Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F01D5_2
         (537 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17532865|ref|NP_496932.1| metridin-like ShK toxin precursor f...   401   e-111
gi|17537087|ref|NP_496930.1| metridin-like ShK toxin precursor f...   251   7e-66
gi|39591324|emb|CAE73377.1| Hypothetical protein CBG20816 [Caeno...   206   2e-52
gi|17532871|ref|NP_496935.1| metridin-like ShK toxin precursor f...   176   2e-43
gi|7509721|pir||T26772 hypothetical protein Y39G8B.g - Caenorhab...   164   3e-42
gi|39591333|emb|CAE73386.1| Hypothetical protein CBG20826 [Caeno...   169   4e-41
gi|39591325|emb|CAE73378.1| Hypothetical protein CBG20818 [Caeno...   127   2e-28
gi|17532867|ref|NP_496933.1| metridin-like ShK toxin precursor f...   124   1e-27
gi|17532869|ref|NP_496934.1| metridin-like ShK toxin precursor f...   119   4e-26
gi|17537941|ref|NP_496244.1| metridin-like ShK toxin precursor f...   114   1e-24
gi|39597452|emb|CAE59682.1| Hypothetical protein CBG03105 [Caeno...   113   2e-24
gi|39580152|emb|CAE56272.1| Hypothetical protein CBG23917 [Caeno...    96   4e-19
gi|17540554|ref|NP_500487.1| metridin-like ShK toxin family memb...    96   5e-19
gi|37619814|emb|CAA91281.2| Hypothetical protein E04D5.4 [Caenor...    93   3e-18
gi|33285188|gb|AAF99963.2| Hypothetical protein F49F1.6 [Caenorh...    92   7e-18
gi|17540546|ref|NP_500485.1| metridin-like ShK toxin family memb...    91   1e-17
gi|39580151|emb|CAE56271.1| Hypothetical protein CBG23916 [Caeno...    87   1e-16
gi|39580150|emb|CAE56270.1| Hypothetical protein CBG23915 [Caeno...    87   2e-16
gi|17560526|ref|NP_506977.1| predicted CDS, metridin-like ShK to...    82   8e-15
gi|17555906|ref|NP_499332.1| metridin-like ShK toxin family memb...    76   4e-13
gi|39580149|emb|CAE56269.1| Hypothetical protein CBG23914 [Caeno...    75   7e-13
gi|17568655|ref|NP_510166.1| metridin-like ShK toxin family memb...    75   9e-13
gi|39585059|emb|CAE62710.1| Hypothetical protein CBG06864 [Caeno...    74   1e-12
gi|39590219|emb|CAE65957.1| Hypothetical protein CBG11139 [Caeno...    74   1e-12
gi|39588773|emb|CAE58297.1| Hypothetical protein CBG01405 [Caeno...    74   2e-12
gi|39588772|emb|CAE58296.1| Hypothetical protein CBG01404 [Caeno...    74   2e-12
gi|17561012|ref|NP_507973.1| predicted CDS, metridin-like ShK to...    74   2e-12
gi|32565512|ref|NP_495379.2| metridin-like ShK toxin family memb...    73   4e-12
gi|17506061|ref|NP_491509.1| metridin-like ShK toxin precursor f...    72   5e-12
gi|17559338|ref|NP_504978.1| metridin-like ShK toxin family memb...    72   5e-12
gi|17541538|ref|NP_499933.1| metridin-like ShK toxin family memb...    72   6e-12
gi|33300864|emb|CAE17990.1| Hypothetical protein Y39G8B.10 [Caen...    72   8e-12
gi|39591865|emb|CAE71443.1| Hypothetical protein CBG18354 [Caeno...    72   8e-12
gi|50507721|emb|CAH04750.1| Hypothetical protein M163.8 [Caenorh...    72   8e-12
gi|17565822|ref|NP_503462.1| predicted CDS, metridin-like ShK to...    71   1e-11
gi|39584357|emb|CAE65521.1| Hypothetical protein CBG10496 [Caeno...    70   3e-11
gi|39584367|emb|CAE65531.1| Hypothetical protein CBG10508 [Caeno...    69   4e-11
gi|39584333|emb|CAE65497.1| Hypothetical protein CBG10467 [Caeno...    69   4e-11
gi|17558700|ref|NP_504129.1| metridin-like ShK toxin family memb...    69   5e-11
gi|39587540|emb|CAE58478.1| Hypothetical protein CBG01620 [Caeno...    69   7e-11
gi|39595139|emb|CAE60176.1| Hypothetical protein CBG03731 [Caeno...    68   9e-11
gi|17563864|ref|NP_504146.1| metridin-like ShK toxin family memb...    68   1e-10
gi|39590218|emb|CAE65956.1| Hypothetical protein CBG11138 [Caeno...    67   1e-10
gi|39587297|emb|CAE74951.1| Hypothetical protein CBG22842 [Caeno...    67   1e-10
gi|39587298|emb|CAE74952.1| Hypothetical protein CBG22843 [Caeno...    67   1e-10
gi|39587304|emb|CAE74958.1| Hypothetical protein CBG22849 [Caeno...    67   1e-10
gi|17563984|ref|NP_506976.1| metridin-like ShK toxin family memb...    67   1e-10
gi|39584292|emb|CAE65456.1| Hypothetical protein CBG10421 [Caeno...    67   2e-10
gi|7509719|pir||T26770 hypothetical protein Y39G8B.e - Caenorhab...    67   2e-10
gi|39584289|emb|CAE65453.1| Hypothetical protein CBG10418 [Caeno...    67   3e-10
gi|39584356|emb|CAE65520.1| Hypothetical protein CBG10495 [Caeno...    67   3e-10
gi|17540556|ref|NP_500488.1| metridin-like ShK toxin family memb...    67   3e-10
gi|39587171|emb|CAE57639.1| Hypothetical protein CBG00624 [Caeno...    66   3e-10
gi|39581744|emb|CAE71077.1| Hypothetical protein CBG17922 [Caeno...    66   3e-10
gi|17561014|ref|NP_507974.1| predicted CDS, metridin-like ShK to...    66   3e-10
gi|39587306|emb|CAE74960.1| Hypothetical protein CBG22851 [Caeno...    66   3e-10
gi|17563852|ref|NP_504152.1| metridin-like ShK toxin family memb...    66   4e-10
gi|102520|pir||S23244 hypothetical protein ZK643.6 - Caenorhabdi...    66   4e-10
gi|17557025|ref|NP_498981.1| predicted CDS, metridin-like ShK to...    66   4e-10
gi|17560542|ref|NP_506985.1| metridin-like ShK toxin family memb...    66   4e-10
gi|17566788|ref|NP_507329.1| metridin-like ShK toxin family memb...    66   4e-10
gi|17563862|ref|NP_504145.1| metridin-like ShK toxin family memb...    66   4e-10
gi|39584288|emb|CAE65452.1| Hypothetical protein CBG10417 [Caeno...    65   6e-10
gi|39584298|emb|CAE65462.1| Hypothetical protein CBG10427 [Caeno...    65   6e-10
gi|17560216|ref|NP_507155.1| metridin-like ShK toxin family memb...    65   7e-10
gi|17558698|ref|NP_504130.1| metridin-like ShK toxin family memb...    65   7e-10
gi|17560540|ref|NP_506984.1| metridin-like ShK toxin family memb...    65   7e-10
gi|39584236|emb|CAE65400.1| Hypothetical protein CBG10351 [Caeno...    65   7e-10
gi|17540552|ref|NP_500486.1| secreted antigen like precursor fam...    64   1e-09
gi|17563870|ref|NP_504149.1| metridin-like ShK toxin family memb...    64   2e-09
gi|39584291|emb|CAE65455.1| Hypothetical protein CBG10420 [Caeno...    63   3e-09
gi|17563872|ref|NP_504150.1| metridin-like ShK toxin family memb...    63   3e-09
gi|17563868|ref|NP_504148.1| metridin-like ShK toxin family memb...    63   3e-09
gi|39587593|emb|CAE58531.1| Hypothetical protein CBG01687 [Caeno...    63   3e-09
gi|39596533|emb|CAE63152.1| Hypothetical protein CBG07468 [Caeno...    63   3e-09
gi|17563866|ref|NP_504147.1| metridin-like ShK toxin family memb...    63   4e-09
gi|17566804|ref|NP_507336.1| predicted CDS, metridin-like ShK to...    63   4e-09
gi|32965101|gb|AAP91738.1| zinc metalloprotease-like [Ciona inte...    62   5e-09
gi|39584287|emb|CAE65451.1| Hypothetical protein CBG10416 [Caeno...    62   5e-09
gi|17566792|ref|NP_507331.1| metridin-like ShK toxin family memb...    62   6e-09
gi|7507156|pir||T31840 hypothetical protein T05B4.4 - Caenorhabd...    62   6e-09
gi|39584294|emb|CAE65458.1| Hypothetical protein CBG10423 [Caeno...    62   6e-09
gi|39591323|emb|CAE73376.1| Hypothetical protein CBG20815 [Caeno...    62   8e-09
gi|39584290|emb|CAE65454.1| Hypothetical protein CBG10419 [Caeno...    61   1e-08
gi|17560218|ref|NP_507156.1| metridin-like ShK toxin family memb...    61   1e-08
gi|17557938|ref|NP_503246.1| CC domain and metridin-like ShK tox...    61   1e-08
gi|38422291|emb|CAB04184.2| Hypothetical protein F26D2.14 [Caeno...    61   1e-08
gi|7509718|pir||T26769 hypothetical protein Y39G8B.d - Caenorhab...    61   1e-08
gi|39584301|emb|CAE65465.1| Hypothetical protein CBG10430 [Caeno...    60   2e-08
gi|39584293|emb|CAE65457.1| Hypothetical protein CBG10422 [Caeno...    60   2e-08
gi|39584235|emb|CAE65399.1| Hypothetical protein CBG10350 [Caeno...    60   2e-08
gi|39584295|emb|CAE65459.1| Hypothetical protein CBG10424 [Caeno...    60   2e-08
gi|39583615|emb|CAE65719.1| Hypothetical protein CBG10799 [Caeno...    60   2e-08
gi|17559780|ref|NP_507558.1| predicted CDS, metridin-like ShK to...    59   4e-08
gi|17566796|ref|NP_507333.1| metridin-like ShK toxin family memb...    59   4e-08
gi|7503198|pir||T16330 hypothetical protein F41G3.10 - Caenorhab...    59   5e-08
gi|17559340|ref|NP_504979.1| metridin-like ShK toxin family memb...    59   7e-08
gi|17557570|ref|NP_504877.1| predicted CDS, metridin-like ShK to...    58   1e-07
gi|39588774|emb|CAE58298.1| Hypothetical protein CBG01406 [Caeno...    58   1e-07
gi|17532779|ref|NP_496243.1| metridin-like ShK toxin family memb...    57   2e-07
gi|17566800|ref|NP_507335.1| metridin-like ShK toxin family memb...    57   3e-07
gi|31746664|gb|AAF99887.2| Hypothetical protein C46H11.8 [Caenor...    56   4e-07
gi|39591476|emb|CAE73530.1| Hypothetical protein CBG20993 [Caeno...    55   8e-07
gi|17506057|ref|NP_491507.1| metridin-like ShK toxin precursor f...    54   1e-06
gi|39596066|emb|CAE69702.1| Hypothetical protein CBG15963 [Caeno...    54   1e-06
gi|39587299|emb|CAE74953.1| Hypothetical protein CBG22844 [Caeno...    54   1e-06
gi|39587356|emb|CAE75010.1| Hypothetical protein CBG22911 [Caeno...    54   2e-06
gi|5732926|gb|AAD49342.1| excretory/secretory mucin MUC-5 [Toxoc...    53   3e-06
gi|39590221|emb|CAE65959.1| Hypothetical protein CBG11142 [Caeno...    53   3e-06
gi|39591515|emb|CAE73569.1| Hypothetical protein CBG21039 [Caeno...    53   3e-06
gi|39579535|emb|CAE56086.1| Hypothetical protein CBG23670 [Caeno...    53   4e-06
gi|5732922|gb|AAD49340.1| excretory/secretory mucin MUC-3 [Toxoc...    52   5e-06
gi|39579000|emb|CAE57036.1| Hypothetical protein CBG24919 [Caeno...    52   5e-06
gi|17568029|ref|NP_510745.1| metridin-like ShK toxin family memb...    52   6e-06
gi|34850045|gb|AAF99973.2| Hypothetical protein F52G3.5 [Caenorh...    52   6e-06
gi|37619829|emb|CAA98497.2| Hypothetical protein F58B4.1a [Caeno...    52   8e-06
gi|1103869|gb|AAB05820.1| surface coat glycoprotein TES-120 prec...    51   1e-05
gi|17533231|ref|NP_496658.1| CC domain and metridin-like ShK tox...    50   2e-05
gi|39591513|emb|CAE73567.1| Hypothetical protein CBG21037 [Caeno...    50   3e-05
gi|5732924|gb|AAD49341.1| excretory/secretory mucin MUC-4 [Toxoc...    50   3e-05
gi|17506059|ref|NP_491508.1| metridin-like ShK toxin family memb...    50   3e-05
gi|39585704|emb|CAE59906.1| Hypothetical protein CBG03390 [Caeno...    50   3e-05
gi|17561176|ref|NP_503270.1| metridin-like ShK toxin family memb...    49   4e-05
gi|17557944|ref|NP_503238.1| CC domain and metridin-like ShK tox...    49   4e-05
gi|17561174|ref|NP_503269.1| predicted CDS, excretory secretory ...    49   4e-05
gi|39596022|emb|CAE67525.1| Hypothetical protein CBG13046 [Caeno...    49   5e-05
gi|17561170|ref|NP_503267.1| excretory secretory mucin MUC-5 lik...    49   7e-05
gi|39581742|emb|CAE71075.1| Hypothetical protein CBG17919 [Caeno...    48   9e-05
gi|5732920|gb|AAD49339.1| excretory/secretory mucin MUC-2 [Toxoc...    48   1e-04
gi|17560534|ref|NP_506981.1| predicted CDS, metridin-like ShK to...    48   1e-04
gi|17505853|ref|NP_491709.1| tyrosinase family member (82.2 kD) ...    47   2e-04
gi|957315|gb|AAB34577.1| Myc homolog [Crassostrea virginica]           47   2e-04
gi|39579001|emb|CAE57037.1| Hypothetical protein CBG24920 [Caeno...    47   3e-04
gi|39595381|emb|CAE60419.1| Hypothetical protein CBG04025 [Caeno...    46   4e-04
gi|34555924|emb|CAA18774.2| Hypothetical protein C24F3.3 [Caenor...    46   5e-04
gi|17538754|ref|NP_501871.1| hatching enzyme EHE1 family member ...    46   5e-04
gi|17539740|ref|NP_502533.1| enzyme hatching EHE1 family member ...    45   6e-04
gi|37619780|emb|CAB63429.2| Hypothetical protein 4R79.1 [Caenorh...    45   6e-04
gi|17538172|ref|NP_503121.1| predicted CDS, hatching enzyme EHE1...    45   6e-04
gi|37619826|emb|CAA98057.2| Hypothetical protein F09E8.6 [Caenor...    45   6e-04
gi|39592260|emb|CAE75481.1| Hypothetical protein CBG23485 [Caeno...    45   6e-04
gi|17569607|ref|NP_508154.1| meprin beta family member (XB397) [...    45   8e-04
gi|17541498|ref|NP_500574.1| metridin-like ShK toxin precursor (...    45   8e-04
gi|17558906|ref|NP_506116.1| metridin-like ShK toxin precursor f...    45   0.001
gi|39579482|emb|CAE56872.1| Hypothetical protein CBG24705 [Caeno...    45   0.001
gi|39585222|emb|CAE57465.1| Hypothetical protein CBG00430 [Caeno...    44   0.001
gi|20806091|ref|NP_060034.8| stabilin 2; CD44-like precursor FEL...    44   0.002
gi|32351285|gb|AAP74958.1| FEX2 [Homo sapiens]                         44   0.002
gi|50401629|sp|Q8WWQ8|SBN2_HUMAN Stabilin 2 precursor (FEEL-2 pr...    44   0.002
gi|47077685|dbj|BAD18723.1| FLJ00344 protein [Homo sapiens]            44   0.002
gi|5579501|gb|AAA92361.2| metalloproteinase 1 [Hydra vulgaris]         44   0.002
gi|39591512|emb|CAE73566.1| Hypothetical protein CBG21036 [Caeno...    43   0.004
gi|39589914|emb|CAE60912.1| Hypothetical protein CBG04629 [Caeno...    43   0.004
gi|39587709|emb|CAE58647.1| Hypothetical protein CBG01815 [Caeno...    43   0.004
gi|39579003|emb|CAE57039.1| Hypothetical protein CBG24922 [Caeno...    43   0.004
gi|17506711|ref|NP_492055.1| tyrosinase family member (1H852) [C...    42   0.005
gi|37619824|emb|CAA93663.3| Hypothetical protein F39D8.4 [Caenor...    42   0.005
gi|39596689|emb|CAE63308.1| Hypothetical protein CBG07697 [Caeno...    42   0.007
gi|17565858|ref|NP_506562.1| secreted antigen like (5O838) [Caen...    42   0.007
gi|39592545|emb|CAE63622.1| Hypothetical protein CBG08116 [Caeno...    42   0.007
gi|1729887|sp|P54190|TE26_TOXCA 26 KD SECRETED ANTIGEN PRECURSOR...    42   0.007
gi|39593445|emb|CAE64915.1| Hypothetical protein CBG09735 [Caeno...    42   0.009
gi|136441|sp|P21849|TSA4_GIALA Major surface-labeled trophozoite...    41   0.011
gi|17561612|ref|NP_505785.1| metalloprotease III (5L398) [Caenor...    41   0.011
gi|39582762|emb|CAE74225.1| Hypothetical protein CBG21909 [Caeno...    41   0.011
gi|27373053|gb|AAO12213.1| serine protease 1 [Aurelia aurita]          41   0.011
gi|4009453|gb|AAD03497.1| VSP417-3/A-II [Giardia intestinalis]         40   0.025
gi|39591542|emb|CAE71118.1| Hypothetical protein CBG17971 [Caeno...    40   0.025
gi|17560536|ref|NP_506982.1| predicted CDS, metridin-like ShK to...    40   0.033
gi|6137224|gb|AAF04387.1| variant-specific surface protein; VSP4...    40   0.033
gi|31233310|ref|XP_318851.1| ENSANGP00000014375 [Anopheles gambi...    39   0.043
gi|17568135|ref|NP_510434.1| metridin-like ShK toxin family memb...    39   0.043
gi|4151255|gb|AAD04339.1| variant-specific surface protein 417-4...    39   0.056
gi|50732087|ref|XP_418472.1| PREDICTED: similar to SCO-spondin [...    39   0.056
gi|6650217|gb|AAF21772.1| variant-specific surface protein [Giar...    39   0.056
gi|549130|sp|Q03185|TS11_GIALA Major surface trophozoite antigen...    39   0.073
gi|39585297|emb|CAE61619.1| Hypothetical protein CBG05543 [Caeno...    39   0.073
gi|15011842|ref|NP_032600.2| mitochondrial capsule selenoprotein...    38   0.096
gi|11360382|pir||T10081 sperm mitochondrial capsule selenoprotei...    38   0.096
gi|28202255|sp|P15265|MCS_MOUSE Sperm mitochondrial associated c...    38   0.096
gi|17566514|ref|NP_507839.1| predicted CDS, putative endoplasmic...    38   0.096
gi|33637544|gb|AAQ23916.1| metallothionein IIH [Crassostrea virg...    38   0.096
gi|17563784|ref|NP_508016.1| metridin-like ShK toxin (5V287) [Ca...    38   0.096
gi|39589655|emb|CAE66890.1| Hypothetical protein CBG12271 [Caeno...    38   0.13
gi|39581719|emb|CAE71052.1| Hypothetical protein CBG17894 [Caeno...    38   0.13
gi|630497|pir||S44739 C02C2.1 protein - Caenorhabditis elegans         38   0.13
gi|33637538|gb|AAQ23913.1| metallothionein IIE [Crassostrea virg...    38   0.13
gi|15054372|gb|AAK62032.1| metalloprotease 1 precursor [Ancylost...    38   0.13
gi|17551924|ref|NP_498711.1| tyrosinase and metridin-like ShK to...    38   0.13
gi|39589656|emb|CAE66891.1| Hypothetical protein CBG12272 [Caeno...    38   0.13
gi|39593512|emb|CAE61804.1| Hypothetical protein CBG05771 [Caeno...    37   0.16
gi|31560799|ref|NP_035739.2| tumor necrosis factor receptor supe...    37   0.16
gi|202102|gb|AAA40465.1| tumor necrosis factor receptor                37   0.16
gi|44889660|gb|AAS48429.1| TNF receptor superfamily, member 1A [...    37   0.16
gi|44889658|gb|AAS48428.1| TNF receptor superfamily, member 1A [...    37   0.16
gi|5924059|gb|AAD56428.1| decoy TNF receptor [Salvelinus fontina...    37   0.21
gi|20149764|ref|NP_619614.1| stabilin-2 [Mus musculus] >gnl|BL_O...    37   0.21
gi|23268453|gb|AAN11401.1| metalloprotease 1 precursor [Ancylost...    37   0.21
gi|27807217|ref|NP_777099.1| tumor necrosis factor receptor supe...    37   0.21
gi|13928724|ref|NP_113724.1| mitochondrial capsule selenoprotein...    37   0.21
gi|16799788|ref|NP_470056.1| similar to flagellar hook-associate...    37   0.21
gi|25149641|ref|NP_501114.2| metalloproteinase 1 like precursor ...    37   0.28
gi|7497016|pir||T29277 hypothetical protein C34D4.9 - Caenorhabd...    37   0.28
gi|45549029|ref|NP_476717.3| CG12181-PB [Drosophila melanogaster...    36   0.36
gi|34864902|ref|XP_235015.2| similar to stabilin-2 [Rattus norve...    36   0.36
gi|478817|pir||S29893 salivary glue protein - fruit fly (Drosoph...    36   0.36
gi|2370133|emb|CAA70926.1| mucin [Homo sapiens]                        36   0.36
gi|28850374|gb|AAM08468.2| similar to Dictyostelium discoideum (...    36   0.48
gi|42659788|ref|XP_039877.8| mucin 5, subtype B, tracheobronchia...    36   0.48
gi|23821885|sp|Q9HC84|MU5B_HUMAN Mucin 5B precursor (Mucin 5 sub...    36   0.48
gi|29250343|gb|EAA41838.1| GLP_158_2755_590 [Giardia lamblia ATC...    36   0.48
gi|17554098|ref|NP_499836.1| tyrosinase family member (77.8 kD) ...    36   0.48
gi|47091667|ref|ZP_00229463.1| flagellar hook-associated protein...    36   0.48
gi|2130541|gb|AAC51343.1| mucin MUC5B [Homo sapiens]                   36   0.48
gi|50749679|ref|XP_430101.1| PREDICTED: hypothetical protein XP_...    36   0.48
gi|46906956|ref|YP_013345.1| flagellar hook-associated protein 1...    36   0.48
gi|16802747|ref|NP_464232.1| similar to flagellar hook-associate...    36   0.48
gi|39584299|emb|CAE65463.1| Hypothetical protein CBG10428 [Caeno...    35   0.62
gi|4009352|gb|AAD03483.1| variant-specific surface protein [Giar...    35   0.62
gi|33186908|ref|NP_035838.2| von Willebrand factor [Mus musculus...    35   0.62
gi|2290534|gb|AAB65151.1| sublingual gland mucin [Homo sapiens]        35   0.62
gi|39581621|emb|CAE58406.1| Hypothetical protein CBG01536 [Caeno...    35   0.62
gi|47217533|emb|CAG02460.1| unnamed protein product [Tetraodon n...    35   0.81
gi|38077118|ref|XP_354871.1| similar to sublingual apomucin [Mus...    35   0.81
gi|39591796|emb|CAE71374.1| Hypothetical protein CBG18278 [Caeno...    35   0.81
gi|7497960|pir||T15840 hypothetical protein C54G7.3 - Caenorhabd...    35   0.81
gi|28829058|gb|AAM43609.2| similar to Dictyostelium discoideum (...    35   0.81
gi|30691992|gb|AAP33500.1| cadmium metallothionein [Tetrahymena ...    35   0.81
gi|47522766|ref|NP_999134.1| p55 TNF receptor [Sus scrofa] >gnl|...    35   0.81
gi|23484529|gb|EAA19831.1| RING-finger protein [Plasmodium yoeli...    35   0.81
gi|48374047|ref|NP_997126.2| mucin 19; sublingual apomucin [Mus ...    35   0.81
gi|50760091|ref|XP_417896.1| PREDICTED: similar to ALL-1 protein...    35   1.1
gi|46947106|gb|AAB02256.2| SFE1 [Strongylocentrotus purpuratus]        35   1.1
gi|50405245|ref|YP_054337.1| Putative surface protein with EGF d...    35   1.1
gi|2499181|sp|Q28983|ZAN_PIG Zonadhesin precursor >gnl|BL_ORD_ID...    35   1.1
gi|6678339|ref|NP_033404.1| thrombomodulin [Mus musculus] >gnl|B...    35   1.1
gi|26354540|dbj|BAC40898.1| unnamed protein product [Mus musculus]     35   1.1
gi|33637540|gb|AAQ23914.1| metallothionein IIF [Crassostrea virg...    35   1.1
gi|29248342|gb|EAA39878.1| GLP_77_40692_38983 [Giardia lamblia A...    35   1.1
gi|17555178|ref|NP_499257.1| metridin-like ShK toxin (3L287) [Ca...    35   1.1
gi|28866964|ref|NP_783321.1| metallothionein 1J; metallothionein...    35   1.1
gi|17555180|ref|NP_499258.1| metridin-like ShK toxin (3L289) [Ca...    35   1.1
gi|7512094|pir||T30274 proteoliaisin - sea urchin (Strongylocent...    35   1.1
gi|19032245|emb|CAD24308.1| putative coagulation serine protease...    34   1.4
gi|38638810|gb|AAB69905.3| Nematode astacin protease protein 32 ...    34   1.4
gi|17563756|ref|NP_503351.1| metalloprotease III family member (...    34   1.4
gi|6062595|gb|AAF02907.1| variant-specific surface protein [Giar...    34   1.4
gi|39583647|emb|CAE63751.1| Hypothetical protein CBG08286 [Caeno...    34   1.4
gi|37784506|gb|AAP41950.1| von Willebrand factor [Mus musculus]        34   1.4
gi|39596591|emb|CAE63210.1| Hypothetical protein CBG07566 [Caeno...    34   1.4
gi|14091037|gb|AAK53564.1| tumor necrosis factor receptor 1 prec...    34   1.4
gi|6981664|ref|NP_037223.1| tumor necrosis factor receptor super...    34   1.4
gi|14091035|gb|AAK53563.1| tumor necrosis factor receptor 1 prec...    34   1.4
gi|29246754|gb|EAA38339.1| GLP_251_26574_28757 [Giardia lamblia ...    34   1.4
gi|30690036|ref|NP_195169.3| DNA-binding family protein [Arabido...    34   1.8
gi|26449664|dbj|BAC41956.1| unknown protein [Arabidopsis thaliana]     34   1.8
gi|42573171|ref|NP_974682.1| DNA-binding family protein [Arabido...    34   1.8
gi|34014801|gb|AAO49800.1| MUC19 [Mus musculus]                        34   1.8
gi|39587003|emb|CAE62938.1| Hypothetical protein CBG07145 [Caeno...    34   1.8
gi|7485321|pir||T04789 hypothetical protein F10M10.200 - Arabido...    34   1.8
gi|30690027|ref|NP_849563.1| DNA-binding family protein [Arabido...    34   1.8
gi|23481470|gb|EAA17738.1| hypothetical protein [Plasmodium yoel...    34   1.8
gi|47095271|ref|ZP_00232882.1| flagellar hook-associated protein...    34   1.8
gi|44889656|gb|AAS48427.1| TNF receptor superfamily, member 1A [...    34   1.8
gi|30313663|gb|AAO38851.1| sublingual apomucin [Mus musculus]          34   1.8
gi|47939526|gb|AAH71687.1| MGC4170 protein [Homo sapiens]              33   2.4
gi|34911328|ref|NP_917011.1| putative zinc finger protein [Oryza...    33   2.4
gi|47230395|emb|CAF99588.1| unnamed protein product [Tetraodon n...    33   2.4
gi|39596667|emb|CAE63286.1| Hypothetical protein CBG07666 [Caeno...    33   2.4
gi|46195745|ref|NP_115655.1| hypothetical protein DKFZp761I1011 ...    33   2.4
gi|47208718|emb|CAF91948.1| unnamed protein product [Tetraodon n...    33   2.4
gi|20260280|gb|AAM13038.1| unknown protein [Arabidopsis thaliana...    33   2.4
gi|15239594|ref|NP_197391.1| oxidoreductase, 2OG-Fe(II) oxygenas...    33   2.4
gi|30913170|sp|Q8WSW3|MTCD_TETTH Cadmium metallothionein precurs...    33   2.4
gi|10048477|ref|NP_035871.1| zonadhesin [Mus musculus] >gnl|BL_O...    33   2.4
gi|32189740|ref|NP_859470.1| hypothetical protein Chr3_0360 [Lei...    33   2.4
gi|13492037|gb|AAK28052.1| Zonadhesin >gnl|BL_ORD_ID|1548452 gi|...    33   2.4
gi|17542742|ref|NP_500460.1| SP1070 (4E777) [Caenorhabditis eleg...    33   2.4
gi|34904734|ref|NP_913714.1| helicase-like transcription factor-...    33   2.4
gi|46119101|ref|XP_384927.1| hypothetical protein FG04751.1 [Gib...    33   2.4
gi|22770993|gb|AAN06822.1| cadmium metallothionein [Tetrahymena ...    33   2.4
gi|28828522|gb|AAO51130.1| hypothetical protein [Dictyostelium d...    33   2.4
gi|2506853|sp|P02800|MT1A_HORSE Metallothionein-IA (MT-1A)             33   2.4
gi|72165|pir||SMHO1A metallothionein 1A - horse                        33   2.4
gi|17536241|ref|NP_495390.1| tc5 transposase and CENP-B protein ...    33   3.1
gi|21357303|ref|NP_649295.1| CG9389-PA [Drosophila melanogaster]...    33   3.1
gi|32566017|ref|NP_500195.2| tc5 transposase and CENP-B protein ...    33   3.1
gi|17537507|ref|NP_494714.1| tc5 transposase and CENP-B protein ...    33   3.1
gi|34146947|gb|AAB94140.3| Hypothetical protein M116.3 [Caenorha...    33   3.1
gi|7511607|pir||T15068 protein mut-2 - Caenorhabditis elegans (f...    33   3.1
gi|1346604|sp|P98089|MUCL_RAT Intestinal mucin-like protein (MLP)      33   3.1
gi|285329|pir||A42112 mucin-like peptide MLP 2677 - rat                33   3.1
gi|17541654|ref|NP_501429.1| tc5 transposase and CENP-B protein ...    33   3.1
gi|15451846|ref|NP_001480.2| nuclear receptor subfamily 6, group...    33   3.1
gi|29248834|gb|EAA40359.1| GLP_22_65046_66472 [Giardia lamblia A...    33   3.1
gi|21040480|gb|AAH30600.1| Nuclear receptor subfamily 6, group A...    33   3.1
gi|39581619|emb|CAE58404.1| Hypothetical protein CBG01534 [Caeno...    33   3.1
gi|45382809|ref|NP_989992.1| ovomucin alpha-subunit [Gallus gall...    33   3.1
gi|3135306|gb|AAC78790.1| zonadhesin [Homo sapiens]                    33   3.1
gi|34853889|ref|XP_342428.1| similar to germ cell nuclear factor...    33   3.1
gi|14574305|gb|AAK68445.1| Hypothetical protein Y38F2AR.4 [Caeno...    33   3.1
gi|15451848|ref|NP_201591.1| nuclear receptor subfamily 6, group...    33   3.1
gi|12643728|sp|Q15406|NR61_HUMAN Orphan nuclear receptor NR6A1 (...    33   3.1
gi|394806|emb|CAA43948.1| salivary glue protein [Drosophila mela...    33   3.1
gi|6753956|ref|NP_034394.1| nuclear receptor subfamily 6, group ...    33   3.1
gi|15451850|ref|NP_201592.1| nuclear receptor subfamily 6, group...    33   3.1
gi|33468863|ref|NP_032656.1| metallothionein 2 [Mus musculus] >g...    33   3.1
gi|72163|pir||SMMS2 metallothionein II - mouse                         33   3.1
gi|18653442|gb|AAL77433.1| chitinase [Brassica juncea]                 33   3.1
gi|24651243|ref|NP_733334.1| CG7908-PA [Drosophila melanogaster]...    26   3.5
gi|45550859|ref|NP_651759.3| CG7908-PB [Drosophila melanogaster]...    26   3.8
gi|16768718|gb|AAL28578.1| HL05736p [Drosophila melanogaster]          26   3.8
gi|33300350|emb|CAE17855.1| Hypothetical protein M05D6.8 [Caenor...    33   4.0
gi|3660676|gb|AAC62618.1| metalloprotease mmp21/22C [Homo sapiens]     33   4.0
gi|50760817|ref|XP_418145.1| PREDICTED: similar to enhancer of z...    33   4.0
gi|17560086|ref|NP_506578.1| metridin-like ShK toxin (5O923) [Ca...    33   4.0
gi|25148834|ref|NP_500415.2| metalloproteinase 1 like (19.2 kD) ...    33   4.0
gi|46136737|ref|XP_390060.1| hypothetical protein FG09884.1 [Gib...    33   4.0
gi|47222761|emb|CAG01728.1| unnamed protein product [Tetraodon n...    33   4.0
gi|47214969|emb|CAG01303.1| unnamed protein product [Tetraodon n...    33   4.0
gi|22972988|ref|ZP_00019836.1| hypothetical protein [Chloroflexu...    33   4.0
gi|3645920|gb|AAC63529.1| metalloprotease isoform C [Homo sapiens]     33   4.0
gi|30585417|gb|AAP36981.1| Homo sapiens metallothionein 1H [synt...    33   4.0
gi|1362056|pir||S56648 trypsin inhibitor precursor (clone ATI21)...    33   4.0
gi|136528|sp|P08380|TXA3_RADPA Neurotoxin III (Toxin RpIII) (Sod...    33   4.0
gi|127401|sp|P04355|MT2_RAT Metallothionein-II (MT-II) >gnl|BL_O...    33   4.0
gi|401230|sp|P30785|TXA5_RADMA Neurotoxin 5 (Toxin RTX-V) >gnl|B...    33   4.0
gi|10835085|ref|NP_005942.1| metallothionein 1H [Homo sapiens] >...    33   4.0
gi|6048743|gb|AAF02299.1| chitinase [Brassica juncea]                  33   4.0
gi|21654762|gb|AAK84670.1| polyprotein precursor [gill-associate...    32   5.3
gi|17533715|ref|NP_495591.1| putative protein, with at least 3 t...    32   5.3
gi|15722000|gb|AAL04415.1| zonadhesin splice variant 2 [Homo sap...    32   5.3
gi|27881488|ref|NP_775079.1| zonadhesin isoform 2 [Homo sapiens]...    32   5.3
gi|28379316|ref|NP_786208.1| extracellular protein [Lactobacillu...    32   5.3
gi|27881494|ref|NP_775082.1| zonadhesin isoform 6 [Homo sapiens]...    32   5.3
gi|15721998|gb|AAL04413.1| zonadhesin splice variant 6 [Homo sap...    32   5.3
gi|39580768|emb|CAE58937.1| Hypothetical protein CBG02205 [Caeno...    32   5.3
gi|32563693|ref|NP_492177.2| zinc carboxypeptidase A metalloprot...    32   5.3
gi|27881492|ref|NP_775081.1| zonadhesin isoform 5 [Homo sapiens]...    32   5.3
gi|15721997|gb|AAL04412.1| zonadhesin splice variant 5 [Homo sap...    32   5.3
gi|29250441|gb|EAA41935.1| GLP_39_78272_71763 [Giardia lamblia A...    32   5.3
gi|46132537|ref|ZP_00202933.1| COG1716: FOG: FHA domain [Ralston...    32   5.3
gi|24663466|ref|NP_729831.1| CG17666-PB [Drosophila melanogaster...    32   5.3
gi|29150368|gb|AAO72377.1| putative oxidoreductase [Oryza sativa...    32   5.3
gi|24663462|ref|NP_648599.1| CG17666-PA [Drosophila melanogaster...    32   5.3
gi|21063971|gb|AAM29215.1| AT06220p [Drosophila melanogaster]          32   5.3
gi|25141272|ref|NP_491174.2| carboxypeptidase a2 family member (...    32   5.3
gi|16554449|ref|NP_003377.1| zonadhesin isoform 3 [Homo sapiens]...    32   5.3
gi|27924006|sp|Q9Y493|ZAN_HUMAN Zonadhesin precursor >gnl|BL_ORD...    32   5.3
gi|19115301|ref|NP_594389.1| hypothetical protein with coiled-co...    32   5.3
gi|39582093|emb|CAE63736.1| Hypothetical protein CBG08265 [Caeno...    32   5.3
gi|7506614|pir||T24170 hypothetical protein R11A5.7 - Caenorhabd...    32   5.3
gi|46228776|gb|EAK89646.1| protein with 2x PHD domains [Cryptosp...    32   5.3
gi|17390423|gb|AAH18190.1| Metallothionein 1X [Homo sapiens]           32   5.3
gi|27881490|ref|NP_775080.1| zonadhesin isoform 4 [Homo sapiens]...    32   5.3
gi|39590599|emb|CAE64969.1| Hypothetical protein CBG09803 [Caeno...    32   5.3
gi|15721999|gb|AAL04414.1| zonadhesin splice variant 4 [Homo sap...    32   5.3
gi|127395|sp|P02799|MT2_CRIGR Metallothionein-II (MT-II) >gnl|BL...    32   5.3
gi|401229|sp|P30784|TXA4_RADMA Neurotoxin 4 (Toxin RTX-IV) >gnl|...    32   5.3
gi|13383506|gb|AAK21011.1| zonadhesin [Homo sapiens]                   32   5.3
gi|27881486|ref|NP_775078.1| zonadhesin isoform 1 [Homo sapiens]...    32   5.3
gi|15721995|gb|AAL04410.1| zonadhesin splice variant 1 [Homo sap...    32   5.3
gi|48976131|ref|NP_001001771.1| fibrillin 1 [Sus scrofa] >gnl|BL...    29   6.8
gi|7489933|pir||T30545 major surface glycoprotein - Pneumocystis...    32   6.9
gi|25005280|emb|CAD28559.2| metalloprotease I [Ostertagia ostert...    32   6.9
gi|30686940|ref|NP_194290.2| ShTK domain-containing protein [Ara...    32   6.9
gi|21396511|dbj|BAC00855.1| chorionic proteinase inhibitor [Trib...    32   6.9
gi|39589900|emb|CAE60898.1| Hypothetical protein CBG04613 [Caeno...    32   6.9
gi|18405808|ref|NP_566838.1| oxidoreductase, 2OG-Fe(II) oxygenas...    32   6.9
gi|18086437|gb|AAL57673.1| AT3g28480/MFJ20_16 [Arabidopsis thali...    32   6.9
gi|7486817|pir||T05787 hypothetical protein M7J2.30 - Arabidopsi...    32   6.9
gi|9294583|dbj|BAB02864.1| prolyl 4-hydroxylase alpha subunit-li...    32   6.9
gi|29251488|gb|EAA42969.1| GLP_170_92010_93062 [Giardia lamblia ...    32   6.9
gi|25365919|pir||H85295 hypothetical protein AT4g25600 [imported...    32   6.9
gi|48094395|ref|XP_392121.1| similar to thrombospondin repeat co...    32   6.9
gi|28190036|gb|AAO32956.1| MTD [Homo sapiens]                          32   6.9
gi|34393269|dbj|BAC83179.1| prolyl 4-hydroxylase alpha-1 subunit...    32   6.9
gi|224784|prf||1201189A metallothionein                                32   6.9
gi|44894225|gb|AAS48650.1| ADAM metalloprotease CG7908 [Drosophi...    26   7.5
gi|1638875|gb|AAC50778.1| enhancer of zeste homolog 1 [Homo sapi...    32   9.0
gi|19923202|ref|NP_001982.2| enhancer of zeste homolog 1 [Homo s...    32   9.0
gi|24650519|ref|NP_651533.1| CG6124-PA [Drosophila melanogaster]...    32   9.0
gi|31205855|ref|XP_311879.1| ENSANGP00000017658 [Anopheles gambi...    32   9.0
gi|31205059|ref|XP_311478.1| ENSANGP00000022434 [Anopheles gambi...    32   9.0
gi|50757548|ref|XP_415562.1| PREDICTED: similar to F-box and WD-...    32   9.0
gi|29250510|gb|EAA42002.1| GLP_68_2582_684 [Giardia lamblia ATCC...    32   9.0
gi|18378985|ref|NP_563658.1| maternal embryogenesis control prot...    32   9.0
gi|31239543|ref|XP_320185.1| ENSANGP00000011153 [Anopheles gambi...    32   9.0
gi|39582154|emb|CAE71486.1| Hypothetical protein CBG18408 [Caeno...    32   9.0
gi|22535957|gb|AAN01133.1| geranyl diphosphate synthase [Abies g...    32   9.0
gi|45479858|gb|AAS66770.1| cys-rich cocoon protein [Theromyzon r...    32   9.0
gi|31982093|ref|NP_766201.2| RIKEN cDNA 9330174J19 [Mus musculus...    32   9.0
gi|19703599|ref|NP_603161.1| Fusobacterium outer membrane protei...    32   9.0
gi|4138141|emb|CAA10175.1| ss-galactosidase [Lycopersicon escule...    32   9.0
gi|12643811|sp|Q9NJ15|PCK5_BRACL Proprotein convertase subtilisi...    32   9.0
gi|7488975|pir||T04340 beta-galactosidase (EC 3.2.1.23) II precu...    32   9.0
gi|40788238|dbj|BAA20842.2| KIAA0388 [Homo sapiens]                    32   9.0
gi|26347771|dbj|BAC37534.1| unnamed protein product [Mus musculus]     32   9.0
gi|28626521|ref|NP_066363.1| KIAA1404 protein [Homo sapiens] >gn...    32   9.0
gi|17564882|ref|NP_506136.1| i-36 protein family member (5M990) ...    32   9.0
gi|26324718|dbj|BAC26113.1| unnamed protein product [Mus musculus]     32   9.0
gi|37619828|emb|CAE48502.1| Hypothetical protein F58B4.1b [Caeno...    32   9.0
gi|39587543|emb|CAE58481.1| Hypothetical protein CBG01624 [Caeno...    32   9.0
gi|50233783|ref|NP_542795.1| chromosome 20 open reading frame 12...    32   9.0
gi|13310412|gb|AAK18278.1| metallothionein 1H-like protein [Homo...    32   9.0
gi|18201974|sp|O18842|MT_BALMY Metallothionein (MT) >gnl|BL_ORD_...    32   9.0
gi|127370|sp|P04732|MT1E_HUMAN Metallothionein-IE (MT-1E) >gnl|B...    32   9.0
gi|26325258|dbj|BAC26383.1| unnamed protein product [Mus musculus]     32   9.0
gi|33329232|gb|AAQ10016.1| putative esophageal gland cell secret...    32   9.0


>gi|17532865|ref|NP_496932.1| metridin-like ShK toxin precursor
           family member (2O286) [Caenorhabditis elegans]
 gi|7498414|pir||T20466 hypothetical protein F01D5.1 -
           Caenorhabditis elegans
 gi|3875502|emb|CAB04039.1| Hypothetical protein F01D5.1
           [Caenorhabditis elegans]
          Length = 178

 Score =  401 bits (1030), Expect = e-111
 Identities = 178/178 (100%), Positives = 178/178 (100%)
 Frame = -1

Query: 537 MICYAVFLIFLAQFANAQDKPCIDDPNVKCEDFKDDCATEKMIPLLKESCPVTCKLCPPT 358
           MICYAVFLIFLAQFANAQDKPCIDDPNVKCEDFKDDCATEKMIPLLKESCPVTCKLCPPT
Sbjct: 1   MICYAVFLIFLAQFANAQDKPCIDDPNVKCEDFKDDCATEKMIPLLKESCPVTCKLCPPT 60

Query: 357 EAPTTLAPCFDDKDTDCASFKQFCSNSKYIPMLKSFCPVTCNMCPGATTVMPTPNPNCQD 178
           EAPTTLAPCFDDKDTDCASFKQFCSNSKYIPMLKSFCPVTCNMCPGATTVMPTPNPNCQD
Sbjct: 61  EAPTTLAPCFDDKDTDCASFKQFCSNSKYIPMLKSFCPVTCNMCPGATTVMPTPNPNCQD 120

Query: 177 NGPNCAGWVKNGYCNKCFYKCSEREKYCAKSCGFCTPGTCKDCNSLETLFSFGANKLL 4
           NGPNCAGWVKNGYCNKCFYKCSEREKYCAKSCGFCTPGTCKDCNSLETLFSFGANKLL
Sbjct: 121 NGPNCAGWVKNGYCNKCFYKCSEREKYCAKSCGFCTPGTCKDCNSLETLFSFGANKLL 178




[DB home][top]