIIARKGSQTVRKHRE-----QKERKKAQHKHWELAGTKLGDIM 479

Query: 1462 SGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKK 1641
               +        ++D     +   ++  H+    +A+       S++EQR+ LPIFA+++
Sbjct: 480  GVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSILEQRQYLPIFAVQQ 539

Query: 1642 NLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAE 1821
             L+  + DN I++VVGETGSGKTTQ+TQY  E G    G IGCTQPRRVAAMSVAKRV+E
Sbjct: 540  ELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSE 599

Query: 1822 EYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTI 2001
            E G  LG +VGY IRFEDCTS++T+IKYMTDG+LLRE L + DL  YS I++DEAHER++
Sbjct: 600  EMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAIIMDEAHERSL 659

Query: 2002 HTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREP 2181
            +TDVLFGLL+    +R +LKLI+TSAT+D+ KF+ +F   PIF IPGRTFPV+IL+++ P
Sbjct: 660  NTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTP 719

Query: 2182 ESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPV 2361
            + DY+EAA    +Q+HL+  PGD+L+F+ GQE+I+ + + + E ++ +  + P L +LP+
Sbjct: 720  QEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEEL-ENAPALAVLPI 778

Query: 2362 YGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMD 2541
            Y  LPS++Q +IF  AP G RK ++ATNIAETSLT+DGI +V+D G+ K K++NP+ GMD
Sbjct: 779  YSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMD 838

Query: 2542 SLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQL 2721
            +L + PISQA A QRSGRAGRTGPG+C+RLYT+ A+++E+L T VPEIQRTNLA+ +L L
Sbjct: 839  ALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLL 898

Query: 2722 KAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKL 2901
            K++G+ +L+ F FMD PP D+M+ ++  L  L ALD  G LT  GR M EFPL+P+LSK+
Sbjct: 899  KSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKM 958

Query: 2902 LIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSW 3081
            LI+S D+GCS E+L IV+ML+V  IFYRPK +++ +DQ + KF  PE DHLT L VY  W
Sbjct: 959  LIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQW 1018

Query: 3082 KNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFF 3261
            KN+++S  WC ++FI  ++M++ +++R QL  IM + ++ + SCG D   V+K IC+ +F
Sbjct: 1019 KNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYF 1078

Query: 3262 RNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTKEYMREVTAIDP 3435
              AAK      Y  +  G   ++HP+S+ F     P+++VYHELVMTTKEYM+ VTA+D
Sbjct: 1079 HQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDG 1138

Query: 3436 KWLVEFAPSFFKIGDSTK 3489
            +WL E  P F+ +  + K
Sbjct: 1139 EWLAELGPMFYSVKQAGK 1156


>gi|40788918|dbj|BAA13213.2| KIAA0224 [Homo sapiens]
          Length = 1256

 Score =  716 bits (1848), Expect = 0.0
 Identities = 371/798 (46%), Positives = 530/798 (65%), Gaps = 3/798 (0%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDEPDFLRGYGKGG 1284
            ERWE  +M  +GV+   ++ +  EE    + +                 P FL G
Sbjct: 404  ERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLV----------PPFLDGRIVFT 453

Query: 1285 AEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFS-SNARILDPM 1461
             + EPV  VK+    LA  A       ++ +E     Q+ER     K +  +  ++ D M
Sbjct: 454  KQPEPVIPVKDATSDLAIIARKGSQTVRKHRE-----QKERKKAQHKHWELAGTKLGDIM 508

Query: 1462 SGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKK 1641
               +        ++D     +   ++  H+    +A+       S++EQR+ LPIFA+++
Sbjct: 509  GVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSILEQRQYLPIFAVQQ 568

Query: 1642 NLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAE 1821
             L+  + DN I++VVGETGSGKTTQ+TQY  E G    G IGCTQPRRVAAMSVAKRV+E
Sbjct: 569  ELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSE 628

Query: 1822 EYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTI 2001
            E G  LG +VGY IRFEDCTS++T+IKYMTDG+LLRE L + DL  YS I++DEAHER++
Sbjct: 629  EMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAIIMDEAHERSL 688

Query: 2002 HTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREP 2181
            +TDVLFGLL+    +R +LKLI+TSAT+D+ KF+ +F   PIF IPGRTFPV+IL+++ P
Sbjct: 689  NTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTP 748

Query: 2182 ESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPV 2361
            + DY+EAA    +Q+HL+  PGD+L+F+ GQE+I+ + + + E ++ +  + P L +LP+
Sbjct: 749  QEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEEL-ENAPALAVLPI 807

Query: 2362 YGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMD 2541
            Y  LPS++Q +IF  AP G RK ++ATNIAETSLT+DGI +V+D G+ K K++NP+ GMD
Sbjct: 808  YSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMD 867

Query: 2542 SLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQL 2721
            +L + PISQA A QRSGRAGRTGPG+C+RLYT+ A+++E+L T VPEIQRTNLA+ +L L
Sbjct: 868  ALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLL 927

Query: 2722 KAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKL 2901
            K++G+ +L+ F FMD PP D+M+ ++  L  L ALD  G LT  GR M EFPL+P+LSK+
Sbjct: 928  KSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKM 987

Query: 2902 LIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSW 3081
            LI+S D+GCS E+L IV+ML+V  IFYRPK +++ +DQ + KF  PE DHLT L VY  W
Sbjct: 988  LIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQW 1047

Query: 3082 KNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFF 3261
            KN+++S  WC ++FI  ++M++ +++R QL  IM + ++ + SCG D   V+K IC+ +F
Sbjct: 1048 KNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYF 1107

Query: 3262 RNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTKEYMREVTAIDP 3435
              AAK      Y  +  G   ++HP+S+ F     P+++VYHELVMTTKEYM+ VTA+D
Sbjct: 1108 HQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDG 1167

Query: 3436 KWLVEFAPSFFKIGDSTK 3489
            +WL E  P F+ +  + K
Sbjct: 1168 EWLAELGPMFYSVKQAGK 1185


>gi|30410010|ref|NP_848467.1| DEAH (Asp-Glu-Ala-His) box polypeptide
            38; pre-mRNA splicing factor 16; DEAD/H
            (Asp-Glu-Ala-Asp/His) box polypeptide 38 [Mus musculus]
 gi|28279833|gb|AAH46557.1| DEAH (Asp-Glu-Ala-His) box polypeptide 38
            [Mus musculus]
          Length = 1228

 Score =  715 bits (1846), Expect = 0.0
 Identities = 370/798 (46%), Positives = 530/798 (66%), Gaps = 3/798 (0%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDEPDFLRGYGKGG 1284
            ERWE  +M  +GV+   ++ +  EE    + +                 P FL G
Sbjct: 376  ERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLV----------PPFLDGRIVFT 425

Query: 1285 AEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFS-SNARILDPM 1461
             + EPV  VK+    LA  A       ++ +E     Q+ER     K +  +  ++ D M
Sbjct: 426  KQPEPVIPVKDATSDLAIIARKGSQTVRKHRE-----QKERRKAQHKHWELAGTKLGDIM 480

Query: 1462 SGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKK 1641
               +        ++D     +   ++  H+    +A+       S++EQR+ LPIFA+++
Sbjct: 481  GVKKEEEPDKAMTEDGKVDYRTEQKFADHMKEKSEASSEFAKKKSILEQRQYLPIFAVQQ 540

Query: 1642 NLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAE 1821
             L+  + DN I++VVGETGSGKTTQ+TQY  E G    G IGCTQPRRVAAMSVAKRV+E
Sbjct: 541  ELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSE 600

Query: 1822 EYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTI 2001
            E G  LG +VGY IRFEDCTS++T+IKYMTDG+LLRE L + DL  YS +++DEAHER++
Sbjct: 601  EMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAVIMDEAHERSL 660

Query: 2002 HTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREP 2181
            +TDVLFGLL+    +R +LKLI+TSAT+D+ KF+ +F   PIF IPGRTFPV+IL+++ P
Sbjct: 661  NTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTP 720

Query: 2182 ESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPV 2361
            + DY+EAA    +Q+HL+  PGD+L+F+ GQE+I+ + + + E ++ +  + P L +LP+
Sbjct: 721  QEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEEL-ENAPALAVLPI 779

Query: 2362 YGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMD 2541
            Y  LPS++Q +IF  AP G RK ++ATNIAETSLT+DGI +V+D G+ K K++NP+ GMD
Sbjct: 780  YSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMD 839

Query: 2542 SLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQL 2721
            +L + PISQA A QRSGRAGRTGPG+C+RLYT+ A+++E+L T VPEIQRTNLA+ +L L
Sbjct: 840  ALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLL 899

Query: 2722 KAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKL 2901
            K++G+ +L+ F FMD PP D+M+ ++  L  L ALD  G LT  GR M EFPL+P+LSK+
Sbjct: 900  KSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKM 959

Query: 2902 LIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSW 3081
            LI+S D+GCS E+L IV+ML+V  IFYRPK +++ +DQ + KF  PE DHLT L VY  W
Sbjct: 960  LIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQW 1019

Query: 3082 KNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFF 3261
            KN+++S  WC ++FI  ++M++ +++R QL  IM + ++ + SCG D   V+K IC+ +F
Sbjct: 1020 KNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYF 1079

Query: 3262 RNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTKEYMREVTAIDP 3435
              AAK      Y  +  G   ++HP+S+ F     P+++VYHELVMTTKEYM+ VTA+D
Sbjct: 1080 HQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDG 1139

Query: 3436 KWLVEFAPSFFKIGDSTK 3489
            +WL E  P F+ +  + K
Sbjct: 1140 EWLAELGPMFYSVKQAGK 1157


>gi|49075482|ref|XP_401803.1| hypothetical protein UM04188.1 [Ustilago
            maydis 521]
 gi|46099959|gb|EAK85192.1| hypothetical protein UM04188.1 [Ustilago
            maydis 521]
          Length = 1308

 Score =  714 bits (1843), Expect = 0.0
 Identities = 382/836 (45%), Positives = 543/836 (64%), Gaps = 28/836 (3%)
 Frame = +1

Query: 1105 ERWELRQMQ--GAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVED-EPDFLRGYG 1275
            + WE  ++Q  G G  TA D+ + DE+                   LV D +P FL G
Sbjct: 433  DAWERNRLQTSGVGPRTAIDLDNMDED------------GESRIHLLVHDLKPPFLDGKT 480

Query: 1276 KGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFS------- 1434
                ++EP+  VK+    +A  A     L +E +E   +A+    +    G +
Sbjct: 481  VFTKQLEPINPVKDGLSDMAVFARKGSRLVRETREKAERAKAAGKVAAMGGTTLGNILGI 540

Query: 1435 -----SNARILDPMSGNQSTAWSADES-KDRNNKMKEMPE------WLKHV-TAGGKATY 1575
                  +  +  P   N+ +A    ES K         P+      + KH+ T+ G + +
Sbjct: 541  KADDDEDHPVAVPTGVNKGSAHPESESAKTAAEDAAAQPDGKGDSQFAKHLKTSTGGSEF 600

Query: 1576 GRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRR 1755
             R   L   EQR+ LP FA ++ LM+ + +NQ++VV+GETGSGKTTQ+ Q+  E G  +
Sbjct: 601  SRTKTLK--EQRQYLPAFACREELMKIIRENQVVVVIGETGSGKTTQLAQFLHEDGYTQY 658

Query: 1756 GKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLREC 1935
            G +GCTQPRRVAAMSVAKRV+EE  CKLG  VGY+IRFEDCTS +T IKYMTDG+LLRE
Sbjct: 659  GMVGCTQPRRVAAMSVAKRVSEEMECKLGGTVGYSIRFEDCTSSETKIKYMTDGVLLRES 718

Query: 1936 LIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFL 2115
            L + DL  YS ++LDEAHER++ TDVL GLL+   ++R +LKLI+TSAT+++ KF+ ++
Sbjct: 719  LNEADLDRYSAVILDEAHERSLSTDVLMGLLRKILQRRRDLKLIVTSATMNADKFASFYG 778

Query: 2116 EAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSC 2295
             A  FTIPGRTFPV++L+++ P  DY+++A    + IHL+ P GD+LVF+TGQE+I+ +C
Sbjct: 779  GAQTFTIPGRTFPVDVLFSKTPCEDYVDSAIKQSLSIHLSHPKGDILVFMTGQEDIEVTC 838

Query: 2296 EVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDG 2475
            +V+ ER+  +  D P L++LP+Y  +P+++Q +IFD +  G+RK ++ATNIAETSLT+DG
Sbjct: 839  QVITERLSQID-DAPPLLVLPIYSQMPADLQAKIFDASENGERKCIVATNIAETSLTVDG 897

Query: 2476 IFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRD 2655
            I YVVD G+ K K+YNPK GMDSL +TPISQA A QRSGRAGRTG G  YRLYTE AFR
Sbjct: 898  IMYVVDAGYYKLKVYNPKVGMDSLQITPISQANANQRSGRAGRTGSGTAYRLYTEIAFRT 957

Query: 2656 EMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGD 2835
            E+    +PEIQRTNLA+T+L LK++G++NL+DFDFMD PP D+++ ++  L  L AL+
Sbjct: 958  ELFANTIPEIQRTNLANTVLMLKSLGVSNLLDFDFMDPPPQDTILNSMYQLWVLGALNNV 1017

Query: 2836 GLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQ 3015
            G LT LGR+M EFP+EPSLSK+LI SV+ GCS E+LTIV+ML+V ++FYRPKE+ + +D
Sbjct: 1018 GELTPLGRKMGEFPMEPSLSKMLITSVEYGCSVEMLTIVSMLSVPSVFYRPKERMEESDA 1077

Query: 3016 KKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHK 3195
             + KF   E DHLTLL VYN W+N+ +   WC ++F+  +++++A+++R QL  IM   K
Sbjct: 1078 AREKFFVAESDHLTLLHVYNQWRNNGYRDSWCSKHFLHSKTLRKAREVRVQLEDIMKTQK 1137

Query: 3196 LLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF--QQQPEW 3369
            L +VSC  D   ++K I +G+F  AA+      Y     G  +++HP+SA +     PE+
Sbjct: 1138 LRLVSCATDWDGIRKCITAGYFHQAARSAGIGEYVNCRTGIKMFLHPTSALYGLGYSPEY 1197

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKI---GDSTKLSTFKRNQKIDPL 3528
            VVYH++V+T+KE M  VT +DP WL E   +F+ I   G ++  +  KR   +D L
Sbjct: 1198 VVYHQVVLTSKEMMNTVTQVDPHWLAELGGAFYSIKERGSTSHGTRAKRTGDLDKL 1253


>gi|49097008|ref|XP_409964.1| hypothetical protein AN5827.2
            [Aspergillus nidulans FGSC A4]
 gi|40739146|gb|EAA58336.1| hypothetical protein AN5827.2 [Aspergillus
            nidulans FGSC A4]
          Length = 1128

 Score =  713 bits (1840), Expect = 0.0
 Identities = 353/640 (55%), Positives = 479/640 (74%), Gaps = 5/640 (0%)
 Frame = +1

Query: 1603 EQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGCTQP 1779
            + R+ LPI+  +  +++A+ D+Q+L++VGETGSGKTTQ+ QY  EAG  + G K+GCTQP
Sbjct: 476  DTRKKLPIYQFRDQIIQAVHDHQVLIIVGETGSGKTTQLPQYLHEAGYTKNGMKVGCTQP 535

Query: 1780 RRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSG 1959
            RRVAAMSVA RVAEE G KLG +VGY+IRFED TS  T++KYMTDGMLLRE L +PDL
Sbjct: 536  RRVAAMSVAARVAEEMGVKLGNEVGYSIRFEDNTSDKTVLKYMTDGMLLRELLTEPDLGQ 595

Query: 1960 YSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIP 2139
            YS +M+DEAHERT+ TD+  GLLK  A+ RP+LKL+I+SAT+D+ KF  YF  APIF IP
Sbjct: 596  YSALMIDEAHERTVPTDIACGLLKDIAKARPDLKLLISSATMDAQKFQSYFDNAPIFNIP 655

Query: 2140 GRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMK 2319
            GR + V+I YT++PE++YL AA  TV QIH+++ PGD+LVFLTGQEEI+ + + L E  +
Sbjct: 656  GRMYNVDIHYTQQPEANYLAAAITTVFQIHVSQGPGDILVFLTGQEEIEAAEQSLQETAR 715

Query: 2320 SMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPG 2499
             +G  +PE+II P+Y  LPS++Q +IF+P P   RKVV+ATNIAETSLTIDGI YV+DPG
Sbjct: 716  KLGNKIPEMIICPIYANLPSDLQAKIFEPTPPKARKVVLATNIAETSLTIDGIVYVIDPG 775

Query: 2500 FVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVP 2679
            FVK+ ++NP++GM+SLVVTP S+A+A QR+GRAGR GPGKC+RLYT+ A+ +E+  +  P
Sbjct: 776  FVKENVFNPRTGMESLVVTPCSRASANQRAGRAGRVGPGKCFRLYTKWAYYNELEESTTP 835

Query: 2680 EIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGR 2859
            EIQRTNL+S +L LK++GI+ L++FDFMD PP +++I AL  L+ L AL+  G LTK+GR
Sbjct: 836  EIQRTNLSSVILMLKSLGIDQLLEFDFMDPPPAETIIRALEQLYALGALNDRGELTKIGR 895

Query: 2860 RMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAML-NVQNIFYRPKEKQDHADQKKAKFHQ 3036
            +MAEFP +P L+K ++ +   GC EEVL+IV+ML     +F+RPK+K+ HAD  + +F
Sbjct: 896  QMAEFPTDPMLAKAILAADKHGCVEEVLSIVSMLGEASALFFRPKDKKIHADSARNRFTV 955

Query: 3037 PE-GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSC 3213
             + GDHLTLL ++N W +  FS  W  ENF+Q RS+ RA+D+R QL  + DR ++ + SC
Sbjct: 956  KDGGDHLTLLNIWNQWVDSDFSYVWAKENFLQQRSLTRARDVRDQLAKLCDRVEVTVSSC 1015

Query: 3214 G-RDVSRVQKAICSGFFRNAAK-RDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHEL 3387
            G  ++  +QKAI +GFF NAA+ +   + YRT+  GQ VY+HPSS  F+  P WV+Y EL
Sbjct: 1016 GSNNIVPIQKAITAGFFPNAARLQRGGDSYRTIKTGQTVYLHPSSTLFEVNPRWVIYFEL 1075

Query: 3388 VMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKR 3507
            V+T+KEYMR    +  +WLVE AP ++K  D   L T K+
Sbjct: 1076 VLTSKEYMRSNMPLQAEWLVEVAPHYYKKKDLETLGTEKK 1115


>gi|19862987|sp|Q10752|CC28_SCHPO Putative ATP-dependent RNA helicase
            cdc28
          Length = 1055

 Score =  711 bits (1836), Expect = 0.0
 Identities = 348/645 (53%), Positives = 486/645 (74%), Gaps = 4/645 (0%)
 Frame = +1

Query: 1594 SMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGK-IGC 1770
            S+   R+SLP++  K +L++A+ + Q+L++V ETGSGKTTQ+ Q+  EAG  +  K I C
Sbjct: 410  SLESSRKSLPVYQYKDDLLKAINEYQVLLIVAETGSGKTTQLPQFLHEAGYTKGNKKICC 469

Query: 1771 TQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPD 1950
            TQPRRVAAMSVA RVA+E   +LG +VGY+IRFE+ TS+ T+IKY+TDGMLLRE L +PD
Sbjct: 470  TQPRRVAAMSVAARVAKEMDVRLGQEVGYSIRFENATSEKTVIKYLTDGMLLREFLTEPD 529

Query: 1951 LSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIF 2130
            L+ YS+I++DEAHERT+HTD+LFGL+K  AR RP+LK++I+SAT+D+ KFS YF EAP+F
Sbjct: 530  LASYSVIIIDEAHERTLHTDILFGLVKDIARFRPDLKVLISSATIDAEKFSAYFDEAPVF 589

Query: 2131 TIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYE 2310
             +PGR +PV+I YT +PE++Y++AA  T++QIH T+P GD+LVFLTGQ+EI+   E + E
Sbjct: 590  YVPGRRYPVDIYYTPQPEANYIQAAITTILQIHTTQPAGDILVFLTGQDEIELMSENMQE 649

Query: 2311 RMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVV 2490
              + +G  +PE+I+ P+Y  LPSE+Q +IFDP P G RKVV+ATNIAETS+TIDG+ +V+
Sbjct: 650  LCRILGKRIPEIILCPIYANLPSELQAKIFDPTPPGARKVVLATNIAETSITIDGVNFVI 709

Query: 2491 DPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPT 2670
            D GFVKQ +YNP++GM+SLV  P S+A+A QR+GRAGR GPGKC+RLYT R + +E+
Sbjct: 710  DSGFVKQNMYNPRTGMESLVSVPCSRASADQRAGRAGRVGPGKCFRLYTRRTYNNELDMV 769

Query: 2671 PVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTK 2850
              PEIQRTNL + +L LK++GINNL+DFDFMDAPP ++++ +L  L+ L AL+  G LTK
Sbjct: 770  TSPEIQRTNLTNIVLLLKSLGINNLLDFDFMDAPPPETLMRSLELLYALGALNNRGELTK 829

Query: 2851 LGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAML-NVQNIFYRPKEKQDHADQKKAK 3027
            LGR+MAEFP +P LSK LI S   GC EEVL+IV+ML    ++FYRPK+K   AD+ +A
Sbjct: 830  LGRQMAEFPTDPMLSKSLIASSKYGCVEEVLSIVSMLGEASSLFYRPKDKIMEADKARAN 889

Query: 3028 FHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKL-LM 3204
            F QP GDHLTLL ++N W +  FS  W  ENF+Q +S+ RA+D+R QL  + +R ++ L+
Sbjct: 890  FTQPGGDHLTLLHIWNEWVDTDFSYNWARENFLQYKSLCRARDVRDQLANLCERVEIELV 949

Query: 3205 VSCGRDVSRVQKAICSGFFRNAAKRDPQ-EGYRTLTDGQNVYIHPSSACFQQQPEWVVYH 3381
             +    +  ++KAI +G+F NAA+ D   + YRT+   Q VYIHPSS+  +++P+ ++Y
Sbjct: 950  TNSSESLDPIKKAITAGYFSNAARLDRSGDSYRTVKSNQTVYIHPSSSVAEKKPKVIIYF 1009

Query: 3382 ELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQK 3516
            ELV+TTKEY R++T I P+WL+E +P +FK  +  +L   ++  K
Sbjct: 1010 ELVLTTKEYCRQITEIQPEWLLEISPHYFKPENIEELQKTQKRHK 1054


>gi|50258188|gb|EAL20882.1| hypothetical protein CNBE2430
            [Cryptococcus neoformans var. neoformans B-3501A]
          Length = 1302

 Score =  711 bits (1835), Expect = 0.0
 Identities = 374/795 (47%), Positives = 529/795 (66%), Gaps = 7/795 (0%)
 Frame = +1

Query: 1111 WELRQMQGAGVLTATDMPD-FDEEMGVLRNYXXXXXXXXXXXXLVED-EPDFLRGYGKGG 1284
            WE  +MQ +GVL    + D FD++                   LV D +P FL G
Sbjct: 444  WETNRMQTSGVLQRGGVDDDFDDD------------SDSKVHVLVHDLKPPFLDGTVAYT 491

Query: 1285 AEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDPMS 1464
             +++P+  VK+    +A  +    AL +ER+E     ++ER+    K  S     L  +
Sbjct: 492  KQLDPINPVKDGTSDMALFSKKGSALVRERRE-----RQEREKAAAKAASIAGTTLGNLM 546

Query: 1465 G--NQSTAWSADESKDRNNKMKEMPEWLKHVTAG-GKATYGRRTNLSMVEQRESLPIFAL 1635
            G  ++       +        K   ++  H+    G + + +   L   EQRE LP FA+
Sbjct: 547  GVTDEPDLGQEGQKDGVTENYKADSQFSSHLKKSEGVSNFAKSRTLK--EQREYLPAFAV 604

Query: 1636 KKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRV 1815
            ++ LM  + D+Q+LVVVGETGSGKTTQ+ Q+  E G    G IGCTQPRRVAAMSVAKRV
Sbjct: 605  REELMGMIRDHQVLVVVGETGSGKTTQLGQFLYEDGYCANGMIGCTQPRRVAAMSVAKRV 664

Query: 1816 AEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHER 1995
            +EE  C LG  VGY IRFEDCTS+DT IK+MTDG+LLRE L + DL  YS+I+LDEAHER
Sbjct: 665  SEEMECTLGETVGYAIRFEDCTSKDTKIKFMTDGVLLRESLNEGDLDRYSVIILDEAHER 724

Query: 1996 TIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTR 2175
            ++ TD+L GLL+    +R +LKLI+TSAT+++ KFS++F  A  +TIPGRTFPVEI +++
Sbjct: 725  SLSTDILMGLLRKILTRRRDLKLIVTSATMNAEKFSQFFGNAATYTIPGRTFPVEIFHSK 784

Query: 2176 EPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIIL 2355
             P  DY+++A   V+QIHL+   GD+LVF+TGQE+I+  C+V+ ER+  +  D P L +L
Sbjct: 785  SPCEDYVDSAIKQVLQIHLSSSQGDILVFMTGQEDIECCCQVIEERLSQLD-DPPPLAVL 843

Query: 2356 PVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSG 2535
            P+Y  +P+++Q +IF P P G+RKVV+ATNIAETSLT+DGI YVVD G+ K K+YNPK G
Sbjct: 844  PIYSQMPADLQAKIFQPTPDGRRKVVVATNIAETSLTVDGILYVVDCGYSKLKVYNPKVG 903

Query: 2536 MDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLL 2715
            MD+L +TPISQA   QR+GRAGRTGPG CYRLYTE A+ +E+  + +PEIQRTNLA+T+L
Sbjct: 904  MDALQITPISQANCGQRAGRAGRTGPGFCYRLYTETAYLNELFASNIPEIQRTNLANTVL 963

Query: 2716 QLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLS 2895
             LK++G+ NL++FDFMD PP ++++ ++  L  L ALD  G LT +GR+M++FP+EPSL+
Sbjct: 964  LLKSLGVKNLLEFDFMDPPPQENILNSMYQLWVLGALDNVGNLTSIGRKMSDFPMEPSLA 1023

Query: 2896 KLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYN 3075
            K+LI+SVD  CS E+LTIV+ML+V ++FYRP ++ + +D  + KF  PE DHLTLL VY
Sbjct: 1024 KMLIVSVDYQCSSEMLTIVSMLSVPSVFYRPPQRAEESDAAREKFFVPESDHLTLLHVYT 1083

Query: 3076 SWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSG 3255
             WK++ +S  WC ++F+  + M++A+++R QL  IM + K+ ++S G D   V+K I +G
Sbjct: 1084 QWKSNGYSDSWCMKHFLHPKLMRKAREVRGQLEDIMKQQKMDLLSVGTDWDIVRKCITAG 1143

Query: 3256 FFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF--QQQPEWVVYHELVMTTKEYMREVTAI 3429
            +F  AA+      Y  +  G    +HP+SA +     P++VVYHELV+T+K+YM  VT++
Sbjct: 1144 YFHQAARVKGIGEYMNIRTGLPCVLHPTSALYGLGYMPDYVVYHELVLTSKQYMMCVTSV 1203

Query: 3430 DPKWLVEFAPSFFKI 3474
            DP WL +    FF I
Sbjct: 1204 DPYWLADLGSVFFSI 1218


>gi|34852059|ref|XP_215306.2| similar to DEAD/H (Asp-Glu-Ala-Asp/His)
            box polypeptide 16 [Rattus norvegicus]
          Length = 888

 Score =  711 bits (1834), Expect = 0.0
 Identities = 359/718 (50%), Positives = 497/718 (69%), Gaps = 15/718 (2%)
 Frame = +1

Query: 1363 SKERKETKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWS---ADESKDRNNKMKEMP 1533
            + E +  + + +R +D++ +  F+   R  D          S   A E   +  KM E
Sbjct: 161  ASEDEWERTERERLQDLEERDAFAERVRQRDKDRTRNVLERSDKKAYEEAQKRLKMAEED 220

Query: 1534 EWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTT 1713
                  ++G   +   +   S+   R SLP+F  ++ L+ A+ ++Q+L++ GETGSGKTT
Sbjct: 221  RKAMEPSSGPPLSAQAQQKESIQAVRRSLPVFPFREELLTAIANHQVLIIEGETGSGKTT 280

Query: 1714 QMTQYAIEAGLGRRG-KIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQD 1890
            Q+ QY  E G  ++G KI CTQPRRVAAMSVA RVA E G KLG             ++
Sbjct: 281  QIPQYLFEEGYTKKGMKIACTQPRRVAAMSVAARVAREMGVKLG-------------NER 327

Query: 1891 TIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLII 2070
            T+++YMTDGMLLRE L +PDL+ YS++M+DEAHERT+HTD+LFGL+K  AR RPELK+++
Sbjct: 328  TVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLV 387

Query: 2071 TSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGD 2250
             SATLD+ +FS +F +AP+F IPGR FPV+I YT+ PE+DYLEA  ++V+QIH+T+PPGD
Sbjct: 388  ASATLDTARFSAFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGD 447

Query: 2251 VLVFLTGQEEID----------TSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIF 2400
            +LVFLTGQ               +CE+L +R   +G  + EL++LP+Y  LPS+MQ RIF
Sbjct: 448  ILVFLTGQVSCHPAPYSGGDWRAACEMLQDRCSRLGSKIRELLVLPIYANLPSDMQARIF 507

Query: 2401 DPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAK 2580
             P P G RKVV+ATNIAETSLTI+GI YV+DPGF KQK YNP++GM+SL VTP S+A+A
Sbjct: 508  QPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASAN 567

Query: 2581 QRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDF 2760
            QR+GRAGR   GKC+RLYT  A++ E+  T VPEIQRT+L + +L LK++GI++L+ FDF
Sbjct: 568  QRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDF 627

Query: 2761 MDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEV 2940
            +D PP ++++ AL  L+ L AL+  G LT  GR+MAE P++P LSK+++ S    CSEE+
Sbjct: 628  LDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEI 687

Query: 2941 LTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFE 3117
            LT+ AML+V N IFYRPK+K  HAD  +  F  P GDHL LL VY  W    +S  WC+E
Sbjct: 688  LTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYE 747

Query: 3118 NFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGY 3297
            NF+Q RSM+RA+D+R+QL G+++R ++ + SC  D  RV+KAI SG+F + A R  + GY
Sbjct: 748  NFVQFRSMRRARDVREQLEGLLERVEVGLTSCQGDYVRVRKAITSGYFYHTA-RLTRSGY 806

Query: 3298 RTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFK 3471
            RT+   Q V+IHP+S+ F+QQP W++YHELV+TTKE+MR+V  I+  WL+E AP ++K
Sbjct: 807  RTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYK 864


>gi|38106993|gb|EAA53224.1| hypothetical protein MG07501.4
            [Magnaporthe grisea 70-15]
          Length = 1016

 Score =  702 bits (1813), Expect = 0.0
 Identities = 356/649 (54%), Positives = 473/649 (72%), Gaps = 8/649 (1%)
 Frame = +1

Query: 1582 RTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG- 1758
            +  LSM E R+SLPI+  +   + A+   QILV+VGETGSGKTTQ+ QY  EAG  + G
Sbjct: 361  KRQLSMQETRKSLPIYVYRDEFLAALEQYQILVIVGETGSGKTTQLPQYLHEAGYTKDGM 420

Query: 1759 KIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECL 1938
            ++GCTQPRRVAAMSVA RVA+E G K+G +VGY+IRFED TS  TI+KYMTDGMLLRE +
Sbjct: 421  RVGCTQPRRVAAMSVAARVADEMGVKVGNEVGYSIRFEDNTSDKTILKYMTDGMLLREFM 480

Query: 1939 IDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLE 2118
             +PDLS YS +M+DEAHERT+HTD+L  L+K  AR+R +LKL+I+SAT+++ KF+ YF +
Sbjct: 481  TEPDLSSYSALMIDEAHERTVHTDILLALVKDLARERKDLKLLISSATMNAEKFASYFDD 540

Query: 2119 APIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCE 2298
            APIF IPGR +PV+I YT  PE++YL AA  TV QIH T+P GD+L+FLTGQ+EI+ +
Sbjct: 541  APIFNIPGRRYPVDIYYTPAPEANYLSAAITTVFQIHTTQPKGDILIFLTGQDEIEAAEM 600

Query: 2299 VLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGI 2478
             + E  + +G  V EL+I P+Y  LPSE+Q++IF+P P   RKVV+ATNIAETSLTIDGI
Sbjct: 601  QITETARKLGSRVKELVICPIYANLPSELQSKIFEPTPENARKVVLATNIAETSLTIDGI 660

Query: 2479 FYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDE 2658
             YV+DPG+VK+ +YNP +GM +LVV P S+A+A QRSGRAGR GPGKC+RLYT+ A+ +E
Sbjct: 661  VYVIDPGYVKENVYNPATGMSNLVVVPCSRASANQRSGRAGRVGPGKCFRLYTKYAYMNE 720

Query: 2659 MLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDG 2838
            M  +  PEIQRTNL   +LQLK++GIN L+DF+FMD PP +++I ALN L  L  L+  G
Sbjct: 721  MEESTTPEIQRTNLNGVVLQLKSLGINELLDFEFMDPPPTEALIGALNQLFALQGLNHKG 780

Query: 2839 LLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLN-VQNIFYRPKEKQDHADQ 3015
             LTKLGR+MAEFP +P L+K ++ +   GC EEVL+IVAML+    +F+RPK+KQ HAD
Sbjct: 781  ELTKLGRQMAEFPTDPMLAKAVLAADKEGCVEEVLSIVAMLSEASALFFRPKDKQVHADA 840

Query: 3016 KKAKFHQPE-GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRH 3192
             + +F   E GDH+TLL ++N W +  +S  W  ENF+Q RS+ RA+D+R+QL  + +R
Sbjct: 841  ARGRFTVKEGGDHVTLLNIWNQWLDSDYSPIWSKENFLQQRSLTRARDVREQLSKLCERV 900

Query: 3193 KLLMVSCG--RDVSRVQKAICSGFFRNAAKRDPQ-EGYRTLTDGQNVYIHPSSACFQQQ- 3360
            ++ + +CG   ++  +++AI +GFF NAA+     + YRT+ +   VYIHPSS   Q+
Sbjct: 901  EVTLSTCGGISNMPPIKRAITAGFFPNAARMQRSGDSYRTVKNNTTVYIHPSSVMMQEDP 960

Query: 3361 -PEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFK 3504
             P  V+Y+ELV TTKEYMR    I+PKWL E AP F K  D   L   K
Sbjct: 961  PPRMVIYYELVQTTKEYMRSCMPIEPKWLAELAPHFHKAKDIAALEEKK 1009


>gi|46137751|ref|XP_390567.1| conserved hypothetical protein
            [Gibberella zeae PH-1]
 gi|42546450|gb|EAA69293.1| conserved hypothetical protein [Gibberella
            zeae PH-1]
          Length = 1011

 Score =  702 bits (1811), Expect = 0.0
 Identities = 355/645 (55%), Positives = 474/645 (73%), Gaps = 7/645 (1%)
 Frame = +1

Query: 1591 LSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIG 1767
            LS+ E R+SLPI+  +   + A+   Q+LV+VGETGSGKTTQ+ QY  EAG  + G K+G
Sbjct: 361  LSIQETRKSLPIYQYRDEFLAALEQYQVLVIVGETGSGKTTQLPQYLHEAGYTKNGLKVG 420

Query: 1768 CTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDP 1947
            CTQPRRVAAMSVA RVAEE G K+G +VGYTIRFEDCTS  T++KYMTDGMLLRE + +P
Sbjct: 421  CTQPRRVAAMSVAARVAEEVGVKVGNEVGYTIRFEDCTSDKTVLKYMTDGMLLREFMTEP 480

Query: 1948 DLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPI 2127
            DL+GYS +M+DEAHERT+HTD+L  L+K  +R+RP+LKL+I+SAT+++ KF++YF +API
Sbjct: 481  DLAGYSALMIDEAHERTVHTDILLALIKDLSRERPDLKLLISSATMNAEKFAQYFDDAPI 540

Query: 2128 FTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLY 2307
            F IPGR +PV+I YT  PE++YL AA  T  QIH T+P GD+L+FLTGQ+EI+ +   +
Sbjct: 541  FNIPGRRYPVDIYYTPAPEANYLAAAITTTFQIHTTQPKGDILIFLTGQDEIEAAELEIA 600

Query: 2308 ERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYV 2487
            E  K +G  V EL+I P+Y  LPSE+Q++IF+P P G RKVV+ATNIAETSLTIDGI YV
Sbjct: 601  ETAKKLGSRVKELVICPIYANLPSELQSKIFEPTPDGARKVVLATNIAETSLTIDGIVYV 660

Query: 2488 VDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLP 2667
            +DPG+VK+ +YNP +GM +LVV P S+A+A QRSGRAGR GPGKC+RLYT+ A+ +EM
Sbjct: 661  IDPGYVKENVYNPATGMSNLVVVPCSRASANQRSGRAGRVGPGKCFRLYTKFAYMNEMDE 720

Query: 2668 TPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLT 2847
            +  PEIQRTNL   +LQLK++GIN L+DF+FMD PP +++I ALN L  L AL+  G LT
Sbjct: 721  STTPEIQRTNLNGVVLQLKSLGINELLDFEFMDPPPTEALIGALNQLFALQALNHKGELT 780

Query: 2848 KLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAML-NVQNIFYRPKEKQDHADQKKA 3024
            KLGR+M EFP +P L+K ++ +   GC EEVL+IV+ML     +F+RPK+K+ HAD  +
Sbjct: 781  KLGRQMGEFPTDPMLAKAVLAADKEGCVEEVLSIVSMLGEASALFFRPKDKKIHADSARN 840

Query: 3025 KFHQPE-GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLL 3201
            +F   + GDH+TLL V+N W +  FS  W  ENF+Q RS+ RA+D+R QL  + +R ++
Sbjct: 841  RFTVKDGGDHITLLNVWNQWVDSDFSPVWAKENFLQQRSLTRARDVRDQLAKLCERVEVA 900

Query: 3202 MVSCG-RDVSRVQKAICSGFFRNAAK-RDPQEGYRTLTDGQNVYIHPSSACFQQQP--EW 3369
              +CG  ++  +++AI +GFF NAA+ +   + YRT+ +   V+IHPSS      P  +
Sbjct: 901  PSTCGATNLRPIKRAITAGFFPNAARLQKSGDSYRTVKNSTTVWIHPSSVLMAIDPPEKM 960

Query: 3370 VVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFK 3504
            VVY ELV TTKEYMR V  I+P+WL E AP F K  D  ++   K
Sbjct: 961  VVYFELVQTTKEYMRSVMPIEPRWLSELAPHFHKKKDVEEMEEKK 1005


>gi|39104622|dbj|BAC65596.4| mKIAA0577 protein [Mus musculus]
          Length = 1018

 Score =  702 bits (1811), Expect = 0.0
 Identities = 341/623 (54%), Positives = 460/623 (73%), Gaps = 2/623 (0%)
 Frame = +1

Query: 1609 RESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG-KIGCTQPRR 1785
            R SLP+F  ++ L+ A+ ++Q+L++ GETGSGKTTQ+ QY  E G  ++G KI CTQPRR
Sbjct: 401  RRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTKKGMKIACTQPRR 460

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVA RVA E G KLG +VGY+IRFEDCTS+ T+++YMTDGMLLRE L +PDL+ YS
Sbjct: 461  VAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYS 520

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
            ++M+DEAHERT+HTD+LFGL+K  AR RPELK+++ SATLD+ +FS +F +AP+F IPGR
Sbjct: 521  VVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATLDTARFSAFFDDAPVFRIPGR 580

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
                                         T+PPGD+LVFLTGQEEI+ +CE+L +R + +
Sbjct: 581  R----------------------------TQPPGDILVFLTGQEEIEAACEMLQDRCRRL 612

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
            G  + EL++LP+Y  LPS+MQ RIF P P G RKVV+ATNIAETSLTI+GI YV+DPGF
Sbjct: 613  GSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFC 672

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            KQK YNP++GM+SL VTP S+A+A QR+GRAGR   GKC+RLYT  A++ E+  T VPEI
Sbjct: 673  KQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEI 732

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRT+L + +L LK++GI++L+ FDF+D PP ++++ AL  L+ L AL+  G LT  GR+M
Sbjct: 733  QRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKM 792

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPE 3042
            AE P++P LSK+++ S    CSEE+LT+ AML+V N IFYRPK+K  HAD  +  F  P
Sbjct: 793  AELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPG 852

Query: 3043 GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRD 3222
            GDHL LL VY  W    +S  WC+ENF+Q RSM+RA+D+R+QL G+++R ++ + SC  D
Sbjct: 853  GDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLTSCQGD 912

Query: 3223 VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTK 3402
              RV+K+I SG+F + A R  + GYRT+   Q V+IHP+S+ F+QQP W++YHELV+TTK
Sbjct: 913  YVRVRKSITSGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTK 971

Query: 3403 EYMREVTAIDPKWLVEFAPSFFK 3471
            E+MR+V  I+  WL+E AP ++K
Sbjct: 972  EFMRQVLEIESSWLLEVAPHYYK 994


>gi|48474990|sp|Q9P774|PR16_SCHPO Pre-mRNA splicing factor RNA
            helicase prp16
          Length = 1173

 Score =  701 bits (1809), Expect = 0.0
 Identities = 378/813 (46%), Positives = 536/813 (65%), Gaps = 6/813 (0%)
 Frame = +1

Query: 1078 KARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDE-- 1251
            +A  R      WE  +M  +GV  A   P  + +  ++               L+ DE
Sbjct: 333  EASDRFKENSMWEKNRMITSGVSKA---PGLESDYSLMEE---------RRVHLLVDELR 380

Query: 1252 PDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGF 1431
            P FL G      ++  +  V++P   LA  A +   L +ER+E      RER    QK
Sbjct: 381  PHFLDGAEFSSKKVGDITSVRDPQSDLAINARLGSRLVRERREF-----RER----QKAA 431

Query: 1432 SSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWL--KHVTAGGKATYGRRTNLSMVE 1605
            S+   +     GN        +S D + K    P  +  +   +  K T   RT  S  E
Sbjct: 432  SAATSLAGTSLGN---VMGLKDSNDEDAKAGTTPVKVAGRSEQSNKKDTEFARTK-SYRE 487

Query: 1606 QRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRR 1785
            QRE LP FA+++ L+  + DNQ+L+VVGETGSGKTTQ+ Q+  E G  R G IGCTQPRR
Sbjct: 488  QREFLPAFAVREQLLSVIRDNQVLIVVGETGSGKTTQLAQFLYEDGYHRNGMIGCTQPRR 547

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVAKRV+EE G +LG+ VGY+IRFED T  DT+IKYMTDG+LLRE L+  +L  YS
Sbjct: 548  VAAMSVAKRVSEEMGVRLGSTVGYSIRFEDVTGPDTVIKYMTDGVLLRESLMQNNLEKYS 607

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
            +I++DEAHER+++TD+L GLLK    +R ++KL++TSAT++S KFS++F  AP FTIPGR
Sbjct: 608  VIIMDEAHERSLNTDILMGLLKKVLSRRRDIKLLVTSATMNSQKFSDFFGGAPQFTIPGR 667

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
            T+PV+I++ + P SDY+EAA   V+QIHL++P GD+LVF+TGQE+I+ +CE++ +R+  +
Sbjct: 668  TYPVDIMFAKAPCSDYVEAAVRQVLQIHLSQPAGDILVFMTGQEDIEATCEIIADRLNQL 727

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
              D P L ILP+Y  +P+++Q +IFD A  G RKVV+ATNIAETSLT+ GI YVVD G+
Sbjct: 728  H-DAPRLSILPIYSQMPADLQAKIFDSAEPGVRKVVVATNIAETSLTVHGISYVVDTGYC 786

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            K K+YN K G+D+L VTPISQA A QR+GRAGRTGPG  YRLYTE A+  EM  T +PEI
Sbjct: 787  KLKMYNSKLGIDTLQVTPISQANANQRAGRAGRTGPGIAYRLYTEMAYIREMFETTLPEI 846

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRTNL++T+L LK++G+  + DFDFMD PP D+++ +L  L TL ALD  G LT LG++M
Sbjct: 847  QRTNLSNTVLILKSLGVEEISDFDFMDRPPNDTLMASLYELWTLGALDNFGKLTTLGKKM 906

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEG 3045
            + FP++PSLSKL+I++ D  C+EE++TIV+ML+V ++FYRPKE+ + +D  + KF+ PE
Sbjct: 907  SLFPMDPSLSKLIIIAEDYKCTEEIITIVSMLSVPSVFYRPKERAEESDAAREKFNVPES 966

Query: 3046 DHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDV 3225
            DHL LL +Y  W+ + +S  WC ++F+  +++KRA+DIR+QL+ IM + K+ + S   D
Sbjct: 967  DHLMLLNIYQHWQRNGYSNSWCSKHFLHSKTLKRARDIRQQLVEIMSKQKISLESVS-DW 1025

Query: 3226 SRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF--QQQPEWVVYHELVMTT 3399
              V++ +CS +F  AA       Y  L  G   ++H +S+ +     P++V+YHELV+T+
Sbjct: 1026 DIVRRVLCSAYFHQAACAKGIGEYVHLRSGMPCHLHVTSSLYGLGYLPDYVIYHELVLTS 1085

Query: 3400 KEYMREVTAIDPKWLVEFAPSFFKIGDSTKLST 3498
            KEYM  VT++DP WL EF   ++ + +  +  T
Sbjct: 1086 KEYMNIVTSVDPYWLAEFGGVYYSVKERFRNET 1118


>gi|7522524|pir||T39724 probable pre-mRNA splicing factor
            ATP-dependent RNA helicase SPBC17G9.01 [imported] -
            fission yeast (Schizosaccharomyces pombe) (fragment)
 gi|5738522|emb|CAB52799.1| SPBC17G9.01 [Schizosaccharomyces pombe]
          Length = 995

 Score =  701 bits (1809), Expect = 0.0
 Identities = 378/813 (46%), Positives = 536/813 (65%), Gaps = 6/813 (0%)
 Frame = +1

Query: 1078 KARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDE-- 1251
            +A  R      WE  +M  +GV  A   P  + +  ++               L+ DE
Sbjct: 155  EASDRFKENSMWEKNRMITSGVSKA---PGLESDYSLMEE---------RRVHLLVDELR 202

Query: 1252 PDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGF 1431
            P FL G      ++  +  V++P   LA  A +   L +ER+E      RER    QK
Sbjct: 203  PHFLDGAEFSSKKVGDITSVRDPQSDLAINARLGSRLVRERREF-----RER----QKAA 253

Query: 1432 SSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWL--KHVTAGGKATYGRRTNLSMVE 1605
            S+   +     GN        +S D + K    P  +  +   +  K T   RT  S  E
Sbjct: 254  SAATSLAGTSLGN---VMGLKDSNDEDAKAGTTPVKVAGRSEQSNKKDTEFARTK-SYRE 309

Query: 1606 QRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRR 1785
            QRE LP FA+++ L+  + DNQ+L+VVGETGSGKTTQ+ Q+  E G  R G IGCTQPRR
Sbjct: 310  QREFLPAFAVREQLLSVIRDNQVLIVVGETGSGKTTQLAQFLYEDGYHRNGMIGCTQPRR 369

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVAKRV+EE G +LG+ VGY+IRFED T  DT+IKYMTDG+LLRE L+  +L  YS
Sbjct: 370  VAAMSVAKRVSEEMGVRLGSTVGYSIRFEDVTGPDTVIKYMTDGVLLRESLMQNNLEKYS 429

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
            +I++DEAHER+++TD+L GLLK    +R ++KL++TSAT++S KFS++F  AP FTIPGR
Sbjct: 430  VIIMDEAHERSLNTDILMGLLKKVLSRRRDIKLLVTSATMNSQKFSDFFGGAPQFTIPGR 489

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
            T+PV+I++ + P SDY+EAA   V+QIHL++P GD+LVF+TGQE+I+ +CE++ +R+  +
Sbjct: 490  TYPVDIMFAKAPCSDYVEAAVRQVLQIHLSQPAGDILVFMTGQEDIEATCEIIADRLNQL 549

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
              D P L ILP+Y  +P+++Q +IFD A  G RKVV+ATNIAETSLT+ GI YVVD G+
Sbjct: 550  H-DAPRLSILPIYSQMPADLQAKIFDSAEPGVRKVVVATNIAETSLTVHGISYVVDTGYC 608

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            K K+YN K G+D+L VTPISQA A QR+GRAGRTGPG  YRLYTE A+  EM  T +PEI
Sbjct: 609  KLKMYNSKLGIDTLQVTPISQANANQRAGRAGRTGPGIAYRLYTEMAYIREMFETTLPEI 668

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRTNL++T+L LK++G+  + DFDFMD PP D+++ +L  L TL ALD  G LT LG++M
Sbjct: 669  QRTNLSNTVLILKSLGVEEISDFDFMDRPPNDTLMASLYELWTLGALDNFGKLTTLGKKM 728

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEG 3045
            + FP++PSLSKL+I++ D  C+EE++TIV+ML+V ++FYRPKE+ + +D  + KF+ PE
Sbjct: 729  SLFPMDPSLSKLIIIAEDYKCTEEIITIVSMLSVPSVFYRPKERAEESDAAREKFNVPES 788

Query: 3046 DHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDV 3225
            DHL LL +Y  W+ + +S  WC ++F+  +++KRA+DIR+QL+ IM + K+ + S   D
Sbjct: 789  DHLMLLNIYQHWQRNGYSNSWCSKHFLHSKTLKRARDIRQQLVEIMSKQKISLESVS-DW 847

Query: 3226 SRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF--QQQPEWVVYHELVMTT 3399
              V++ +CS +F  AA       Y  L  G   ++H +S+ +     P++V+YHELV+T+
Sbjct: 848  DIVRRVLCSAYFHQAACAKGIGEYVHLRSGMPCHLHVTSSLYGLGYLPDYVIYHELVLTS 907

Query: 3400 KEYMREVTAIDPKWLVEFAPSFFKIGDSTKLST 3498
            KEYM  VT++DP WL EF   ++ + +  +  T
Sbjct: 908  KEYMNIVTSVDPYWLAEFGGVYYSVKERFRNET 940


>gi|49079422|ref|XP_403358.1| hypothetical protein UM05743.1 [Ustilago
            maydis 521]
 gi|46100765|gb|EAK85998.1| hypothetical protein UM05743.1 [Ustilago
            maydis 521]
          Length = 1920

 Score =  696 bits (1795), Expect = 0.0
 Identities = 346/627 (55%), Positives = 473/627 (75%), Gaps = 7/627 (1%)
 Frame = +1

Query: 1609 RESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGK-IGCTQPRR 1785
            R+SLP++AL++ L++A+ + Q+L+VVGETGSGKTTQ+ Q+  EAG  + GK +GCTQPRR
Sbjct: 1262 RKSLPVYALRQELLDAIDEYQVLIVVGETGSGKTTQLPQFLHEAGYTKNGKKVGCTQPRR 1321

Query: 1786 VAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYS 1965
            VAAMSVA RVAEE G +LG + GY+IRFEDCTS DT+IKYMTDGMLLRE L +PDLS YS
Sbjct: 1322 VAAMSVAARVAEEMGVRLGRECGYSIRFEDCTSDDTVIKYMTDGMLLREFLTEPDLSSYS 1381

Query: 1966 LIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGR 2145
             I++DEAHERT+ TDVLFGL+K  AR RP+LKL+I+SATLD+ KFSE+F +APIF +PGR
Sbjct: 1382 AIIIDEAHERTLSTDVLFGLVKDIARFRPDLKLLISSATLDAEKFSEFFDDAPIFDVPGR 1441

Query: 2146 TFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM 2325
             +PV+I YT +PE++YL AA  TV QIH T+P GD+LVFLTGQ+EID + E L E  +++
Sbjct: 1442 RYPVDIHYTPQPEANYLHAAITTVFQIHTTQPRGDILVFLTGQDEIDAAMENLQETSRAL 1501

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFV 2505
            G  + ELII P+Y  LPSEMQ +IF+P P G RKVV+ATNIAETS+TIDG+ +V+DPGFV
Sbjct: 1502 GNKIAELIICPIYANLPSEMQAKIFEPTPEGARKVVLATNIAETSITIDGVVFVIDPGFV 1561

Query: 2506 KQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEI 2685
            KQ  YN ++GM SL V   S+A+A QR+GRAGR G GKC+RL+T+ AFR+EM     PEI
Sbjct: 1562 KQNSYNARTGMSSLTVVACSRASANQRAGRAGRVGAGKCFRLFTKWAFRNEMEENTTPEI 1621

Query: 2686 QRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRM 2865
            QRTNLA+ +L LK++GIN+L++FDF+D PP D+++ +   L+ L AL+  G LTKLGRRM
Sbjct: 1622 QRTNLANVVLLLKSLGINDLLNFDFLDPPPSDTLMRSFELLYALGALNDKGELTKLGRRM 1681

Query: 2866 AEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQN-IFYRPKEKQDHADQKKAKFHQPE 3042
            AEFP++P LSK ++ S    C+EEV++IV+ML+  + +F+RPK+K+ HAD+ +A F QP
Sbjct: 1682 AEFPVDPQLSKAILASETYRCTEEVVSIVSMLSESSALFFRPKDKKMHADRARAAFVQPG 1741

Query: 3043 GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCG-- 3216
            GDHLTLL V+  W + ++   +C +NF+Q + + R +D+R QL  + +R +L   S
Sbjct: 1742 GDHLTLLNVWEQWVHSNYDHQFCIDNFVQPKVLARVRDVRDQLSQLCERVELTPESNADP 1801

Query: 3217 RDVSRVQKAICSGFFRNAAK-RDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHEL 3387
             D+S +Q++I +G+F N A+ +   E YRT+     ++IHPSS  ++   QP ++ + EL
Sbjct: 1802 SDISGIQRSILAGYFMNTARIQKGGEAYRTIKQNTTIHIHPSSCLYKHIPQPPFLCFFEL 1861

Query: 3388 VMTTKEYMREVTAIDPKWLVEFAPSFF 3468
            V T+K +MR+V  I P+WL+E A  +F
Sbjct: 1862 VETSKNFMRQVMQIRPEWLLEVAKHYF 1888


>gi|50510419|dbj|BAD32195.1| mKIAA0224 protein [Mus musculus]
          Length = 1224

 Score =  689 bits (1777), Expect = 0.0
 Identities = 364/798 (45%), Positives = 517/798 (64%), Gaps = 3/798 (0%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDEPDFLRGYGKGG 1284
            ERWE  +M  +GV+   ++ +  EE    + +                 P FL G
Sbjct: 379  ERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLV----------PPFLDGRIVFT 428

Query: 1285 AEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFS-SNARILDPM 1461
             + EPV  VK+    LA  A       ++ +E     Q+ER     K +  +  ++ D M
Sbjct: 429  KQPEPVIPVKDATSDLAIIARKGSQTVRKHRE-----QKERRKAQHKHWELAGTKLGDIM 483

Query: 1462 SGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKK 1641
               +        ++D     +   ++  H+    +A+       S++EQR+ LPIFA+++
Sbjct: 484  GVKKEEEPDKAMTEDGKVDYRTEQKFADHMKEKSEASSEFAKKKSILEQRQYLPIFAVQQ 543

Query: 1642 NLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAE 1821
             L+  + DN I++VVGETGSGKTTQ+TQY  E G    G IGCTQPRRVAAMSVAKRV+E
Sbjct: 544  ELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSE 603

Query: 1822 EYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTI 2001
            E G  LG +VGY IRFEDCTS++T+IKYMTDG+LLRE L + DL  YS +++DEAHER++
Sbjct: 604  EMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAVIMDEAHERSL 663

Query: 2002 HTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREP 2181
            +TDVLFGLL+    +R +LKLI+TSAT+D+ KF+ +F   PIF IPGRTFPV+IL+++ P
Sbjct: 664  NTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTP 723

Query: 2182 ESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPV 2361
            + DY+EAA    +Q+HL+  PGD+L+F+ GQE+I+ + + + E ++ +  + P L +LP+
Sbjct: 724  QEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEEL-ENAPALAVLPI 782

Query: 2362 YGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMD 2541
            Y  LPS++Q +IF  AP G RK ++ATNIAETSLT+DGI +V+D G+ K K++NP+ GMD
Sbjct: 783  YSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMD 842

Query: 2542 SLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQL 2721
            +L + PISQA A QRSGRAGRTGPG   R  T          T VPEIQRTNLA+ +L L
Sbjct: 843  ALQIYPISQANANQRSGRAGRTGPGSTRRALTRTT-------TTVPEIQRTNLANVVLLL 895

Query: 2722 KAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKL 2901
            K++G+ +L+ F FMD PP D+M+ ++  L  L ALD  G LT  GR M EFPL+P+LSK+
Sbjct: 896  KSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKM 955

Query: 2902 LIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSW 3081
            LI+S D+GCS E+L IV+ML+V  IFYRPK +++ +DQ + KF  PE DHLT L VY  W
Sbjct: 956  LIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQW 1015

Query: 3082 KNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFF 3261
            KN+++S  WC ++FI  ++M++ +++R QL  IM + ++ + SCG D   V+K IC+ +F
Sbjct: 1016 KNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYF 1075

Query: 3262 RNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTKEYMREVTAIDP 3435
              AAK      Y  +  G   ++HP+S+ F     P+++VYHELVMTTKEYM+ VTA+D
Sbjct: 1076 HQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDG 1135

Query: 3436 KWLVEFAPSFFKIGDSTK 3489
            +WL E  P F+ +  + K
Sbjct: 1136 EWLAELGPMFYSVKQAGK 1153


>gi|50546395|ref|XP_500667.1| hypothetical protein [Yarrowia
            lipolytica]
 gi|49646533|emb|CAG82909.1| unnamed protein product [Yarrowia
            lipolytica CLIB99]
          Length = 1077

 Score =  684 bits (1764), Expect = 0.0
 Identities = 372/840 (44%), Positives = 529/840 (62%), Gaps = 10/840 (1%)
 Frame = +1

Query: 1111 WELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDE-PDFLRGYGKGGA 1287
            WE  QM G GV++           G  + Y             V +  P FL G
Sbjct: 257  WEQNQMSGGGVMS-----------GEAQQYDAMDEVDNAIHISVNNLIPPFLDGQQVFTR 305

Query: 1288 EIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFSSNARILDPMSG 1467
            + +PV  V++    LA  A     L K+R++ + +A++ +D  + +G      +L  +
Sbjct: 306  QKDPVSAVRDVQSDLAILAKRGSQLVKDRRQLRERAKQVKDASSTQG-----TVLGLVDE 360

Query: 1468 NQSTAWSADESKDR----NNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFAL 1635
             ++    A+  K++      ++KE PE                  L+  E R  LP FA+
Sbjct: 361  KKAEETKAEVKKEKLIEVKTEVKEDPEV-------------ESKPLTPKEARTLLPAFAV 407

Query: 1636 KKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRV 1815
            +  L++ +  NQ+ +V+GETGSGKTTQ+TQY  EAG   RG IGCTQPRRVAAMSVA+RV
Sbjct: 408  RDPLLQVIQSNQVTIVIGETGSGKTTQLTQYLYEAGYAERGMIGCTQPRRVAAMSVAQRV 467

Query: 1816 AEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHER 1995
            ++E   ++G +VGY IRFED TS  T IKY+TDG+LLRE L DP L  YS +++DEAHER
Sbjct: 468  SQEMEVRVGQEVGYAIRFEDHTSPATKIKYLTDGILLRETLTDPTLDNYSCVIMDEAHER 527

Query: 1996 TIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTR 2175
             ++TD+L GL +    KR +LKLI+TSAT++S +FS++F  AP FTIPGRT+PV + + R
Sbjct: 528  ALNTDILLGLFRTILAKRRDLKLIVTSATMNSKRFSDFFGGAPTFTIPGRTYPVSVHHER 587

Query: 2176 EPESDYLEAAHITVMQIHLTEP--PGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELI 2349
             P  DY+ AA   V+ IH++     GD+LVF+TGQE+I  +CEVL ER++    +   L+
Sbjct: 588  APVDDYVAAAVKKVLSIHVSSEVSTGDILVFMTGQEDITVTCEVLEERLQKDLDNPAPLM 647

Query: 2350 ILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPK 2529
            ILP++  +P+++Q +IF+ AP G RK ++ATNIAETSLT+DGI +VVD G+ K K+Y+PK
Sbjct: 648  ILPIFSQMPADLQNKIFNKAPPGVRKCIVATNIAETSLTVDGITFVVDAGYSKLKVYSPK 707

Query: 2530 SGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLAST 2709
            +GMDSL V PIS A A QRSGRAGRT  G  YRLYTE A R+EM PT +PEIQRTNLA+T
Sbjct: 708  TGMDSLQVAPISVAQAVQRSGRAGRTAKGTAYRLYTEHAEREEMYPTAIPEIQRTNLANT 767

Query: 2710 LLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPS 2889
            LL LK++G+ +L+ F FMD PP D+++ +L  L +L A+D  G +T+LG +M++FP++P
Sbjct: 768  LLLLKSVGVTDLMKFAFMDPPPKDTIMASLYELWSLGAVDNLGNITQLGMKMSQFPMDPC 827

Query: 2890 LSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAV 3069
            L K+LI SVD GCS+E+L++VAML V  +FYRP E+Q  AD  + KF  PE DHLTLL V
Sbjct: 828  LGKILIKSVDYGCSKEMLSVVAMLCVPTVFYRPPERQQEADSAREKFFVPESDHLTLLHV 887

Query: 3070 YNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAIC 3249
            Y  W ++  S  WC ++F+  +++++A ++R+QL  IM  +K+ + SCG D   ++K IC
Sbjct: 888  YTQWLHNKKSPVWCAKHFLHAKALEKAHEVREQLEQIMTTNKMHIDSCGTDWDLLRKCIC 947

Query: 3250 SGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF--QQQPEWVVYHELVMTTKEYMREVT 3423
            +GFF  AA+      YR L    +  +HP+SA +     P +VVYHEL++T+KEYM  VT
Sbjct: 948  AGFFHQAARVHGLGSYRNLRTLVSTQLHPTSALYGLGYLPAFVVYHELILTSKEYMSCVT 1007

Query: 3424 AIDPKWLVEFAPSFFKIGDSTKLSTFKRNQK-IDPLFDKYADANAWRITRVKKRIYNPNK 3600
            ++DP WL EF   F+ + D T    F R +  ++ L +   D+       VKK +    K
Sbjct: 1008 SVDPAWLAEFGSCFYVLKDRTGKVDFSRKRAGLERLLE--VDSKRQEEKEVKKEVKKEEK 1065


>gi|32421753|ref|XP_331320.1| hypothetical protein [Neurospora crassa]
 gi|28922320|gb|EAA31559.1| hypothetical protein [Neurospora crassa]
 gi|28950131|emb|CAD70989.1| probable pre-mRNA splicing protein PRP2
            [Neurospora crassa]
          Length = 917

 Score =  681 bits (1756), Expect = 0.0
 Identities = 353/658 (53%), Positives = 465/658 (70%), Gaps = 11/658 (1%)
 Frame = +1

Query: 1564 KATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAG 1743
            K     R   S+ E R+SLP++A +   ++A+ + Q+L++VGETGSGKTTQ+ QY  EAG
Sbjct: 253  KIEAAERAAKSIQEVRKSLPVYAYRDAFLDAIKEYQVLILVGETGSGKTTQIPQYLHEAG 312

Query: 1744 LGRRG-KIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGM 1920
                G K+ CTQPRRVAAMSVA RVA+E G K+G +VGY+IRFEDCTS  TI+KYMTDGM
Sbjct: 313  YTEGGMKVACTQPRRVAAMSVAARVADEMGVKVGREVGYSIRFEDCTSDKTILKYMTDGM 372

Query: 1921 LLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKF 2100
            LLRE +  P L GYS IM+DEAHERT+HTD+L  L+K   R RP+LKLII+SATL++ KF
Sbjct: 373  LLREMVTSPTLEGYSAIMIDEAHERTVHTDILLALIKDLTRARPDLKLIISSATLNAEKF 432

Query: 2101 SEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEE 2280
            S YF +APIF +PGR  PV++ YT  PES+YLEA+ +TV QIH T+P G +LVFLTGQEE
Sbjct: 433  STYFDDAPIFNVPGRVHPVDVYYTSAPESNYLEASLVTVFQIHATQPEGGILVFLTGQEE 492

Query: 2281 IDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETS 2460
            ID +CE + E  K +G  VPE+I LP+Y  +PSE+Q +IF+P P G RKVV +TNIAETS
Sbjct: 493  IDKACERVEEIKKKLGGRVPEIIPLPIYANMPSELQAKIFEPTPPGARKVVFSTNIAETS 552

Query: 2461 LTIDGIFYVVDPGFVKQKIYNP--KSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLY 2634
            LTIDGI YV+D G+VK+  ++P   +G  +L V P S+AAA QR GRAGR  PGKC+RLY
Sbjct: 553  LTIDGIVYVIDCGYVKENTFSPVGTTGQSTLAVVPCSRAAANQRMGRAGRVRPGKCFRLY 612

Query: 2635 TERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHT 2814
            T+ A+  EM  +P PEIQRT+L+S +LQLKA+GI +L+ FDF+D PP + +I +LN L+
Sbjct: 613  TKFAYLSEMDESPTPEIQRTSLSSVVLQLKALGIEDLLGFDFLDPPPTELLIKSLNMLYA 672

Query: 2815 LSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAML-NVQNIFYRPK 2991
            L AL+  G LT++GR+M EFP EP L+K LI +   GC +E+LTIV+ML  V  +F+RPK
Sbjct: 673  LGALNSAGQLTRVGRQMGEFPAEPMLAKALIAATAEGCVDEMLTIVSMLGEVATLFFRPK 732

Query: 2992 EKQDHADQKKAKFHQPE-GDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQ 3168
            +K+ HAD  +A+F   + GDHLTLL VYN W +  +S  W  ENF+  RS+ RA+D+R Q
Sbjct: 733  DKKVHADSARARFTVKDGGDHLTLLNVYNQWVDADYSPIWAKENFLTQRSLTRARDVRDQ 792

Query: 3169 LLGIMDRHKLLMVSCGRDVSRVQ---KAICSGFFRNAAKRD-PQEGYRTLTDGQNVYIHP 3336
            L  + DR      S    VS +Q   +A+ + FF NAA+ +   +GYRTL +   VY+HP
Sbjct: 793  LAKLCDRVLEGSTSTCGGVSNMQPILRALTAAFFLNAARLNRGGDGYRTLKNNMTVYVHP 852

Query: 3337 SSAC--FQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFK 3504
            SS        P+ ++YHELV+TTKE++R V  IDPKWL EF   ++   D   ++  K
Sbjct: 853  SSVVKGMDPPPKVIIYHELVVTTKEFVRSVIPIDPKWLTEFGGHYYDAKDVESMTVKK 910


>gi|49118496|gb|AAH73477.1| Unknown (protein for MGC:80994) [Xenopus
            laevis]
          Length = 793

 Score =  678 bits (1749), Expect = 0.0
 Identities = 357/587 (60%), Positives = 436/587 (73%), Gaps = 6/587 (1%)
 Frame = +1

Query: 685  EVAEIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENV 861
            E   IG IY+G+V SI  FG F+ LEG R++ EGLVHIS++R E RV  VADV+ +G+ V
Sbjct: 216  EEPAIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRV 275

Query: 862  KVKVNKIENGKISLSMKEVDQNSGEDLNPRET-----DLNPDAIGVRPRTPPASTSSWMN 1026
            K+KV      K SLSMK+V+Q++GEDLNP        D N +A  +R    P   S
Sbjct: 276  KIKVLSFTGCKTSLSMKDVNQDTGEDLNPNRRRNLIGDGNEEA-SMRNPDRPTHLSLVNA 334

Query: 1027 PEASGVGQGPSTSIGGGKARVRISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXX 1206
            PE               K   +IS PE+WE++QM  A VL+  + PDFDEE G+L
Sbjct: 335  PEVED-------DTLERKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDD 387

Query: 1207 XXXXXXXXXXLVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETK 1386
                      LVE+EP FLRG+ K   ++ P+K+VKNPDGSL+QAA+MQ AL+KER+E K
Sbjct: 388  EEDEDLEIE-LVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERREVK 446

Query: 1387 IQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGK 1566
             QAQRE +MD+      N   +DP+        +A+  +       ++PEW KH   G K
Sbjct: 447  -QAQREAEMDSIP-MGLNKHWVDPLPDVDGRQIAAN-MRGIGMMPNDIPEWKKHAFGGNK 503

Query: 1567 ATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGL 1746
            A+YG++T +S++EQRESLPI+ LK+ L++A+ DNQIL+V+GETGSGKTTQ+TQY  EAG
Sbjct: 504  ASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGY 563

Query: 1747 GRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLL 1926
              RGKIGCTQPRRVAAMSVAKRV+EEYGC LG +VGYTIRFEDCTS +T+IKYMTDGMLL
Sbjct: 564  TTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLL 623

Query: 1927 RECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSE 2106
            RECLIDPDL+ Y++IMLDEAHERTIHTDVLFGLLK   +KR ++KLI+TSATLD+VKFS+
Sbjct: 624  RECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQ 683

Query: 2107 YFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEID 2286
            YF EAPIFTIPGRT+PVEILYT+EPE+DYL+A+ ITVMQIHLTEPPGD+LVFLTGQEEID
Sbjct: 684  YFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEID 743

Query: 2287 TSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRK 2427
            T+CE+LYERMKS+GPDVPELIILPVY ALPSEMQTRIFDPAP G RK
Sbjct: 744  TACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRK 790



 Score = 80.1 bits (196), Expect = 4e-13
 Identities = 55/154 (35%), Positives = 88/154 (56%), Gaps = 6/154 (3%)
 Frame = +1

Query: 1   MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDD 180
           + +LE+LSLVSKV +E++NH G+ +KD+AEFVI LA+++ +F+  K AL+  G   +F D
Sbjct: 4   LQKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKSTSFEIFKSALEKNGA--EFTD 61

Query: 181 SLTATILRIVQSMTAVXXXXXXGGDSKEDIKDSHKITLI--SDAKEEIKARLPALAMAN- 351
           SL + +LR++Q+M                   + K TLI  +  KE++K   PAL  A+
Sbjct: 62  SLISNLLRLIQTMRPPAK------------PSTSKETLIKPNGEKEKLKELFPALCRADN 109

Query: 352 -TAKEKEDNEDDLMA--QLEKMEGRYESEKRLQK 444
            T +   D ED  +A   L+++E     E++  K
Sbjct: 110 PTVRTMLDPEDVKVAADALQELEALMPKEEKSSK 143


>gi|34851735|ref|XP_238048.2| similar to RIKEN cDNA 5730550P09 [Rattus
            norvegicus]
          Length = 1279

 Score =  677 bits (1746), Expect = 0.0
 Identities = 358/798 (44%), Positives = 516/798 (63%), Gaps = 3/798 (0%)
 Frame = +1

Query: 1105 ERWELRQMQGAGVLTATDMPDFDEEMGVLRNYXXXXXXXXXXXXLVEDEPDFLRGYGKGG 1284
            ERWE  +M  +GV+   ++ +  EE    + +                 P FL G
Sbjct: 375  ERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLV----------PPFLDGRIVFT 424

Query: 1285 AEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQRERDMDTQKGFS-SNARILDPM 1461
             + EPV  VK+    LA  A       ++ +E     Q+ER     K +  +  ++ D M
Sbjct: 425  KQPEPVIPVKDATSDLAIIARKGSQTVRKHRE-----QKERRKAQHKHWELAGTKLGDIM 479

Query: 1462 SGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGRRTNLSMVEQRESLPIFALKK 1641
               +        ++D     +   ++  H+    +A+       S++EQR+ LPIFA+++
Sbjct: 480  GVKKEEEPDKAMTEDGKVDYRTEQKFADHMKEKSEASSEFAKKKSILEQRQYLPIFAVQQ 539

Query: 1642 NLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAE 1821
             L+  + DN I++VVGETGSGKTTQ+TQY  + G    G IGCTQPRRVAAMSVAKRV+E
Sbjct: 540  ELLTIIRDNSIVIVVGETGSGKTTQLTQYLHQDGYTDYGMIGCTQPRRVAAMSVAKRVSE 599

Query: 1822 EYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTI 2001
            E G  LG +VGY IRFEDCTS++T+IKYMTDG+LLRE L + DL  YS I++DEAHER++
Sbjct: 600  EMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAIIMDEAHERSL 659

Query: 2002 HTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREP 2181
            +TDVLFGLL+    +R +LKLI+TSAT+D+ KF+ +F   PIF IPGRTFPV+IL+++ P
Sbjct: 660  NTDVLFGLLREVVARRSDLKLIVTSATMDADKFAAFFGNVPIFHIPGRTFPVDILFSKTP 719

Query: 2182 ESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPV 2361
            + DY+EAA    +Q+HL+  PGD+L+F+ GQE+I+ + + + E ++ +  + P L +LP+
Sbjct: 720  QEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEEL-ENAPALAVLPI 778

Query: 2362 YGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMD 2541
            Y  LPS++Q +IF  AP G RK ++ATNIAETSLT+DGI +V+D G+ K K++NP+ GMD
Sbjct: 779  YSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMD 838

Query: 2542 SLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQL 2721
            +L + PISQA A Q              RLYT+ A+++E+L T VPEIQRTNLA+ +L L
Sbjct: 839  ALQIYPISQANANQ--------------RLYTQSAYKNELLTTTVPEIQRTNLANVVLLL 884

Query: 2722 KAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKL 2901
            K++G+ +L+ F FMD PP D+M+ ++  L  L ALD  G LT  GR M EFPL+P+LSK+
Sbjct: 885  KSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKM 944

Query: 2902 LIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSW 3081
            LI+S D+GCS E+L IV+ML+V  IFYRPK +++ +DQ + KF  PE DHLT L VY  W
Sbjct: 945  LIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQW 1004

Query: 3082 KNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFF 3261
            KN+++S  WC ++FI  ++M++ +++R QL  IM + ++ + SCG D   V+K IC+ +F
Sbjct: 1005 KNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYF 1064

Query: 3262 RNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQ--QPEWVVYHELVMTTKEYMREVTAIDP 3435
              AAK      Y  +  G   ++HP+S+ F     P+++VYHELVMTTKEYM+ VTA+D
Sbjct: 1065 HQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDG 1124

Query: 3436 KWLVEFAPSFFKIGDSTK 3489
            +WL E  P F+ +  + K
Sbjct: 1125 EWLAELGPMFYSVKQAGK 1142


>gi|15226549|ref|NP_182247.1| RNA helicase, putative [Arabidopsis
            thaliana]
 gi|3913425|sp|O22899|DD15_ARATH Putative pre-mRNA splicing factor
            ATP-dependent RNA helicase
 gi|25409033|pir||H84912 probable pre-mRNA splicing factor RNA
            helicase [imported] - Arabidopsis thaliana
 gi|2275203|gb|AAB63825.1| putative pre-mRNA splicing factor RNA
            helicase [Arabidopsis thaliana]
 gi|22135845|gb|AAM91108.1| At2g47250/T8I13.9 [Arabidopsis thaliana]
 gi|28416499|gb|AAO42780.1| At2g47250/T8I13.9 [Arabidopsis thaliana]
          Length = 729

 Score =  677 bits (1746), Expect = 0.0
 Identities = 339/657 (51%), Positives = 473/657 (71%), Gaps = 17/657 (2%)
 Frame = +1

Query: 1561 GKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEA 1740
            GKA Y +R    ++E+R  LP++  K + +  +  NQ L++VGETGSGKTTQ+ Q+ ++A
Sbjct: 48   GKA-YSQRY-FEILEKRRDLPVWLQKDDFLNTLNSNQTLILVGETGSGKTTQIPQFVLDA 105

Query: 1741 GL------GRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIK 1902
             +      GR+  +GCTQPRRVAAMSV++RVA+E    +G +VGY+IRFEDCTS  T++K
Sbjct: 106  VVADNSDKGRKWLVGCTQPRRVAAMSVSRRVADEMDVSIGEEVGYSIRFEDCTSSRTMLK 165

Query: 1903 YMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSAT 2082
            Y+TDGMLLRE + DP L  Y +I+LDEAHERT+ TDVLFGLLK   R RP+LKL++ SAT
Sbjct: 166  YLTDGMLLREAMADPLLERYKVIILDEAHERTLATDVLFGLLKEVLRNRPDLKLVVMSAT 225

Query: 2083 LDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVF 2262
            L++ KF EYF  AP+  +PGR  PVEI YT+EPE DYLEAA  TV+QIH+ EPPGD+LVF
Sbjct: 226  LEAEKFQEYFSGAPLMKVPGRLHPVEIFYTQEPERDYLEAAIRTVVQIHMCEPPGDILVF 285

Query: 2263 LTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPA-------GK 2421
            LTG+EEI+ +C  + + + ++G  V  + ++P+Y  LP  MQ +IFDPAP
Sbjct: 286  LTGEEEIEDACRKINKEVSNLGDQVGPVKVVPLYSTLPPAMQQKIFDPAPVPLTEGGPAG 345

Query: 2422 RKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAG 2601
            RK+V++TNIAETSLTIDGI YV+DPGF KQK+YNP+  ++SL+V+PIS+A+A QRSGRAG
Sbjct: 346  RKIVVSTNIAETSLTIDGIVYVIDPGFAKQKVYNPRIRVESLLVSPISKASAHQRSGRAG 405

Query: 2602 RTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLD 2781
            RT PGKC+RLYTE++F +++ P   PEI R+NLA+T+L LK +GI++L+ FDFMD P  +
Sbjct: 406  RTRPGKCFRLYTEKSFNNDLQPQTYPEILRSNLANTVLTLKKLGIDDLVHFDFMDPPAPE 465

Query: 2782 SMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAML 2961
            +++ AL  L+ L ALD +G LTK G  M+EFPL+P +SK+LI+S +  CS E+L++ AML
Sbjct: 466  TLMRALEVLNYLGALDDEGNLTKTGEIMSEFPLDPQMSKMLIVSPEFNCSNEILSVSAML 525

Query: 2962 NVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSM 3141
            +V N F RP+E Q  AD+ KA+F   +GDHLTLL VY+++K ++    WCFENF+  R+M
Sbjct: 526  SVPNCFVRPREAQKAADEAKARFGHIDGDHLTLLNVYHAYKQNNEDPNWCFENFVNNRAM 585

Query: 3142 KRAQDIRKQLLGIMDRHKLLMVSC---GRD-VSRVQKAICSGFFRNAAKRDPQEGYRTLT 3309
            K A ++R+QL+ IM R  L M S     RD    ++KA+ +G+F   A  +    Y T+
Sbjct: 586  KSADNVRQQLVRIMSRFNLKMCSTDFNSRDYYVNIRKAMLAGYFMQVAHLERTGHYLTVK 645

Query: 3310 DGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGD 3480
            D Q V++HPS+ C   +PEWV+Y+E V+TT+ ++R VT I  +WLV+ A  ++ + +
Sbjct: 646  DNQVVHLHPSN-CLDHKPEWVIYNEYVLTTRNFIRTVTDIRGEWLVDVAQHYYDLSN 701


>gi|15228730|ref|NP_191790.1| RNA helicase, putative [Arabidopsis
            thaliana]
 gi|11346355|pir||T48023 ATP-dependent RNA helicase-like protein -
            Arabidopsis thaliana
 gi|7340702|emb|CAB82945.1| ATP-dependent RNA helicase-like protein
            [Arabidopsis thaliana]
 gi|21539575|gb|AAM53340.1| ATP-dependent RNA helicase-like protein
            [Arabidopsis thaliana]
 gi|34098783|gb|AAQ56774.1| At3g62310 [Arabidopsis thaliana]
          Length = 726

 Score =  670 bits (1728), Expect = 0.0
 Identities = 336/664 (50%), Positives = 475/664 (70%), Gaps = 17/664 (2%)
 Frame = +1

Query: 1597 MVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEA------GLGRRG 1758
            ++E+R +LP++  K+  ++ + +NQ L++VGETGSGKTTQ+ Q+ I+A         R+
Sbjct: 54   ILEKRRTLPVWLQKEEFLKTLNNNQTLILVGETGSGKTTQIPQFVIDAVDAETSDKRRKW 113

Query: 1759 KIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECL 1938
             +GCTQPRRVAAMSV++RVAEE    +G +VGY+IRFEDC+S  T++KY+TDGMLLRE +
Sbjct: 114  LVGCTQPRRVAAMSVSRRVAEEMDVTIGEEVGYSIRFEDCSSPRTVLKYLTDGMLLREAM 173

Query: 1939 IDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLE 2118
             DP L  Y +I+LDEAHERT+ TDVLFGLLK   + RP+LKL++ SATL++ KF +YF
Sbjct: 174  ADPLLERYKVIILDEAHERTLATDVLFGLLKEVLKNRPDLKLVVMSATLEAEKFQDYFSG 233

Query: 2119 APIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCE 2298
            AP+  +PGR  PVEI YT+EPE DYLEAA  TV+QIH+ EPPGD+LVFLTG+EEI+ +C
Sbjct: 234  APLMKVPGRLHPVEIFYTQEPERDYLEAAIRTVVQIHMCEPPGDILVFLTGEEEIEDACR 293

Query: 2299 VLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGK-------RKVVIATNIAET 2457
             + + + ++G  V  + ++P+Y  LP  MQ +IFDPAP          RK+V++TNIAET
Sbjct: 294  KINKEVGNLGDQVGPIKVVPLYSTLPPAMQQKIFDPAPEPVTEGGPPGRKIVVSTNIAET 353

Query: 2458 SLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYT 2637
            SLTIDGI YV+DPGF KQK+YNP+  ++SL+V+PIS+A+A QRSGRAGRT PGKC+RLYT
Sbjct: 354  SLTIDGIVYVIDPGFAKQKVYNPRIRVESLLVSPISKASAHQRSGRAGRTRPGKCFRLYT 413

Query: 2638 ERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTL 2817
            E++F +++ P   PEI R+NLA+T+L LK +GI++L+ FDFMD P  ++++ AL  L+ L
Sbjct: 414  EKSFNNDLQPQTYPEILRSNLANTVLTLKKLGIDDLVHFDFMDPPAPETLMRALEVLNYL 473

Query: 2818 SALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEK 2997
             ALD DG LTK G  M+EFPL+P ++K+LI+S +  CS E+L++ AML+V N F RP+E
Sbjct: 474  GALDDDGNLTKTGEIMSEFPLDPQMAKMLIVSPEFNCSNEILSVSAMLSVPNCFIRPREA 533

Query: 2998 QDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLG 3177
            Q  AD+ KA+F   EGDHLTLL VY+++K ++    WC+ENFI  R+MK A ++R+QL+
Sbjct: 534  QKAADEAKARFGHIEGDHLTLLNVYHAFKQNNEDPNWCYENFINNRAMKSADNVRQQLVR 593

Query: 3178 IMDRHKLLMVSC---GRD-VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSA 3345
            IM R  L M S     RD    ++KA+ +G+F   A  +    Y T+ D Q V++HPS+
Sbjct: 594  IMSRFNLKMCSTDFNSRDYYINIRKAMLAGYFMQVAHLERTGHYLTVKDNQVVHLHPSN- 652

Query: 3346 CFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDP 3525
            C   +PEWV+Y+E V+T++ ++R VT I  +WLV+ A  ++   D +     +  + I+
Sbjct: 653  CLDHKPEWVIYNEYVLTSRNFIRTVTDIRGEWLVDVASHYY---DLSNFPNCEAKRVIEK 709

Query: 3526 LFDK 3537
            L+ K
Sbjct: 710  LYKK 713


>gi|11346341|pir||T46568 ATP-dependent RNA helicase cdc28 [similarity]
            - fission yeast (Schizosaccharomyces pombe)
 gi|1439562|gb|AAC49377.1| Cdc28p
          Length = 968

 Score =  668 bits (1724), Expect = 0.0
 Identities = 329/602 (54%), Positives = 456/602 (75%), Gaps = 4/602 (0%)
 Frame = +1

Query: 1594 SMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGK-IGC 1770
            S+   R+SLP++  K +L++A+ + Q+L++V ETGSGKTTQ+ Q+  EAG  +  K I C
Sbjct: 363  SLESSRKSLPVYQYKDDLLKAINEYQVLLIVAETGSGKTTQLPQFLHEAGYTKGNKKICC 422

Query: 1771 TQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPD 1950
            TQPRRVAAMSVA RVA+E   +LG +VGY+IRFE+ TS+ T+IKY+TDGMLLRE L +PD
Sbjct: 423  TQPRRVAAMSVAARVAKEMDVRLGQEVGYSIRFENATSEKTVIKYLTDGMLLREFLTEPD 482

Query: 1951 LSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIF 2130
            L+ YS+I++DEAHERT+HTD+LFGL+K  AR RP+LK++I+SAT+D+ KFS YF EAP+F
Sbjct: 483  LASYSVIIIDEAHERTLHTDILFGLVKDIARFRPDLKVLISSATIDAEKFSAYFDEAPVF 542

Query: 2131 TIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYE 2310
             +PGR +PV+I YT +PE++Y++AA  T++QIH T+P GD+LVFLTGQ+EI+   E + E
Sbjct: 543  YVPGRRYPVDIYYTPQPEANYIQAAITTILQIHTTQPAGDILVFLTGQDEIELMSENMQE 602

Query: 2311 RMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVV 2490
              + +G  +PE+I+ P+Y  LPSE+Q +IFDP P G RKVV+ATNIAETS+TIDG+ +V+
Sbjct: 603  LCRILGKRIPEIILCPIYANLPSELQAKIFDPTPPGARKVVLATNIAETSITIDGVNFVI 662

Query: 2491 DPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPT 2670
            D GFVKQ +YNP++GM+SLV  P S+A+A QR+GRAGR GPGKC+RLYT   + +E+
Sbjct: 663  DSGFVKQNMYNPRTGMESLVSVPCSRASADQRAGRAGRVGPGKCFRLYTRWTYNNELDMV 722

Query: 2671 PVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTK 2850
              PEIQRTNL + +L LK++GINNL+DFDFMDAPP ++++ +L  L+ L AL+  G LTK
Sbjct: 723  TSPEIQRTNLTNIVLLLKSLGINNLLDFDFMDAPPPETLMRSLELLYALGALNNRGELTK 782

Query: 2851 LGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAML-NVQNIFYRPKEKQDHADQKKAK 3027
            LGR+MAEFP +P LSK LI S   GC EEVL+IV+ML    ++FYRPK+K   AD+ +A
Sbjct: 783  LGRQMAEFPTDPMLSKSLIASSKYGCVEEVLSIVSMLGEASSLFYRPKDKIMEADKARAN 842

Query: 3028 FHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKL-LM 3204
            F QP GDHLTLL ++N W +  FS  W  ENF+Q +S+ RA+D+R QL  + +R ++ L+
Sbjct: 843  FTQPGGDHLTLLHIWNEWVDTDFSYNWARENFLQYKSLCRARDVRDQLANLCERVEIELV 902

Query: 3205 VSCGRDVSRVQKAICSGFFRNAAKRDPQ-EGYRTLTDGQNVYIHPSSACFQQQPEWVVYH 3381
             +    +  ++KAI +G+F NAA+ D   + YRT+   Q VYIHPSS+  +++P+ ++Y
Sbjct: 903  TNSSESLDPIKKAITAGYFPNAARLDRSGDSYRTVKSNQTVYIHPSSSVAEKKPKVIIYF 962

Query: 3382 EL 3387
            EL
Sbjct: 963  EL 964


>gi|31201101|ref|XP_309498.1| ENSANGP00000021966 [Anopheles gambiae]
 gi|21293004|gb|EAA05149.1| ENSANGP00000021966 [Anopheles gambiae str.
            PEST]
          Length = 767

 Score =  664 bits (1713), Expect = 0.0
 Identities = 344/717 (47%), Positives = 484/717 (66%), Gaps = 12/717 (1%)
 Frame = +1

Query: 1366 KERKETKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLK 1545
            K+R+E K  A+      + K  +  +    P S +++ A +A       +  K     +
Sbjct: 36   KKRREEKAAAEGAAGASSSKLDAGGSSSSGPSSASKAAAAAAAAGSATESGGKNPLNGIA 95

Query: 1546 HVTAGGKATYGRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQ 1725
            +           +    + ++R +LP+F  K + M  + ++Q +V+VGETGSGKTTQ+ Q
Sbjct: 96   YT----------QNYYKLYKKRITLPVFEYKTDFMRLLSEHQCIVLVGETGSGKTTQIPQ 145

Query: 1726 YAIEAGLGRRGK-IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIK 1902
            + +E  L    K + CTQPRRVAAMSVA+RV+EE    LG +VGY+IRFEDC+S  T++K
Sbjct: 146  WCVEYALQTSSKGVACTQPRRVAAMSVAQRVSEEMDVMLGQEVGYSIRFEDCSSPRTLLK 205

Query: 1903 YMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSAT 2082
            YMTDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L G+LK   R+R +LKL++ SAT
Sbjct: 206  YMTDGMLLREGMSDPMLEAYQVILLDEAHERTLATDLLMGVLKEVIRQRKDLKLVVMSAT 265

Query: 2083 LDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEP-PGDVLV 2259
            LD+ KF +YF  AP+  +PGRT PVEI YT EPE DYLEAA  TV+QIH+ E   GD+L+
Sbjct: 266  LDAGKFQQYFDNAPLMNVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILM 325

Query: 2260 FLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGK------ 2421
            FLTGQEEI+ +C+ +   + ++GPDV EL  +P+Y  LP  MQ +IF+PAP  +
Sbjct: 326  FLTGQEEIEEACKRVKREIDNLGPDVGELKCIPLYSTLPPPMQQKIFEPAPPKRPNGAIG 385

Query: 2422 RKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAG 2601
            RKVVI+TNIAETSLTIDG+ +V+DPGF KQK+YNP+  ++SL+V+PIS+A+A+QR+GRAG
Sbjct: 386  RKVVISTNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAG 445

Query: 2602 RTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLD 2781
            RT PGKC+RLYTE+A++ EM     PEI R+NL + +LQLK +GI++L+ FDFMD P  +
Sbjct: 446  RTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPE 505

Query: 2782 SMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAML 2961
            +++ AL  L+ L+ALD DG LT LG  MAEFPL+P L+K+LI S    CS E+L+I AML
Sbjct: 506  TLMRALELLNYLAALDDDGNLTDLGAVMAEFPLDPQLAKMLIASCQHNCSNEILSITAML 565

Query: 2962 NVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSM 3141
            +V   F RP E +  AD  K +F   +GDHLTLL VY+++K ++  Q WC++NFI  RS+
Sbjct: 566  SVPQCFVRPNEMKKAADDAKMRFAHVDGDHLTLLNVYHAFKQNNEDQGWCYDNFINYRSL 625

Query: 3142 KRAQDIRKQLLGIMDRHKLLMVSCG----RDVSRVQKAICSGFFRNAAKRDPQEGYRTLT 3309
            K A ++R+QL  IMDR +L   S           ++KA+  GFF   A  +  + Y+T+
Sbjct: 626  KSADNVRQQLARIMDRFQLQRTSTDFTSREYYFNIRKALVQGFFMQVAHLERTKHYQTIK 685

Query: 3310 DGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGD 3480
            D Q V +HPS+ C   +PEWV+Y+E V+TTK Y+R VT + P+WL++ AP ++ + +
Sbjct: 686  DNQVVQLHPST-CLDHKPEWVIYNEFVLTTKNYIRTVTDVKPEWLLQIAPQYYDMNN 741


>gi|50302815|ref|XP_451344.1| unnamed protein product [Kluyveromyces
            lactis]
 gi|49640475|emb|CAH02932.1| unnamed protein product [Kluyveromyces
            lactis NRRL Y-1140]
          Length = 1064

 Score =  656 bits (1692), Expect = 0.0
 Identities = 347/716 (48%), Positives = 481/716 (66%), Gaps = 15/716 (2%)
 Frame = +1

Query: 1372 RKETKIQAQRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHV 1551
            R+ +K+ A R    D +K  S NA  L   +  +      D S D   K    P  +K
Sbjct: 275  RRGSKLVAMRRIHRD-RKSKSQNATELKGSALGKVLGVKQDSSTDAQTKQPNQPIAIKE- 332

Query: 1552 TAGGKATYGRRTNLSMVEQ-RESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQY 1728
                     +  +   ++  R SLP + ++ +LM  + DNQI VV+GETGSGKTTQ+ Q+
Sbjct: 333  ---------KEQSFEEIQAVRRSLPAYKVRHDLMRHIRDNQITVVIGETGSGKTTQLAQF 383

Query: 1729 AIEAGLGRRGK-IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKY 1905
              E G    G+ IGCTQPRRVAA+SVA+RV++E    +G  VGY+IRFED TS  T IK+
Sbjct: 384  LYEDGFTANGRMIGCTQPRRVAAVSVAERVSKEMDTPIGVKVGYSIRFEDQTSDSTKIKF 443

Query: 1906 MTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATL 2085
            MTDG+LLRE +IDP L  YS I++DEAHER+++TDVL G+ K    +R +LKL++TSAT+
Sbjct: 444  MTDGILLREAMIDPLLEKYSCIIMDEAHERSLNTDVLLGIFKTLLARRHDLKLVVTSATM 503

Query: 2086 DSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEP--PGDVLV 2259
            ++ KFS++F  AP + IPG+TFPVEI+YT  P  DY+E+A    + IHL+ P   GD+L+
Sbjct: 504  NADKFSQFFGNAPQYFIPGKTFPVEIIYTNHPVPDYVESAVQKALDIHLSTPISNGDILI 563

Query: 2260 FLTGQEEIDTSCEVLYERM-----KSMGPDVPELI----ILPVYGALPSEMQTRIFDPAP 2412
            F+TGQE+I+ +C  + ER+     K  G +  E +    +LP+Y +LP+++Q RIF
Sbjct: 564  FMTGQEDIEATCSTIIERLTEIYTKKYGANYEEQLADVQVLPIYSSLPADVQGRIFQRQE 623

Query: 2413 AGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSG 2592
               RK+V+ATNIAETSLT+DGI YV+D G+ K K+YNPK G+DSL +TPIS A A QRSG
Sbjct: 624  QNVRKIVVATNIAETSLTVDGIKYVIDCGYSKLKVYNPKIGLDSLRITPISLANANQRSG 683

Query: 2593 RAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAP 2772
            RAGRTGPG  YRL+T  +  ++M P  +PEIQRTNLA+TLLQLK++ INNL  F F+D P
Sbjct: 684  RAGRTGPGIAYRLFTHDSAMEDMYPQAIPEIQRTNLANTLLQLKSLNINNLSKFPFIDPP 743

Query: 2773 PLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIV 2952
            P  +++T+L  L  L ALD  G LTKLGR M  FPL+P LS++LI +   GC+EE+LTIV
Sbjct: 744  PSQNLMTSLYDLWALEALDNFGHLTKLGRLMGAFPLQPFLSRVLISASQYGCTEEMLTIV 803

Query: 2953 AMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQV 3132
            +ML+V ++FYRPKE+++ +DQ +++F  PE DHLTLL VY  WK + +S  WC   F+Q
Sbjct: 804  SMLSVPSVFYRPKEREEESDQARSRFFIPESDHLTLLNVYAQWKANRYSAHWCNSRFLQF 863

Query: 3133 RSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTD 3312
            RS++RA+DIR+QLL ++ +  L M S G D + ++K +C+G+ +  AK      Y  L
Sbjct: 864  RSLQRAKDIREQLLYVIRKLNLPMASSGSDWAPIRKCLCTGYIQQTAKLSGLGKYVHLKT 923

Query: 3313 GQNVYIHPSSACF--QQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKI 3474
            G ++ +HP+SA F     P +VVYHEL+MTTKEY+  VTA+DP WL+E++  F+ I
Sbjct: 924  GMDLKVHPTSALFGLGDLPAYVVYHELLMTTKEYINVVTAVDPLWLMEYSGIFYHI 979


>gi|19921728|ref|NP_610269.1| CG11107-PA [Drosophila melanogaster]
 gi|7304234|gb|AAF59269.1| CG11107-PA [Drosophila melanogaster]
 gi|16197905|gb|AAL13713.1| GM13272p [Drosophila melanogaster]
          Length = 729

 Score =  654 bits (1687), Expect = 0.0
 Identities = 331/642 (51%), Positives = 459/642 (70%), Gaps = 13/642 (2%)
 Frame = +1

Query: 1594 SMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGL--GRRGKIG 1767
            ++ ++R +LP+F  + + M  +  +Q +V+VGETGSGKTTQ+ Q+ ++  +  GR+G +
Sbjct: 64   NLYKKRIALPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAVSKGRKG-VS 122

Query: 1768 CTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDP 1947
            CTQPRRVAAMSVA+RV+EE   KLG +VGY+IRFEDC++  T++KYMTDGMLLRE + DP
Sbjct: 123  CTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDP 182

Query: 1948 DLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPI 2127
             L  Y +I+LDEAHERT+ TD+L G+LK   R+R +LKL++ SATLD+ KF +YF  AP+
Sbjct: 183  MLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATLDAGKFQQYFDNAPL 242

Query: 2128 FTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEP-PGDVLVFLTGQEEIDTSCEVL 2304
              +PGRT PVEI YT EPE DYLEAA  TV+QIH+ E   GD+L+FLTGQEEI+ +C+ +
Sbjct: 243  MKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIEEACKRI 302

Query: 2305 YERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAP------AGKRKVVIATNIAETSLT 2466
               + ++G ++ EL  +P+Y  LP  +Q RIF+PAP      A  RKVV++TNIAETSLT
Sbjct: 303  KREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLT 362

Query: 2467 IDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERA 2646
            IDG+ +V+DPGF KQK+YNP+  ++SL+V+PIS+A+A+QRSGRAGRT PGKC+RLYTE+A
Sbjct: 363  IDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKA 422

Query: 2647 FRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSAL 2826
            F++EM     PEI R+NL + +LQLK +GI++L+ FDFMD P  ++++ AL  L+ L+AL
Sbjct: 423  FKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAAL 482

Query: 2827 DGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDH 3006
            D DG LT LG  M+EFPL+P L+K+LI S    CS E+L+I AML+V   F RP E +
Sbjct: 483  DDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQCFVRPNEAKKA 542

Query: 3007 ADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMD 3186
            AD+ K +F   +GDHLTLL VY+++K       WC+ENFI  RS+K A ++R+QL  IMD
Sbjct: 543  ADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMD 602

Query: 3187 RHKLLMVS---CGRD-VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQ 3354
            R  L   S     +D    ++KA+  GFF   A  +    Y T+ D QNV +HPS+ C
Sbjct: 603  RFNLRRTSTEFTSKDYYVNIRKALVQGFFMQVAHLERTGYYLTIKDNQNVQLHPST-CLD 661

Query: 3355 QQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGD 3480
             +P+WV+Y+E V+TTK Y+R VT + P+WL   AP ++ + +
Sbjct: 662  HKPDWVIYNEFVLTTKNYIRTVTDVKPEWLCCLAPQYYDLNN 703


>gi|45188097|ref|NP_984320.1| ADR224Wp [Eremothecium gossypii]
 gi|44982914|gb|AAS52144.1| ADR224Wp [Eremothecium gossypii]
          Length = 1090

 Score =  653 bits (1685), Expect = 0.0
 Identities = 337/636 (52%), Positives = 459/636 (71%), Gaps = 13/636 (2%)
 Frame = +1

Query: 1606 QRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGK-IGCTQPR 1782
            QR +LP++ +K  L++ + DNQ+ V++GETGSGKTTQ+ QY  E G  R GK IG TQPR
Sbjct: 374  QRRTLPVYEVKSQLLQVIRDNQVTVIIGETGSGKTTQLAQYLHEDGFCRLGKQIGVTQPR 433

Query: 1783 RVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGY 1962
            RVAAMSVA+RVA E G +LG +VGY IRFED TS DT +K+MTDG+LLRE LID  L  Y
Sbjct: 434  RVAAMSVAERVALEMGVELGKEVGYAIRFEDKTSADTRLKFMTDGILLRETLIDDLLEKY 493

Query: 1963 SLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPG 2142
            + I++DEAHER+++TDVL G  K    +R  LKLIITSAT+++ KFS++F +AP FTIPG
Sbjct: 494  ACIIMDEAHERSLNTDVLLGFFKNLLTRRRNLKLIITSATMNASKFSQFFGDAPQFTIPG 553

Query: 2143 RTFPVEILYTREPESDYLEAAHITVMQIHL-TEPPGDVLVFLTGQEEIDTSCEVLYERMK 2319
            RTFPV+I YT  P  DY+EAA      IHL T   GD+L+F+TGQE+I+ +C+ L ER+
Sbjct: 554  RTFPVQINYTSYPVPDYVEAAVQQAASIHLSTSLLGDILIFMTGQEDIEATCDALKERIV 613

Query: 2320 SM-----GPDVPELI----ILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTID 2472
             M     G  + +++    ILP+Y ALP+++Q RIF+ + A KRK+V+ATNIAETSLTID
Sbjct: 614  DMRVKRKGSIMQDILADVEILPIYSALPADIQGRIFNKSDAKKRKIVVATNIAETSLTID 673

Query: 2473 GIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFR 2652
            GI YV+D G+ K K+YNP+ G+ +L +TPIS A A+QRSGRAGRTGPG  YRLYTE
Sbjct: 674  GIKYVIDCGYSKLKVYNPRIGLYNLAITPISLANAQQRSGRAGRTGPGIAYRLYTENTAI 733

Query: 2653 DEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDG 2832
             +M P  +PEIQRT+LAS LL LK++GI ++ +F FMD+PP  +++T++  L TL ALD
Sbjct: 734  ADMHPQSIPEIQRTSLASVLLLLKSLGIEDIFNFPFMDSPPSATLMTSMFELWTLGALDN 793

Query: 2833 DGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHAD 3012
             G LT++G +MA+FPL+PSLSK+L++S   GCSEE++TIV+ML+V  IFYRPKE+Q  +D
Sbjct: 794  FGALTEMGSKMAKFPLQPSLSKILLLSAKYGCSEEMVTIVSMLSVPQIFYRPKERQKESD 853

Query: 3013 QKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRH 3192
            Q + +F  PE DHLTLL V+  WK H +S  WC +N++Q RS++RA DIR+QL+  M +
Sbjct: 854  QARNRFVVPESDHLTLLNVFVQWKVHRYSLDWCRKNYLQYRSLRRAYDIREQLIRAMLKE 913

Query: 3193 KLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSAC--FQQQPE 3366
             + ++S G     ++K IC+G+   AA++     Y  L +G  + +HP+SA       P
Sbjct: 914  DVPIISSGSGWDILRKCICAGYVHQAARKSGLNQYVHLKNGMELKLHPTSALAGMGDLPP 973

Query: 3367 WVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKI 3474
            +VVYHEL++TTKEY+  VTA+DP WL+E+   F+ +
Sbjct: 974  YVVYHELLLTTKEYINLVTAVDPFWLMEYGALFYHV 1009


>gi|50413843|ref|XP_457324.1| unnamed protein product [Debaryomyces
            hansenii]
 gi|49652989|emb|CAG85328.1| unnamed protein product [Debaryomyces
            hansenii CBS767]
          Length = 901

 Score =  651 bits (1680), Expect = 0.0
 Identities = 332/654 (50%), Positives = 466/654 (70%), Gaps = 13/654 (1%)
 Frame = +1

Query: 1594 SMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRG----- 1758
            SM E R+SLP++  ++  ++AM   Q+L+VVGETGSGKTTQ+ QY  EAG  +
Sbjct: 247  SMDEVRKSLPVYKYREQFLDAMSKYQVLIVVGETGSGKTTQLPQYLHEAGYSKSNNGKIL 306

Query: 1759 KIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECL 1938
            KIGCTQPRRVAA SVA R+A+E G  LG +VGY+IRFED +S  TIIKY+TDGMLLRE L
Sbjct: 307  KIGCTQPRRVAATSVANRIADEMGVTLGEEVGYSIRFEDKSSDKTIIKYLTDGMLLREFL 366

Query: 1939 IDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLE 2118
             DP+LS Y  +M+DEAHERT+ T+++  LLK   + R +LKLII SAT+++ KFS YF +
Sbjct: 367  TDPELSSYGALMIDEAHERTVSTEIILSLLKDIIQIRKDLKLIIASATMNAEKFSNYFND 426

Query: 2119 APIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLT-EPPGDVLVFLTGQEEIDTSC 2295
            APIF IPGR FPV+I YT+ PE++Y++AA  T+ QIH T E PGD+LVFLTGQ+EI+T
Sbjct: 427  APIFNIPGRRFPVDIHYTKNPEANYIQAALTTIFQIHTTQELPGDILVFLTGQDEIETMQ 486

Query: 2296 EVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDG 2475
            E L E    +G  +  LII PVY +LP+++Q  IF+P P   RK+V+ATNIAETS+TI+G
Sbjct: 487  ESLEEACHKLGSLIKPLIICPVYASLPTDLQKNIFEPTPPNSRKIVLATNIAETSITIEG 546

Query: 2476 IFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRD 2655
            I YV+DPG+VK+ ++NP +GM+SLVV P S+A+A QR+GRAGR GPGKC+RLYT+ +F +
Sbjct: 547  ISYVIDPGYVKENVFNPVTGMESLVVVPCSRASANQRAGRAGRVGPGKCFRLYTKWSFYN 606

Query: 2656 EMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGD 2835
            E+   P PEI R NL   +L L ++GI +LI+F+F+D P  D++I +L  L+ L AL+
Sbjct: 607  EIQANPTPEILRVNLVHIVLLLLSLGITDLINFEFIDPPSSDTLIKSLELLYALGALNSK 666

Query: 2836 GLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQ-NIFYRPKEKQDHAD 3012
            G LTK GR+MAEFP++P  +K LI S   G + E+LT+++ML+   ++FYRPK+K++ AD
Sbjct: 667  GELTKTGRKMAEFPIDPMFAKCLISSSTYGVTNEILTVISMLSESASLFYRPKDKREQAD 726

Query: 3013 QKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRH 3192
            +KK  F   EGDHLTLL +++ W++  +S  WC +NFIQ +++KR++++R+QL  +  +
Sbjct: 727  KKKESFQVEEGDHLTLLNLWDQWQDTGYSNQWCQDNFIQYKTLKRSKEVRQQLERLCKKT 786

Query: 3193 KLLMVSCGRDVSR---VQKAICSGFFRNAAKRDPQ-EGYRTLTDGQNVYIHPSSACF--Q 3354
             + +V   + V++   +QK+I +GFF N A+     + YR+L   Q V+IHPSS  +  +
Sbjct: 787  GIPVVEDDK-VNKNLMIQKSITAGFFPNIARLSKMGDSYRSLKKNQAVFIHPSSVLYPVK 845

Query: 3355 QQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQK 3516
              P+ ++YHELV+T+KE+MR    ID KWL E AP ++   D   L+T K   K
Sbjct: 846  PPPKLILYHELVLTSKEFMRNCMLIDEKWLNELAPHYYSNKDLDILATKKGPSK 899


>gi|19112729|ref|NP_595937.1| putative pre-mrna splicing factor rna
            helicase [Schizosaccharomyces pombe]
 gi|3913432|sp|O42945|PR43_SCHPO Probable pre-mRNA splicing factor RNA
            helicase prp43
 gi|7492845|pir||T39615 probable pre-mrna splicing factor rna helicase
            - fission yeast (Schizosaccharomyces pombe)
 gi|2956762|emb|CAA17908.1| SPBC16H5.10c [Schizosaccharomyces pombe]
          Length = 735

 Score =  649 bits (1674), Expect = 0.0
 Identities = 335/665 (50%), Positives = 466/665 (69%), Gaps = 18/665 (2%)
 Frame = +1

Query: 1597 MVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGR--RGKIGC 1770
            ++E R  LP++  ++  ++   +NQI+V VGETGSGKTTQ+ Q+ +   L      +I C
Sbjct: 68   ILETRRELPVYQQREEFLKIYHENQIIVFVGETGSGKTTQIPQFVLYDELPHLTNTQIAC 127

Query: 1771 TQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPD 1950
            TQPRRVAAMSVAKRVA+E    LG +VGY IRFEDC+  +T++KYMTDGMLLRE + D
Sbjct: 128  TQPRRVAAMSVAKRVADEMDVDLGEEVGYNIRFEDCSGPNTLLKYMTDGMLLREAMTDHM 187

Query: 1951 LSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIF 2130
            LS YS I+LDEAHERT+ TD+L GL+K  A +RP+LK+I+ SATLD+ KF +YF +AP+
Sbjct: 188  LSRYSCIILDEAHERTLATDILMGLMKRLATRRPDLKIIVMSATLDAKKFQKYFFDAPLL 247

Query: 2131 TIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVL-- 2304
             +PGRT+PVEI YT+EPE DYLEAA  TV+QIH+ E PGD+LVFLTG+EEI+ +C  +
Sbjct: 248  AVPGRTYPVEIYYTQEPERDYLEAALRTVLQIHVEEGPGDILVFLTGEEEIEDACRKITL 307

Query: 2305 ----YERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGK-----RKVVIATNIAET 2457
                  R  + GP    L + P+YG+LP   Q RIF+P P        RKVVI+TNIAET
Sbjct: 308  EADDLVREGAAGP----LKVYPLYGSLPPNQQQRIFEPTPEDTKSGYGRKVVISTNIAET 363

Query: 2458 SLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYT 2637
            SLTIDGI YVVDPGF KQKIYNP+  ++SL+V+PIS+A+A+QR+GRAGRT PGKC+RLYT
Sbjct: 364  SLTIDGIVYVVDPGFSKQKIYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYT 423

Query: 2638 ERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTL 2817
            E AFR E++    PEI R+NL+ST+L+LK +GI++L+ FD+MD P  ++M+ AL  L+ L
Sbjct: 424  EEAFRKELIEQTYPEILRSNLSSTVLELKKLGIDDLVHFDYMDPPAPETMMRALEELNYL 483

Query: 2818 SALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEK 2997
            + LD +G LT LGR+ +EFPL+P+L+ +LI S +  CS EVL++ A+L+V N+F RP
Sbjct: 484  NCLDDNGDLTPLGRKASEFPLDPNLAVMLIRSPEFYCSNEVLSLTALLSVPNVFVRPNSA 543

Query: 2998 QDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLG 3177
            +  AD+ + +F  P+GDHLTLL VY+++K+   +  WC+ +F+  R++  A ++RKQL
Sbjct: 544  RKLADEMRQQFTHPDGDHLTLLNVYHAYKSGEGTADWCWNHFLSHRALISADNVRKQLRR 603

Query: 3178 IMDRHKLLMVSCGRD----VSRVQKAICSGFFRNAAKRDPQ-EGYRTLTDGQNVYIHPSS 3342
             M+R ++ ++S   D       +++A+ SGFF   AK+    + Y T+ D Q V +HPS
Sbjct: 604  TMERQEVELISTPFDDKNYYVNIRRALVSGFFMQVAKKSANGKNYVTMKDNQVVSLHPSC 663

Query: 3343 ACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKID 3522
                  PEWVVY+E V+TTK ++R VTAI P+WL+E AP+++ + D      F  N+++
Sbjct: 664  G-LSVTPEWVVYNEFVLTTKSFIRNVTAIRPEWLIELAPNYYDLDD------FDNNKEVK 716

Query: 3523 PLFDK 3537
                K
Sbjct: 717  SALQK 721


>gi|34878065|ref|XP_214053.2| similar to Putative pre-mRNA splicing
            factor RNA helicase (DEAH box protein 15) [Rattus
            norvegicus]
          Length = 795

 Score =  648 bits (1671), Expect = 0.0
 Identities = 347/735 (47%), Positives = 485/735 (65%), Gaps = 29/735 (3%)
 Frame = +1

Query: 1363 SKERKETKIQAQRERDMDTQKG----FSSNARILDPMSGNQSTAWSADESKDRNNKMKEM 1530
            SK+R   + +  RER+ + +K      S+NA ++         + SA  +   ++
Sbjct: 37   SKDRDRERDRGDREREREKEKEKELRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTH 96

Query: 1531 PEWLKHVTAGGKATYGRRTN-----------LSMVEQRESLPIFALKKNLMEAMIDNQIL 1677
                 H    G  +  +  N             ++++R  LP++  K    + ++ +Q
Sbjct: 97   SAHSTHTGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF 156

Query: 1678 VVVGETGSGKTTQMTQYAIE---AGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTD 1848
            V+VGETGSGKTTQ+ Q+ +E   +  G +  + CTQPRRVAAMSVA+RVA+E    LG +
Sbjct: 157  VLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQE 216

Query: 1849 VGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLL 2028
            VGY+IRFEDC+S  TI+KYMTDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L G+L
Sbjct: 217  VGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVL 276

Query: 2029 KAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAH 2208
            K   R+R +LK+I+ SATLD+ KF  YF   P+ TIPGRT PVEI YT EPE DYLEAA
Sbjct: 277  KEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAI 336

Query: 2209 ITVMQIHLTEPP-GDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEM 2385
             TV+QIH+ E   GD+L+FLTGQEEID +C+ +   +  +GP+V ++ I+P+Y  LP +
Sbjct: 337  RTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQ 396

Query: 2386 QTRIFDPAPAGK------RKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSL 2547
            Q RIF+P P  K      RKVV++TNIAETSLTIDG+ +V+DPGF KQK+YNP+  ++SL
Sbjct: 397  QQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESL 456

Query: 2548 VVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKA 2727
            +VT IS+A+A+QR+GRAGRT PGKC+RLYTE+A++ EM     PEI R+NL S +LQLK
Sbjct: 457  LVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKK 516

Query: 2728 MGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLI 2907
            +GI++L+ FDFMD P  ++++ AL  L+ L+AL+ DG LT+LG  MAEFPL+P L+K++I
Sbjct: 517  LGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVI 576

Query: 2908 MSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKN 3087
             S D  CS EVL+I AML+V   F RP E +  AD+ K +F   +GDHLTLL VY+++K
Sbjct: 577  ASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQ 636

Query: 3088 HHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVS---CGRD-VSRVQKAICSG 3255
            +H S  WC++NFI  RS+  A ++R+QL  IMDR  L   S     RD    ++KA+ +G
Sbjct: 637  NHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTG 696

Query: 3256 FFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDP 3435
            +F   A  +    Y T+ D Q V +HPS+     +PEWV+Y+E V+TTK Y+R  T I P
Sbjct: 697  YFMQVAHLERTGHYLTVKDNQVVQLHPSTV-LDHKPEWVLYNEFVLTTKNYIRTCTDIKP 755

Query: 3436 KWLVEFAPSFFKIGD 3480
            +WLV+ AP ++ + +
Sbjct: 756  EWLVKIAPQYYDMSN 770


>gi|13124667|sp|O43143|DD15_HUMAN Putative pre-mRNA splicing factor
            RNA helicase (DEAH box protein 15) (ATP-dependent RNA
            helicase #46)
 gi|9624453|gb|AAF90182.1| dead box protein 15 [Homo sapiens]
 gi|23273556|gb|AAH35974.1| DHX15 protein [Homo sapiens]
          Length = 795

 Score =  648 bits (1671), Expect = 0.0
 Identities = 347/735 (47%), Positives = 485/735 (65%), Gaps = 29/735 (3%)
 Frame = +1

Query: 1363 SKERKETKIQAQRERDMDTQKG----FSSNARILDPMSGNQSTAWSADESKDRNNKMKEM 1530
            SK+R   + +  RER+ + +K      S+NA ++         + SA  +   ++
Sbjct: 37   SKDRDRERDRGDREREREKEKEKELRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTH 96

Query: 1531 PEWLKHVTAGGKATYGRRTN-----------LSMVEQRESLPIFALKKNLMEAMIDNQIL 1677
                 H    G  +  +  N             ++++R  LP++  K    + ++ +Q
Sbjct: 97   SAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF 156

Query: 1678 VVVGETGSGKTTQMTQYAIE---AGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTD 1848
            V+VGETGSGKTTQ+ Q+ +E   +  G +  + CTQPRRVAAMSVA+RVA+E    LG +
Sbjct: 157  VLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQE 216

Query: 1849 VGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLL 2028
            VGY+IRFEDC+S  TI+KYMTDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L G+L
Sbjct: 217  VGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVL 276

Query: 2029 KAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAH 2208
            K   R+R +LK+I+ SATLD+ KF  YF   P+ TIPGRT PVEI YT EPE DYLEAA
Sbjct: 277  KEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAI 336

Query: 2209 ITVMQIHLTEPP-GDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEM 2385
             TV+QIH+ E   GD+L+FLTGQEEID +C+ +   +  +GP+V ++ I+P+Y  LP +
Sbjct: 337  RTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQ 396

Query: 2386 QTRIFDPAPAGK------RKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSL 2547
            Q RIF+P P  K      RKVV++TNIAETSLTIDG+ +V+DPGF KQK+YNP+  ++SL
Sbjct: 397  QQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESL 456

Query: 2548 VVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKA 2727
            +VT IS+A+A+QR+GRAGRT PGKC+RLYTE+A++ EM     PEI R+NL S +LQLK
Sbjct: 457  LVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKK 516

Query: 2728 MGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLI 2907
            +GI++L+ FDFMD P  ++++ AL  L+ L+AL+ DG LT+LG  MAEFPL+P L+K++I
Sbjct: 517  LGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVI 576

Query: 2908 MSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKN 3087
             S D  CS EVL+I AML+V   F RP E +  AD+ K +F   +GDHLTLL VY+++K
Sbjct: 577  ASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQ 636

Query: 3088 HHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVS---CGRD-VSRVQKAICSG 3255
            +H S  WC++NFI  RS+  A ++R+QL  IMDR  L   S     RD    ++KA+ +G
Sbjct: 637  NHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTG 696

Query: 3256 FFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDP 3435
            +F   A  +    Y T+ D Q V +HPS+     +PEWV+Y+E V+TTK Y+R  T I P
Sbjct: 697  YFMQVAHLERTGHYLTVKDNQVVQLHPSTV-LDHKPEWVLYNEFVLTTKNYIRTCTDIKP 755

Query: 3436 KWLVEFAPSFFKIGD 3480
            +WLV+ AP ++ + +
Sbjct: 756  EWLVKIAPQYYDMSN 770


>gi|48098531|ref|XP_392081.1| similar to ENSANGP00000021966 [Apis
            mellifera]
          Length = 1129

 Score =  647 bits (1669), Expect = 0.0
 Identities = 329/616 (53%), Positives = 444/616 (71%), Gaps = 13/616 (2%)
 Frame = +1

Query: 1666 NQILVVVGETGSGKTTQMTQYAIEAGL--GRRGKIGCTQPRRVAAMSVAKRVAEEYGCKL 1839
            +Q +V+VGETGSGKTTQ+ Q+ +E  +  G +G + CTQPRRVAAMSVA+RV+EE    L
Sbjct: 319  HQCIVLVGETGSGKTTQIPQWCVEYSMRIGNKG-VACTQPRRVAAMSVAQRVSEEMDVAL 377

Query: 1840 GTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLF 2019
            G +VGY+IRFEDC+S  TI+KYMTDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L
Sbjct: 378  GQEVGYSIRFEDCSSPKTILKYMTDGMLLREGMSDPMLDAYQVILLDEAHERTLATDLLM 437

Query: 2020 GLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLE 2199
            G+LK   ++RP+LKL+I SATLD+ KF +YF  AP+  +PGRT PVEI YT+EPE DYLE
Sbjct: 438  GVLKEVIKQRPDLKLVIMSATLDAGKFQQYFDNAPLMNVPGRTHPVEIFYTQEPERDYLE 497

Query: 2200 AAHITVMQIHLTEPP-GDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALP 2376
            AA  TV QIH+ E   GD+L+FLTGQEEI+ +C+ +   M ++GP+V EL  +P+Y  LP
Sbjct: 498  AAIRTVTQIHMCEEVVGDLLLFLTGQEEIEEACKRIKREMDNLGPEVGELKCIPLYSTLP 557

Query: 2377 SEMQTRIFDPAPAGK------RKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGM 2538
              +Q RIF+P P  K      RKVV++TNIAETSLTIDG+ +V+DPGF KQK+YNP+  +
Sbjct: 558  PNLQQRIFEPTPPTKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRV 617

Query: 2539 DSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQ 2718
            +SL+V+PIS+A+A+QR+GRAGRT PGKC+RLYTE+A+++EM     PEI R+NL S +LQ
Sbjct: 618  ESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEKAYKNEMQDNTYPEILRSNLGSVVLQ 677

Query: 2719 LKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSK 2898
            LK +GI++L+ FDFMD P  ++++ AL  L+ L+ALD DG LT LG  MAEFPL+P L+K
Sbjct: 678  LKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMAEFPLDPQLAK 737

Query: 2899 LLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNS 3078
            +LI S +  CS E+L+I AML+V   F RP E +  AD  K +F   +GDHLTLL VY++
Sbjct: 738  MLIASCNHNCSNEILSITAMLSVPQCFVRPNESKKAADDAKMRFAHIDGDHLTLLNVYHA 797

Query: 3079 WKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVS---CGRD-VSRVQKAI 3246
            +K +     WC++NF+  RS+K   ++R+QL  IMDR  L   S     +D    ++KA+
Sbjct: 798  FKQNFEDPQWCYDNFVNYRSLKSGDNVRQQLSRIMDRFCLKRTSTEFTSKDYYINIRKAL 857

Query: 3247 CSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTA 3426
             +GFF   A  +    Y T+ D Q V +HPSS C   +PEWV+Y+E V+TTK Y+R VT
Sbjct: 858  VNGFFMQVAHLERTGHYLTIKDNQIVQLHPSS-CLDHKPEWVIYNEFVLTTKNYIRTVTD 916

Query: 3427 IDPKWLVEFAPSFFKI 3474
            I P WL++ AP ++ +
Sbjct: 917  IKPDWLLKIAPQYYDL 932


>gi|31563436|sp|O35286|DD15_MOUSE Putative pre-mRNA splicing factor
            RNA helicase (DEAH box protein 15)
          Length = 795

 Score =  647 bits (1669), Expect = 0.0
 Identities = 347/735 (47%), Positives = 485/735 (65%), Gaps = 29/735 (3%)
 Frame = +1

Query: 1363 SKERKETKIQAQRERDMDTQKG----FSSNARILDPMSGNQSTAWSADESKDRNNKMKEM 1530
            SK+R   + +  RER+ + +K      S+NA ++         + SA  +   ++
Sbjct: 37   SKDRDRERDRGDREREREKEKEKELRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTH 96

Query: 1531 PEWLKHVTAGGKATYGRRTN-----------LSMVEQRESLPIFALKKNLMEAMIDNQIL 1677
                 H    G  +  +  N             ++++R  LP++  K    + ++ +Q
Sbjct: 97   SAHSTHTGHTGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF 156

Query: 1678 VVVGETGSGKTTQMTQYAIE---AGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTD 1848
            V+VGETGSGKTTQ+ Q+ +E   +  G +  + CTQPRRVAAMSVA+RVA+E    LG +
Sbjct: 157  VLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQE 216

Query: 1849 VGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLL 2028
            VGY+IRFEDC+S  TI+KYMTDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L G+L
Sbjct: 217  VGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVL 276

Query: 2029 KAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAH 2208
            K   R+R +LK+I+ SATLD+ KF  YF   P+ TIPGRT PVEI YT EPE DYLEAA
Sbjct: 277  KEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAI 336

Query: 2209 ITVMQIHLTEPP-GDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEM 2385
             TV+QIH+ E   GD+L+FLTGQEEID +C+ +   +  +GP+V ++ I+P+Y  LP +
Sbjct: 337  RTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQ 396

Query: 2386 QTRIFDPAPAGK------RKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSL 2547
            Q RIF+P P  K      RKVV++TNIAETSLTIDG+ +V+DPGF KQK+YNP+  ++SL
Sbjct: 397  QQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESL 456

Query: 2548 VVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKA 2727
            +VT IS+A+A+QR+GRAGRT PGKC+RLYTE+A++ EM     PEI R+NL S +LQLK
Sbjct: 457  LVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKK 516

Query: 2728 MGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLI 2907
            +GI++L+ FDFMD P  ++++ AL  L+ L+AL+ DG LT+LG  MAEFPL+P L+K++I
Sbjct: 517  LGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVI 576

Query: 2908 MSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKN 3087
             S D  CS EVL+I AML+V   F RP E +  AD+ K +F   +GDHLTLL VY+++K
Sbjct: 577  ASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQ 636

Query: 3088 HHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVS---CGRD-VSRVQKAICSG 3255
            +H S  WC++NFI  RS+  A ++R+QL  IMDR  L   S     RD    ++KA+ +G
Sbjct: 637  NHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTG 696

Query: 3256 FFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDP 3435
            +F   A  +    Y T+ D Q V +HPS+     +PEWV+Y+E V+TTK Y+R  T I P
Sbjct: 697  YFMQVAHLERTGHYLTVKDNQVVQLHPSTV-LDHKPEWVLYNEFVLTTKNYIRTCTDIKP 755

Query: 3436 KWLVEFAPSFFKIGD 3480
            +WLV+ AP ++ + +
Sbjct: 756  EWLVKIAPQYYDMSN 770


>gi|46249858|gb|AAH68766.1| MGC81281 protein [Xenopus laevis]
          Length = 761

 Score =  646 bits (1667), Expect = 0.0
 Identities = 331/655 (50%), Positives = 462/655 (70%), Gaps = 14/655 (2%)
 Frame = +1

Query: 1597 MVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIE---AGLGRRGKIG 1767
            ++++R  LP++  K+   E ++ NQ  V+VGETGSGKTTQ+ Q+ ++   +  G +  +
Sbjct: 96   ILKKRLLLPVWEYKERFTEILMKNQSFVLVGETGSGKTTQIPQWCVDYMRSLPGPKRAVA 155

Query: 1768 CTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDP 1947
            CTQPRRVAAMSVA+RVA+E    LG +VGY+IRFEDC+S  TI+KYMTDGMLLRE + DP
Sbjct: 156  CTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDP 215

Query: 1948 DLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPI 2127
             L  Y +++LDEAHERT+ TD+L G+LK   R+R +LK+I+ SATLD+ KF  YF   P+
Sbjct: 216  LLERYGVVILDEAHERTLATDILMGVLKEVVRQRNDLKVIVMSATLDAGKFQVYFDSCPL 275

Query: 2128 FTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPP-GDVLVFLTGQEEIDTSCEVL 2304
             TIPGRT PVEI YT EPE DYLEA+  TV+QIH+ E   GD+L+FLTGQEEID +C+ +
Sbjct: 276  LTIPGRTHPVEIFYTPEPERDYLEASIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRI 335

Query: 2305 YERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGK------RKVVIATNIAETSLT 2466
               +  +GP+V ++ I+P+Y  LP + Q RIF+P P  K      RKVV++TNIAETSLT
Sbjct: 336  KREIDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKPSGAIGRKVVVSTNIAETSLT 395

Query: 2467 IDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERA 2646
            IDG+ +V+DPGF KQK+YNP+  ++SL+VT IS+A+A+QR+GRAGRT PGKC+RLYTE+A
Sbjct: 396  IDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKA 455

Query: 2647 FRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSAL 2826
            ++ EM     PEI R+NL S +LQLK +GI++L+ FDFMD P  ++++ AL  L+ L+AL
Sbjct: 456  YKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAAL 515

Query: 2827 DGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDH 3006
            + DG LT+LG  MAEFPL+P L+K++I S D  CS E+L+I AML+V   F RP E +
Sbjct: 516  NDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEILSITAMLSVPQCFIRPTEVKKA 575

Query: 3007 ADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMD 3186
            AD+ K +F   +GDHLTLL VY+++K +H S  WC++NFI  RS+  A ++R+QL  IMD
Sbjct: 576  ADESKMRFAHIDGDHLTLLNVYHAFKQNHESSQWCYDNFINYRSLMSADNVRQQLSRIMD 635

Query: 3187 RHKLLMVS---CGRD-VSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQ 3354
            R  L   S     RD    ++KA+ +G+F   A  +    Y T+ D Q V +HPS+
Sbjct: 636  RFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTV-LD 694

Query: 3355 QQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKI 3519
             +PEWV+Y+E V+TTK Y+R  T I P+WLV+ A  ++ +G+  +    ++ ++I
Sbjct: 695  HKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAAQYYDMGNFPQCEAKRQLERI 749


>gi|49084084|ref|XP_404270.1| hypothetical protein AN0133.2
            [Aspergillus nidulans FGSC A4]
 gi|40746155|gb|EAA65311.1| hypothetical protein AN0133.2 [Aspergillus
            nidulans FGSC A4]
          Length = 769

 Score =  641 bits (1654), Expect = 0.0
 Identities = 342/704 (48%), Positives = 474/704 (66%), Gaps = 33/704 (4%)
 Frame = +1

Query: 1477 TAWSADESKDRNNKMKEMPEWLKHVTAGGKAT------YGRRTN-------LSMVEQRES 1617
            T+ + + S   +NK     +  +H T   +A       +   TN        S+++ R
Sbjct: 39   TSSNGNSSSQADNKNSAFAKLQRHKTTAAQAQKVEDNEFNPFTNRPYSSKYFSILKTRRD 98

Query: 1618 LPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGR--RGKIGCTQPRRVA 1791
            LP+ A +   ++    +QILV VGETGSGKTTQ+ Q+ +   L +  R  I CTQPRRVA
Sbjct: 99   LPVHAQRDEFLQLYQQSQILVFVGETGSGKTTQIPQFVLLDDLPQTQRKMIACTQPRRVA 158

Query: 1792 AMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLI 1971
            AMSVA+RVA E    LG +VGY+IRFED TS  T++KYMTDGMLLRE + D +LS YS I
Sbjct: 159  AMSVAQRVAAELDVTLGEEVGYSIRFEDMTSPKTLLKYMTDGMLLREAMNDHELSRYSTI 218

Query: 1972 MLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTF 2151
            +LDEAHERT+ TDVL GLLK   ++RP+LK+II SATLD+ KF  YF +AP+  +PGRT
Sbjct: 219  ILDEAHERTMSTDVLMGLLKEVVQRRPDLKIIIMSATLDAQKFQRYFNDAPLLAVPGRTH 278

Query: 2152 PVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSM-- 2325
            PVEI YT EPE DY+EAA  TV+QIH TE  GD+L+FLTG+EEI+ +   +      M
Sbjct: 279  PVEIFYTPEPEQDYVEAAIRTVLQIHATEDEGDILLFLTGEEEIEDAARKISLEGDEMIR 338

Query: 2326 GPDVPELIILPVYGALPSEMQTRIFDPAPAGKR-------KVVIATNIAETSLTIDGIFY 2484
              D   L +  +YG+LP  MQ RIF+PAP  +R       KV+++TNIAETSLTIDGI Y
Sbjct: 339  EADAGPLKVYTLYGSLPPHMQQRIFEPAPPPRRPGGRPGRKVIVSTNIAETSLTIDGIVY 398

Query: 2485 VVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEML 2664
            VVDPGF KQKIYNP+  ++SL+V+PIS+A+A+QR+GRAGRT PGKC+RLYTE AF+ E++
Sbjct: 399  VVDPGFSKQKIYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTESAFKKELI 458

Query: 2665 PTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLL 2844
                PEI R+NL+ST+L+LK +GI++L+ FD MD P  ++++ AL  L+ L+ LD DG L
Sbjct: 459  DQTYPEILRSNLSSTVLELKKLGIDDLVHFDLMDPPAPETLMRALEELNYLACLDDDGNL 518

Query: 2845 TKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKA 3024
            T LGR  +EFPL+P+L+ +LI S +  CS E+L+I A+L+V  IF RP  ++  AD+ K
Sbjct: 519  TPLGRLASEFPLDPALAVMLISSPEFYCSNEILSITALLSVPQIFVRPASQRKRADEMKN 578

Query: 3025 KFHQPEGDHLTLLAVYNSWKNHHFSQ---PWCFENFIQVRSMKRAQDIRKQLLGIMDRHK 3195
             F  P+GDHLTLL  Y+++K+    +    WC ++F+ +RS++ A ++R QLL IM+R +
Sbjct: 579  LFAHPDGDHLTLLNAYHAFKSPEAQENPKQWCHDHFLSLRSLQSADNVRMQLLRIMEREE 638

Query: 3196 LLMVSCG----RDVSRVQKAICSGFFRNAAKRDPQ--EGYRTLTDGQNVYIHPSSACFQQ 3357
            L M+S      +    +++A+C+GFF   AK++ Q    Y T+ D QNV +HPS+
Sbjct: 639  LEMISTSFEDKKYYENIRRALCAGFFMQVAKKENQGKSMYMTIKDHQNVLLHPSTV-LAH 697

Query: 3358 QPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTK 3489
              EWV+Y+E V+TTK Y+R VTA+ P+WL++ AP+++ I    K
Sbjct: 698  DAEWVLYNEFVLTTKNYIRTVTAVKPEWLIDIAPTYYDISTFPK 741


>gi|50422299|ref|XP_459712.1| unnamed protein product [Debaryomyces
            hansenii]
 gi|49655380|emb|CAG87948.1| unnamed protein product [Debaryomyces
            hansenii CBS767]
          Length = 1184

 Score =  641 bits (1653), Expect = 0.0
 Identities = 353/788 (44%), Positives = 507/788 (63%), Gaps = 43/788 (5%)
 Frame = +1

Query: 1240 VEDEPDFLR---GYGKGGAEIE----PVKVVKNPDGSLAQAALMQGALSKERKETKIQAQ 1398
            +ED  ++L    G+ +  ++I      +  +K+PD  LA  A     + KERK    +++
Sbjct: 351  LEDSKEYLSLQIGHDRNDSKIRGIGPTISPIKDPDSELASMAKQGSMVVKERKSKNERSK 410

Query: 1399 RERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYG 1578
            + ++  T  G +          GN     + D++   N K+ E     K        T
Sbjct: 411  QAKERSTLSGTAL---------GNVLGVETHDKANGSNEKLHEN----KFSNENEIETQD 457

Query: 1579 RRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAG----- 1743
             +  +   +QR SLP FA+KKNL+  + +NQ+ VV+GETGSGKTTQ+TQY  E G
Sbjct: 458  EKAIIQ--QQRRSLPAFAVKKNLLRTIAENQVTVVIGETGSGKTTQLTQYLYEEGFGSNL 515

Query: 1744 --LGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTS-QDTIIKYMTD 1914
              LG+   IGCTQPRRVAAMSVAKRV+EE  CKLG +VG+ IRFED T+ + T+IKYMT+
Sbjct: 516  EQLGKNRMIGCTQPRRVAAMSVAKRVSEEMNCKLGDEVGFAIRFEDKTNPRKTVIKYMTE 575

Query: 1915 GMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSV 2094
            G+LLRE L+DP+L  YS I++DEAHER+++TDVL GL K    +R +LKLI+TSATL++
Sbjct: 576  GVLLREILVDPNLDKYSCIIMDEAHERSLNTDVLLGLFKMLLTRRKDLKLIVTSATLNAD 635

Query: 2095 KFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPP------GDVL 2256
            +F+ YF  AP FTIPGRTFPV++L+++   +DY+E A   V+ IHL          GD+L
Sbjct: 636  RFTRYFGNAPQFTIPGRTFPVDVLFSKSGCTDYVETAVKQVLTIHLQNSAKSNNNDGDIL 695

Query: 2257 VFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVI 2436
            VF+TGQE+I+ +CE+L E++  +  + P L I P++  +P+++Q +IF+     +RKVV+
Sbjct: 696  VFMTGQEDIEVTCELLQEKLDLLD-NPPPLDIFPIFSTMPADLQKKIFNKTNLERRKVVV 754

Query: 2437 ATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPG 2616
            ATNIAETSLT+DG+ YV+D G VK K+YNPK GMD L V PIS A A+QRSGRAGRTGPG
Sbjct: 755  ATNIAETSLTVDGVKYVIDTGLVKSKVYNPKLGMDMLQVIPISIANAQQRSGRAGRTGPG 814

Query: 2617 KCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITA 2796
              YRLYTER+  ++M   P+PEIQRTNL++ +LQLK++ I ++ +F F+D PP D +  +
Sbjct: 815  VAYRLYTERSAEEQMYLQPIPEIQRTNLSNVMLQLKSLKIEDVPNFPFLDPPPKDLLSCS 874

Query: 2797 LNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSV--DLGCSEEVLTIVAMLNVQ 2970
            L  L  + A+D  G LT+LG+ M+ FP+EP+LSKL+++S   +  CSEE++ IVAML+V
Sbjct: 875  LYDLWGIGAIDNCGELTQLGQSMSRFPMEPALSKLILLSCNSEFHCSEEIIIIVAMLSVP 934

Query: 2971 NIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQP---------WCFENF 3123
            ++FYRPKE+ + AD  + KF   E DHLTLL VYN WK+H   +P         WC  NF
Sbjct: 935  SVFYRPKERANEADAIREKFSISESDHLTLLNVYNQWKSHS-EKPQMNMKRLTNWCSRNF 993

Query: 3124 IQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAK--------R 3279
               +S+ RA+DI+ QLL IM++++L ++   R    ++K +C+ F++  AK
Sbjct: 994  FHSKSLLRARDIKNQLLLIMEKNRLKLLK-SRSDEDIRKCLCAAFYQQLAKIMKINIGNT 1052

Query: 3280 DPQEGYRTLTDGQNVYIHPSSAC---FQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVE 3450
               E      +   +++HP+SA        P +VVYHEL++T +EYM  VT++DP WL+E
Sbjct: 1053 GNSEYIHLRHNYMKMFLHPTSALNGGTSMAPTYVVYHELILTNREYMSCVTSVDPLWLLE 1112

Query: 3451 FAPSFFKI 3474
            F   FF++
Sbjct: 1113 FGYIFFEV 1120


>gi|4557517|ref|NP_001349.1| DEAH (Asp-Glu-Ala-His) box polypeptide
            15; DEAD/H box-15; RNA helicase 2; DEAD/H
            (Asp-Glu-Ala-Asp/His) box polypeptide 15; DEA/H
            (Asp-Glu-Ala-His) box polypeptide 15 [Homo sapiens]
 gi|7446076|pir||JC5785 ATP-dependent RNA helicase (EC 3.6.-.-) -
            human
 gi|2696613|dbj|BAA23987.1| ATP-dependent RNA helicase #46 [Homo
            sapiens]
          Length = 813

 Score =  637 bits (1643), Expect = 0.0
 Identities = 344/735 (46%), Positives = 479/735 (64%), Gaps = 29/735 (3%)
 Frame = +1

Query: 1363 SKERKETKIQAQRERDMDTQKG----FSSNARILDPMSGNQSTAWSADESKDRNNKMKEM 1530
            SK+R   + +  RER+ + +K      S+NA ++         + SA  +   ++
Sbjct: 37   SKDRDRERDRGDREREREKEKEKELRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTH 96

Query: 1531 PEWLKHVTAGGKATYGRRTN-----------LSMVEQRESLPIFALKKNLMEAMIDNQIL 1677
                 H    G  +  +  N             ++++R  LP++  K    + +  +Q
Sbjct: 97   SAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILGRHQSF 156

Query: 1678 VVVGETGSGKTTQMTQYAIE---AGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTD 1848
            V+VGETGSGKTTQ+    +E   +  G +  + CTQPRRVAAMSVA+RVA+E    LG +
Sbjct: 157  VLVGETGSGKTTQIPHRCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQE 216

Query: 1849 VGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLL 2028
            VGY+IRFEDC+S  T   YMTDGMLLRE + DP L  Y +I+LDEAHERT+ TD+L G+L
Sbjct: 217  VGYSIRFEDCSSAKTFFMYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVL 276

Query: 2029 KAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAH 2208
            K   R+R +LK+I+ SATLD+ KF  YF   P+ TIPGRT PVEI YT EPE DYLEAA
Sbjct: 277  KEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAI 336

Query: 2209 ITVMQIHLTEPP-GDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEM 2385
             TV+QIH+ E   GD+L+FLTGQEEID +C+ +   +  +GP+V ++ I+P+Y  LP +
Sbjct: 337  RTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQ 396

Query: 2386 QTRIFDPAPAGK------RKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSL 2547
            Q RIF+P P  K      RKVV++TNIAETSLTIDG+ +V+DPGF KQK+YNP+  ++SL
Sbjct: 397  QQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESL 456

Query: 2548 VVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKA 2727
            +VT IS+A+A+QR+GRAGRT PGKC+RLYTE+A++ EM     PEI R+NL S +LQLK
Sbjct: 457  LVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKK 516

Query: 2728 MGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLI 2907
            +GI++L+ FDFMD P  ++++ AL  L+ L+AL+ DG LT+LG  MAEFPL+P L+K++I
Sbjct: 517  LGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVI 576

Query: 2908 MSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKN 3087
             S D  CS EVL+I AML+V   F RP E +  AD+ K +F   +GDHLTLL VY+++K
Sbjct: 577  ASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQ 636

Query: 3088 HHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVS---CGRD-VSRVQKAICSG 3255
            +H S  WC++NFI  RS+  A ++R+QL  IMDR  L   S     RD    ++KA+ +G
Sbjct: 637  NHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTG 696

Query: 3256 FFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDP 3435
            +F   A  +    Y T+ D Q V +HPS+     +PEWV+Y+E V+TTK Y+R  T I P
Sbjct: 697  YFMQVAHLERTGHYLTVKDNQVVQLHPSTV-LDHKPEWVLYNEFVLTTKNYIRTCTDIKP 755

Query: 3436 KWLVEFAPSFFKIGD 3480
            +WLV+ AP ++ + +
Sbjct: 756  EWLVKIAPQYYDMSN 770


>gi|50546941|ref|XP_500940.1| hypothetical protein [Yarrowia
            lipolytica]
 gi|49646806|emb|CAG83191.1| unnamed protein product [Yarrowia
            lipolytica CLIB99]
          Length = 731

 Score =  637 bits (1643), Expect = 0.0
 Identities = 333/668 (49%), Positives = 462/668 (68%), Gaps = 21/668 (3%)
 Frame = +1

Query: 1534 EWLKHVTAGGKATYGRRTN---LSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSG 1704
            E +KH         G+  +     +++ R  LP+   ++  ++     QI+V VGETGSG
Sbjct: 46   EGMKHEDGPNNMFNGKELSTKYFDILKVRRDLPVHVQRQQFLDTFHSTQIMVFVGETGSG 105

Query: 1705 KTTQMTQYAIEAGLGR-RGK-IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDC 1878
            KTTQ+ Q+ +   L + +GK + CTQPRRVAAMSVAKRVA+E   +LG +VGY+IRFED
Sbjct: 106  KTTQIPQFVLFDDLPQLQGKMVACTQPRRVAAMSVAKRVADEMDVRLGEEVGYSIRFEDK 165

Query: 1879 TSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPEL 2058
            TS  T++KYMTDGMLLRE + D +LS YS I+LDEAHERT+ TD+L GL+K  A +RP+L
Sbjct: 166  TSPKTLLKYMTDGMLLREAMHDHNLSRYSCIILDEAHERTLATDILMGLIKQVAVRRPDL 225

Query: 2059 KLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTE 2238
            K+I+ SATLD+ KF  YF +AP+  +PGRT PVEI YT E + DYLE+A  TV+QIH TE
Sbjct: 226  KIIVMSATLDAQKFQSYFNDAPLLAVPGRTHPVEIYYTPEFQRDYLESALRTVLQIHATE 285

Query: 2239 PPGDVLVFLTGQEEIDTSCEVL------YERMKSMGPDVPELIILPVYGALPSEMQTRIF 2400
            P GD+L+FLTG+EEI+ +C  L        R    GP    L   P+YG+LP   Q +IF
Sbjct: 286  PEGDILLFLTGEEEIEDACRKLKLESDELTRESGCGP----LKAYPLYGSLPPNQQQKIF 341

Query: 2401 DPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAK 2580
            D AP G RKV+++TNIAETSLTIDGI YVVD GF KQK+YNP+  ++SL+V PIS+A+A+
Sbjct: 342  DDAPPGGRKVIVSTNIAETSLTIDGIVYVVDTGFSKQKVYNPRIRVESLLVAPISKASAQ 401

Query: 2581 QRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDF 2760
            QR+GRAGRT PGKC+RLYTE AF+ E+     PEI R+NLAST+L+LK +GI++L+ FDF
Sbjct: 402  QRAGRAGRTRPGKCFRLYTEDAFKKELNEQSYPEILRSNLASTVLELKKLGIDDLVHFDF 461

Query: 2761 MDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEV 2940
            MD P  ++M+ AL  L+ L+ LD DG LT+LGR  +EFPL+P L+ +LI S D  CS E+
Sbjct: 462  MDPPAPETMMRALEELNYLTCLDDDGNLTELGRLASEFPLDPMLAVMLISSPDYYCSNEI 521

Query: 2941 LTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFS---QPWC 3111
            L++ A+L+V N+F RP   +  AD+ K  F  P+GDHLTLL VY+++++         WC
Sbjct: 522  LSLTALLSVPNVFVRPNNDRKAADEAKNSFAHPDGDHLTLLNVYHAYRSDEAQADPNEWC 581

Query: 3112 FENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRD----VSRVQKAICSGFFRNAAKR 3279
            ++N++ +RS++ A ++R QL  +M+++ L ++S   +     + ++KA+ +G+F   AK+
Sbjct: 582  YQNYLSLRSLQSADNVRAQLKRLMEKNGLELMSTPYEDRNYYTNIRKALTAGYFMQVAKK 641

Query: 3280 DPQEG---YRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVE 3450
              Q G   Y T+ D Q+V IHPSS    Q  EWV+Y+E V+TTK Y+R VT I P+WL+E
Sbjct: 642  SSQGGKNSYTTVKDNQDVLIHPSSV-LGQDSEWVIYNEFVLTTKNYIRTVTGIRPEWLLE 700

Query: 3451 FAPSFFKI 3474
             AP ++ +
Sbjct: 701  IAPVYYDL 708




[DB home][top]