Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F08G12_2
(996 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17551498|ref|NP_509886.1| u5 snRNP-specific protein (XL916) [... 687 0.0
gi|39594799|emb|CAE70667.1| Hypothetical protein CBG17375 [Caeno... 613 e-174
gi|17505659|ref|NP_491325.1| u5 snRNP-specific protein (36.8 kD)... 442 e-123
gi|7496291|pir||T15181 hypothetical protein C18E3.5 - Caenorhabd... 408 e-113
gi|37231578|gb|AAH58365.1| Prp8bp-pending protein [Mus musculus] 396 e-109
gi|16306637|gb|AAH01494.1| U5 snRNP-specific 40 kDa protein (hPr... 396 e-109
gi|50759611|ref|XP_417704.1| PREDICTED: similar to Prp8bp-pendin... 394 e-108
gi|4758560|ref|NP_004805.1| U5 snRNP-specific 40 kDa protein (hP... 392 e-108
gi|41053421|ref|NP_956616.1| similar to U5 snRNP-specific 40 kDa... 387 e-106
gi|39586335|emb|CAE66746.1| Hypothetical protein CBG12096 [Caeno... 385 e-105
gi|32822805|gb|AAH54992.1| MGC64565 protein [Xenopus laevis] 382 e-105
gi|27924436|gb|AAH45034.1| Prp8bp-pending-prov protein [Xenopus ... 380 e-104
gi|31202483|ref|XP_310190.1| ENSANGP00000010898 [Anopheles gambi... 378 e-103
gi|20129125|ref|NP_608501.1| CG3436-PA [Drosophila melanogaster]... 367 e-100
gi|47216142|emb|CAG10016.1| unnamed protein product [Tetraodon n... 365 1e-99
gi|15224356|ref|NP_181905.1| transducin family protein / WD-40 r... 360 2e-98
gi|21313414|ref|NP_079921.1| U5 snRNP-specific protein (Prp8-bin... 333 3e-90
gi|3746838|gb|AAC64084.1| 38kDa splicing factor; SPF 38 [Homo sa... 332 6e-90
gi|42733993|gb|AAO52600.2| similar to Arabidopsis thaliana (Mous... 332 1e-89
gi|34871679|ref|XP_232775.2| similar to U5 snRNP-specific protei... 311 1e-83
gi|32410343|ref|XP_325652.1| hypothetical protein [Neurospora cr... 277 2e-73
gi|49134361|ref|XP_413222.1| hypothetical protein AN9085.2 [Aspe... 272 1e-71
gi|46111533|ref|XP_382824.1| hypothetical protein FG02648.1 [Gib... 271 2e-71
gi|38104352|gb|EAA50934.1| hypothetical protein MG04693.4 [Magna... 262 8e-69
gi|19113627|ref|NP_596835.1| WD repeat protein; human U5 SNRNP-s... 262 1e-68
gi|50256786|gb|EAL19506.1| hypothetical protein CNBG4530 [Crypto... 203 4e-51
gi|46226958|gb|EAK87924.1| WD repeat protein [Cryptosporidium pa... 199 8e-50
gi|23612787|ref|NP_704326.1| u5 snrnp-specific protein, putative... 195 1e-48
gi|23490090|gb|EAA21947.1| hypothetical protein [Plasmodium yoel... 194 2e-48
gi|49069172|ref|XP_398875.1| hypothetical protein UM01260.1 [Ust... 181 3e-44
gi|50421219|ref|XP_459155.1| unnamed protein product [Debaryomyc... 160 3e-38
gi|23128312|ref|ZP_00110163.1| COG2319: FOG: WD40 repeat [Nostoc... 157 4e-37
gi|20892399|ref|XP_148059.1| expressed sequence AI606931 [Mus mu... 153 5e-36
gi|23128981|ref|ZP_00110817.1| COG2319: FOG: WD40 repeat [Nostoc... 151 2e-35
gi|27666788|ref|XP_221406.1| similar to WD repeat domain 5B [Rat... 151 3e-35
gi|17230958|ref|NP_487506.1| WD-40 repeat protein [Nostoc sp. PC... 148 2e-34
gi|31196347|ref|XP_307121.1| ENSANGP00000012135 [Anopheles gambi... 147 4e-34
gi|46134381|ref|ZP_00157805.2| COG2319: FOG: WD40 repeat [Anabae... 147 5e-34
gi|17230292|ref|NP_486840.1| WD-repeat protein [Nostoc sp. PCC 7... 146 8e-34
gi|20302740|gb|AAM18868.1| unknown [Branchiostoma floridae] 145 1e-33
gi|17864654|ref|NP_524984.1| CG17437-PA [Drosophila melanogaster... 145 1e-33
gi|23199987|ref|NP_061942.2| WD repeat domain 5B [Homo sapiens] ... 145 1e-33
gi|23128236|ref|ZP_00110089.1| COG2319: FOG: WD40 repeat [Nostoc... 145 1e-33
gi|16554627|ref|NP_060058.1| WD repeat domain 5 protein; WD-repe... 144 3e-33
gi|50757207|ref|XP_415427.1| PREDICTED: similar to Zgc:56591 pro... 144 3e-33
gi|34853150|ref|XP_342398.1| similar to hypothetical protein [Ra... 144 3e-33
gi|6714707|emb|CAB66159.1| hypothetical protein [Homo sapiens] 144 3e-33
gi|23130132|ref|ZP_00111951.1| COG2319: FOG: WD40 repeat [Nostoc... 144 4e-33
gi|30353827|gb|AAH52124.1| Zgc:76895 protein [Danio rerio] >gnl|... 144 4e-33
gi|40949819|gb|AAR97571.1| will die slowly [Bombyx mori] 144 4e-33
gi|23126805|ref|ZP_00108691.1| COG2319: FOG: WD40 repeat [Nostoc... 144 4e-33
gi|3023956|sp|Q00808|HET1_PODAN Vegetatible incompatibility prot... 144 4e-33
gi|37523925|ref|NP_927302.1| WD-repeat protein [Gloeobacter viol... 143 5e-33
gi|37522390|ref|NP_925767.1| WD-repeat protein [Gloeobacter viol... 142 9e-33
gi|17225206|gb|AAL37299.1| beta transducin-like protein HET-E2C*... 142 9e-33
gi|7023854|dbj|BAA92110.1| unnamed protein product [Homo sapiens] 142 1e-32
gi|17227525|ref|NP_484073.1| WD-40 repeat protein [Nostoc sp. PC... 142 1e-32
gi|45506973|ref|ZP_00159321.1| COG2319: FOG: WD40 repeat [Anabae... 142 2e-32
gi|17225204|gb|AAL37298.1| beta transducin-like protein HET-E2C ... 142 2e-32
gi|17225208|gb|AAL37300.1| beta transducin-like protein HET-E2C*... 142 2e-32
gi|50416345|gb|AAH77844.1| Unknown (protein for MGC:80538) [Xeno... 140 5e-32
gi|11359958|pir||T46935 hypothetical protein DKFZp434D199.1 - hu... 140 5e-32
gi|23124810|ref|ZP_00106776.1| COG2319: FOG: WD40 repeat [Nostoc... 140 6e-32
gi|37522457|ref|NP_925834.1| WD-repeat protein [Gloeobacter viol... 139 1e-31
gi|45508311|ref|ZP_00160650.1| COG2319: FOG: WD40 repeat [Anabae... 139 1e-31
gi|17225210|gb|AAL37301.1| beta transducin-like protein HET-D2Y ... 137 4e-31
gi|17227934|ref|NP_484482.1| serine/threonine kinase with WD-40 ... 137 4e-31
gi|17227780|ref|NP_484328.1| WD-40 repeat protein [Nostoc sp. PC... 136 7e-31
gi|45506782|ref|ZP_00159132.1| COG2319: FOG: WD40 repeat [Anabae... 136 7e-31
gi|39580327|emb|CAE64482.1| Hypothetical protein CBG09206 [Caeno... 136 9e-31
gi|23130638|ref|ZP_00112451.1| COG2319: FOG: WD40 repeat [Nostoc... 135 1e-30
gi|46135357|ref|ZP_00162759.2| COG2319: FOG: WD40 repeat [Anabae... 135 1e-30
gi|23130558|ref|ZP_00112371.1| COG2319: FOG: WD40 repeat [Nostoc... 134 3e-30
gi|45509691|ref|ZP_00162024.1| COG2319: FOG: WD40 repeat [Anabae... 134 3e-30
gi|49124494|ref|XP_412605.1| hypothetical protein AN8468.2 [Aspe... 134 3e-30
gi|46134602|ref|ZP_00158196.2| COG2319: FOG: WD40 repeat [Anabae... 134 4e-30
gi|23124949|ref|ZP_00106905.1| COG2319: FOG: WD40 repeat [Nostoc... 132 9e-30
gi|46135387|ref|ZP_00162792.2| COG2319: FOG: WD40 repeat [Anabae... 132 1e-29
gi|45508310|ref|ZP_00160649.1| COG2319: FOG: WD40 repeat [Anabae... 132 2e-29
gi|23129632|ref|ZP_00111458.1| COG2319: FOG: WD40 repeat [Nostoc... 131 3e-29
gi|46130702|ref|XP_389131.1| hypothetical protein FG08955.1 [Gib... 130 6e-29
gi|48891847|ref|ZP_00325296.1| COG2319: FOG: WD40 repeat [Tricho... 129 8e-29
gi|17568701|ref|NP_510394.1| WD repeat domain 5B (43.1 kD) (XO96... 129 8e-29
gi|48894805|ref|ZP_00327914.1| COG2319: FOG: WD40 repeat [Tricho... 129 1e-28
gi|37523920|ref|NP_927297.1| WD-repeat protein [Gloeobacter viol... 129 1e-28
gi|23124439|ref|ZP_00106428.1| COG2319: FOG: WD40 repeat [Nostoc... 129 1e-28
gi|23126094|ref|ZP_00108001.1| COG2319: FOG: WD40 repeat [Nostoc... 128 2e-28
gi|17552164|ref|NP_497749.1| WD repeat domain 5B (3E795) [Caenor... 128 2e-28
gi|48891324|ref|ZP_00324864.1| COG2319: FOG: WD40 repeat [Tricho... 128 2e-28
gi|50252234|dbj|BAD28241.1| putative WD repeat domain 5B [Oryza ... 128 2e-28
gi|23129722|ref|ZP_00111547.1| COG2319: FOG: WD40 repeat [Nostoc... 128 2e-28
gi|48893630|ref|ZP_00326828.1| COG2319: FOG: WD40 repeat [Tricho... 127 5e-28
gi|17230611|ref|NP_487159.1| WD repeat protein with Ser/Thr prot... 127 5e-28
gi|45507426|ref|ZP_00159770.1| COG2319: FOG: WD40 repeat [Anabae... 126 9e-28
gi|23130298|ref|ZP_00112115.1| COG2319: FOG: WD40 repeat [Nostoc... 126 9e-28
gi|37521534|ref|NP_924911.1| WD-repeat protein [Gloeobacter viol... 125 2e-27
gi|23129032|ref|ZP_00110866.1| COG2319: FOG: WD40 repeat [Nostoc... 125 2e-27
gi|17232326|ref|NP_488874.1| WD-repeat protein [Nostoc sp. PCC 7... 124 3e-27
gi|15229187|ref|NP_190535.1| transducin family protein / WD-40 r... 124 3e-27
gi|45509405|ref|ZP_00161739.1| COG2319: FOG: WD40 repeat [Anabae... 124 3e-27
gi|23130123|ref|ZP_00111942.1| COG2319: FOG: WD40 repeat [Nostoc... 124 3e-27
gi|17232251|ref|NP_488799.1| WD-repeat protein [Nostoc sp. PCC 7... 124 4e-27
gi|18424859|ref|NP_568993.1| transducin family protein / WD-40 r... 124 4e-27
gi|5051805|emb|CAB45034.1| putative WD-repeat containing protein... 124 4e-27
gi|17229616|ref|NP_486164.1| WD-40 repeat protein [Nostoc sp. PC... 123 7e-27
gi|17228160|ref|NP_484708.1| WD-40 repeat protein [Nostoc sp. PC... 123 7e-27
gi|32189425|ref|NP_849143.1| hypothetical protein FLJ25955 [Homo... 122 1e-26
gi|37522224|ref|NP_925601.1| WD-repeat protein [Gloeobacter viol... 122 2e-26
gi|23126612|ref|ZP_00108502.1| COG2319: FOG: WD40 repeat [Nostoc... 122 2e-26
gi|48893580|ref|ZP_00326778.1| COG2319: FOG: WD40 repeat [Tricho... 122 2e-26
gi|45505417|ref|ZP_00157801.1| COG2319: FOG: WD40 repeat [Anabae... 122 2e-26
gi|37520294|ref|NP_923671.1| WD-40 repeat protein [Gloeobacter v... 121 2e-26
gi|21758953|dbj|BAC05425.1| unnamed protein product [Homo sapiens] 121 2e-26
gi|46119952|ref|ZP_00179225.2| COG2319: FOG: WD40 repeat [Crocos... 121 3e-26
gi|37520475|ref|NP_923852.1| WD-repeat protein [Gloeobacter viol... 120 4e-26
gi|17227974|ref|NP_484522.1| WD-40 repeat protein [Nostoc sp. PC... 120 4e-26
gi|17233145|ref|NP_490235.1| WD-repeat protein [Nostoc sp. PCC 7... 120 5e-26
gi|48846051|ref|ZP_00300319.1| COG2319: FOG: WD40 repeat [Geobac... 120 5e-26
gi|22298032|ref|NP_681279.1| WD-40 repeat protein [Thermosynecho... 120 5e-26
gi|45506958|ref|ZP_00159306.1| COG2319: FOG: WD40 repeat [Anabae... 120 6e-26
gi|48891596|ref|ZP_00325089.1| COG0515: Serine/threonine protein... 120 6e-26
gi|48893278|ref|ZP_00326547.1| COG0515: Serine/threonine protein... 120 6e-26
gi|45509197|ref|ZP_00161532.1| COG2319: FOG: WD40 repeat [Anabae... 119 8e-26
gi|23126059|ref|ZP_00107968.1| COG2319: FOG: WD40 repeat [Nostoc... 119 8e-26
gi|23124360|ref|ZP_00106355.1| COG2319: FOG: WD40 repeat [Nostoc... 119 1e-25
gi|17566626|ref|NP_505737.1| WD repeat domain 5B (54.5 kD) (5L21... 118 2e-25
gi|17227743|ref|NP_484291.1| WD-40 repeat protein [Nostoc sp. PC... 118 2e-25
gi|50539926|ref|NP_001002429.1| zgc:92654 [Danio rerio] >gnl|BL_... 118 2e-25
gi|15242311|ref|NP_196473.1| transducin family protein / WD-40 r... 118 2e-25
gi|45509331|ref|ZP_00161665.1| COG2319: FOG: WD40 repeat [Anabae... 118 2e-25
gi|46134601|ref|ZP_00158195.2| COG2319: FOG: WD40 repeat [Anabae... 117 3e-25
gi|50751998|ref|XP_422608.1| PREDICTED: similar to hypothetical ... 117 3e-25
gi|45433584|ref|NP_991399.1| hypothetical protein MGC76037 [Xeno... 117 3e-25
gi|45361545|ref|NP_989349.1| hypothetical protein MGC76247 [Xeno... 117 4e-25
gi|1346729|sp|P49695|PKWA_THECU Probable serine/threonine-protei... 117 4e-25
gi|14132774|gb|AAK52334.1| LIS1 [Xenopus laevis] 117 4e-25
gi|48835147|ref|ZP_00292148.1| COG2319: FOG: WD40 repeat [Thermo... 117 4e-25
gi|17227779|ref|NP_484327.1| WD-40 repeat protein [Nostoc sp. PC... 117 4e-25
gi|37520744|ref|NP_924121.1| WD-repeat protein [Gloeobacter viol... 117 5e-25
gi|3122952|sp|O15736|TIPD_DICDI Protein tipD >gnl|BL_ORD_ID|3655... 116 7e-25
gi|49102841|ref|XP_411097.1| hypothetical protein AN6960.2 [Aspe... 116 9e-25
gi|47229875|emb|CAG07071.1| unnamed protein product [Tetraodon n... 115 2e-24
gi|480009|pir||S36113 LIS-1 protein - human 115 2e-24
gi|22972904|ref|ZP_00019756.1| hypothetical protein [Chloroflexu... 115 2e-24
gi|47523580|ref|NP_999415.1| platelet-activating factor acetylhy... 115 2e-24
gi|7305363|ref|NP_038653.1| platelet-activating factor acetylhyd... 115 2e-24
gi|17056921|gb|AAL34972.1| Miller-Dieker lissencephaly protein [... 115 2e-24
gi|4557741|ref|NP_000421.1| platelet-activating factor acetylhyd... 115 2e-24
gi|45383504|ref|NP_989655.1| platelet-activating factor acetylhy... 115 2e-24
gi|27807199|ref|NP_777088.1| platelet-activating factor acetylhy... 115 2e-24
gi|23574762|dbj|BAC20600.1| platelet activating factor acetylhyd... 114 3e-24
gi|15235470|ref|NP_192182.1| transducin family protein / WD-40 r... 114 3e-24
gi|349828|gb|AAA02882.1| Miller-Dieker lissencephaly protein 113 6e-24
gi|16331266|ref|NP_441994.1| beta transducin-like protein [Synec... 113 6e-24
gi|37682095|gb|AAQ97974.1| TUWD12 [Danio rerio] 113 8e-24
gi|49091992|ref|XP_407457.1| hypothetical protein AN3320.2 [Aspe... 113 8e-24
gi|48895484|ref|ZP_00328468.1| COG2319: FOG: WD40 repeat [Tricho... 112 1e-23
gi|41056233|ref|NP_956412.1| Unknown (protein for MGC:63538); wu... 112 1e-23
gi|41724850|ref|ZP_00151660.1| COG2319: FOG: WD40 repeat [Dechlo... 112 1e-23
gi|41152231|ref|NP_958503.1| platelet-activating factor acetylhy... 112 1e-23
gi|49073338|ref|XP_400895.1| hypothetical protein UM03280.1 [Ust... 112 2e-23
gi|17230283|ref|NP_486831.1| WD-repeat protein [Nostoc sp. PCC 7... 112 2e-23
gi|45508168|ref|ZP_00160508.1| COG2319: FOG: WD40 repeat [Anabae... 111 2e-23
gi|17230661|ref|NP_487209.1| WD repeat protein with Ser/Thr prot... 111 3e-23
gi|10177204|dbj|BAB10306.1| unnamed protein product [Arabidopsis... 111 3e-23
gi|49523068|gb|AAH75548.1| Unknown (protein for MGC:89488) [Xeno... 110 4e-23
gi|37523230|ref|NP_926607.1| WD-40 repeat protein [Gloeobacter v... 110 4e-23
gi|449693|prf||1919424A Miller-Dieker lissencephaly gene 110 5e-23
gi|37521813|ref|NP_925190.1| WD-repeat protein [Gloeobacter viol... 110 5e-23
gi|46130696|ref|XP_389128.1| hypothetical protein FG08952.1 [Gib... 110 5e-23
gi|46135416|ref|ZP_00203492.1| COG2319: FOG: WD40 repeat [Anabae... 110 7e-23
gi|17056923|gb|AAL34973.1| Miller-Dieker lissencephaly protein [... 110 7e-23
gi|12854841|dbj|BAB30146.1| unnamed protein product [Mus musculus] 110 7e-23
gi|34394218|dbj|BAC84670.1| putative WD repeat domain 5 protein ... 109 9e-23
gi|46111239|ref|XP_382677.1| hypothetical protein FG02501.1 [Gib... 109 9e-23
gi|49101231|ref|XP_410940.1| hypothetical protein AN6803.2 [Aspe... 109 9e-23
gi|31231745|ref|XP_318586.1| ENSANGP00000020892 [Anopheles gambi... 109 1e-22
gi|50754099|ref|XP_414244.1| PREDICTED: similar to DKFZP434C245 ... 109 1e-22
gi|48840987|ref|ZP_00297913.1| COG2319: FOG: WD40 repeat [Methan... 109 1e-22
gi|48893749|ref|ZP_00326947.1| COG2319: FOG: WD40 repeat [Tricho... 109 1e-22
gi|4559414|gb|AAD23059.1| LIS [Mus musculus] 109 1e-22
gi|48096118|ref|XP_392399.1| similar to CG8440-PA [Apis mellifera] 109 1e-22
gi|2104937|gb|AAC63098.1| truncated form platelet-activating fac... 109 1e-22
gi|48893643|ref|ZP_00326841.1| COG2319: FOG: WD40 repeat [Tricho... 108 1e-22
gi|17232051|ref|NP_488599.1| WD-40 repeat-protein [Nostoc sp. PC... 108 1e-22
gi|31226862|ref|XP_317781.1| ENSANGP00000022244 [Anopheles gambi... 108 2e-22
gi|31240513|ref|XP_320670.1| ENSANGP00000021164 [Anopheles gambi... 108 2e-22
gi|47212444|emb|CAG11397.1| unnamed protein product [Tetraodon n... 108 2e-22
gi|34851410|ref|XP_213850.2| similar to RIKEN cDNA 1500041N16 [R... 108 2e-22
gi|26326543|dbj|BAC27015.1| unnamed protein product [Mus musculus] 107 3e-22
gi|33468969|ref|NP_065626.1| transducin (beta)-like 1 X-linked; ... 107 3e-22
gi|12840673|dbj|BAB24913.1| unnamed protein product [Mus musculu... 107 3e-22
gi|47085759|ref|NP_998214.1| zgc:56055 [Danio rerio] >gnl|BL_ORD... 107 3e-22
gi|49073067|ref|XP_400779.1| hypothetical protein UM03164.1 [Ust... 107 3e-22
gi|46134549|ref|ZP_00158076.2| COG2319: FOG: WD40 repeat [Anabae... 107 3e-22
gi|17554220|ref|NP_499755.1| human LISsencephaly gene related (4... 107 4e-22
gi|48097023|ref|XP_393667.1| similar to ENSANGP00000022244 [Apis... 107 4e-22
gi|21674797|ref|NP_662862.1| WD-repeat family protein [Chlorobiu... 107 6e-22
gi|46120249|ref|ZP_00179648.2| COG2319: FOG: WD40 repeat [Crocos... 107 6e-22
gi|48895671|ref|ZP_00328655.1| COG0515: Serine/threonine protein... 107 6e-22
gi|7479150|pir||T42045 beta transducin-like protein homolog - St... 107 6e-22
gi|13938537|gb|AAH07417.1| DKFZP434C245 protein [Homo sapiens] 107 6e-22
gi|14150114|ref|NP_115708.1| hypothetical protein MGC4238 [Homo ... 107 6e-22
gi|21222277|ref|NP_628056.1| putative WD-40 repeat protein [Stre... 107 6e-22
gi|23130358|ref|ZP_00112175.1| COG2319: FOG: WD40 repeat [Nostoc... 106 7e-22
gi|39581518|emb|CAE64254.1| Hypothetical protein CBG08899 [Caeno... 106 7e-22
gi|33417154|gb|AAH56099.1| MGC69111 protein [Xenopus laevis] 106 7e-22
gi|26327737|dbj|BAC27612.1| unnamed protein product [Mus musculus] 106 9e-22
gi|48894319|ref|ZP_00327428.1| COG2319: FOG: WD40 repeat [Tricho... 106 9e-22
gi|31377770|ref|NP_056241.2| DKFZP434C245 protein [Homo sapiens]... 106 9e-22
gi|49098124|ref|XP_410522.1| hypothetical protein AN6385.2 [Aspe... 106 9e-22
gi|12838548|dbj|BAB24241.1| unnamed protein product [Mus musculu... 106 9e-22
gi|34855547|ref|XP_345196.1| similar to nuclear receptor co-repr... 105 1e-21
gi|50551767|ref|XP_503358.1| hypothetical protein [Yarrowia lipo... 105 1e-21
gi|47226994|emb|CAG05886.1| unnamed protein product [Tetraodon n... 105 1e-21
gi|23593529|ref|XP_135092.2| RIKEN cDNA 2510040D07 [Mus musculus] 105 1e-21
gi|50548017|ref|XP_501478.1| hypothetical protein [Yarrowia lipo... 105 1e-21
gi|18044039|gb|AAH19369.1| RIKEN cDNA 1500041N16 [Mus musculus] 105 1e-21
gi|31543001|ref|NP_109657.2| IRA1 protein [Mus musculus] >gnl|BL... 105 1e-21
gi|26665869|ref|NP_758440.1| TUWD12 [Homo sapiens] >gnl|BL_ORD_I... 105 2e-21
gi|12846941|dbj|BAB27371.1| unnamed protein product [Mus musculus] 105 2e-21
gi|18859793|ref|NP_572778.1| CG1796-PA [Drosophila melanogaster]... 105 2e-21
gi|45508715|ref|ZP_00161052.1| COG2319: FOG: WD40 repeat [Anabae... 105 2e-21
gi|23127725|ref|ZP_00109588.1| COG2319: FOG: WD40 repeat [Nostoc... 104 3e-21
gi|39545918|gb|AAR28022.1| TAF5 [Arabidopsis thaliana] 104 3e-21
gi|49076806|ref|XP_402338.1| hypothetical protein UM04723.1 [Ust... 104 3e-21
gi|13385884|ref|NP_080675.1| RIKEN cDNA 1500041N16 [Mus musculus... 104 3e-21
gi|26331128|dbj|BAC29294.1| unnamed protein product [Mus musculus] 104 3e-21
gi|12006108|gb|AAG44738.1| IRA1 [Mus musculus] 104 3e-21
gi|45526977|ref|ZP_00178178.1| COG2319: FOG: WD40 repeat [Crocos... 104 4e-21
gi|47224493|emb|CAG08743.1| unnamed protein product [Tetraodon n... 104 4e-21
gi|48100231|ref|XP_392611.1| similar to TUWD12 [Apis mellifera] 104 4e-21
gi|50797401|ref|XP_423947.1| PREDICTED: similar to nuclear recep... 103 5e-21
gi|17137500|ref|NP_477329.1| CG4063-PA [Drosophila melanogaster]... 103 5e-21
gi|22028422|gb|AAH34901.1| 2510040D07Rik protein [Mus musculus] 103 5e-21
gi|15150805|ref|NP_150600.1| transducin beta-like 1Y; transducin... 103 5e-21
gi|10434648|dbj|BAB14331.1| unnamed protein product [Homo sapiens] 103 5e-21
gi|19913371|ref|NP_078941.2| nuclear receptor co-repressor/HDAC3... 103 5e-21
gi|50728412|ref|XP_416132.1| PREDICTED: similar to TUWD12 [Gallu... 103 6e-21
gi|48892224|ref|ZP_00325622.1| COG2319: FOG: WD40 repeat [Tricho... 103 6e-21
gi|50421955|ref|XP_459538.1| unnamed protein product [Debaryomyc... 103 6e-21
gi|3406654|gb|AAC29438.1| transcriptional repressor TUP1 [Dictyo... 103 6e-21
gi|9931971|gb|AAB81475.2| general transcriptional repressor Tup1... 103 8e-21
gi|5032159|ref|NP_005638.1| transducin beta-like 1X; transducin ... 103 8e-21
gi|23129787|ref|ZP_00111610.1| COG2319: FOG: WD40 repeat [Nostoc... 103 8e-21
gi|23503100|sp|O60907|TBLX_HUMAN F-box-like/WD-repeat protein TB... 103 8e-21
gi|19113822|ref|NP_592910.1| general transcriptional repressor t... 103 8e-21
gi|37521199|ref|NP_924576.1| WD-40 repeat protein [Gloeobacter v... 103 8e-21
gi|31207523|ref|XP_312728.1| ENSANGP00000025070 [Anopheles gambi... 103 8e-21
gi|49119215|gb|AAH73215.1| Unknown (protein for MGC:80502) [Xeno... 103 8e-21
gi|31207525|ref|XP_312729.1| ENSANGP00000019694 [Anopheles gambi... 103 8e-21
gi|31322517|gb|AAP20646.1| nuclear receptor co-repressor complex... 103 8e-21
gi|12006104|gb|AAG44736.1| IRA1 [Homo sapiens] 103 8e-21
gi|50543284|ref|XP_499808.1| hypothetical protein [Yarrowia lipo... 103 8e-21
gi|41152229|ref|NP_958502.1| platelet-activating factor acetylhy... 102 1e-20
gi|47215488|emb|CAG01596.1| unnamed protein product [Tetraodon n... 102 1e-20
gi|30689741|ref|NP_197897.2| transducin family protein / WD-40 r... 102 1e-20
gi|50731422|ref|XP_417265.1| PREDICTED: similar to F-box-WD40 re... 102 1e-20
gi|3983137|gb|AAC83821.1| Lis1 homolog [Drosophila melanogaster] 102 1e-20
gi|17137196|ref|NP_477160.1| CG8440-PA [Drosophila melanogaster]... 102 1e-20
gi|19075884|ref|NP_588384.1| notchless-like; WD repeat protein [... 102 1e-20
gi|49088728|ref|XP_406158.1| hypothetical protein AN2021.2 [Aspe... 102 2e-20
gi|24654584|ref|NP_611261.1| CG10931-PA [Drosophila melanogaster... 102 2e-20
gi|10383804|ref|NP_009997.2| Protein required for cell viability... 101 2e-20
gi|39596796|emb|CAE59023.1| Hypothetical protein CBG02300 [Caeno... 101 2e-20
gi|38505813|ref|NP_942432.1| WD-repeat protein [Synechocystis sp... 101 2e-20
gi|83249|pir||S19487 hypothetical protein YCR072c - yeast (Sacch... 101 3e-20
gi|31213407|ref|XP_315647.1| ENSANGP00000022537 [Anopheles gambi... 101 3e-20
gi|30681779|ref|NP_172528.2| transducin family protein / WD-40 r... 101 3e-20
gi|71878|pir||RGFFB GTP-binding regulatory protein beta chain - ... 101 3e-20
gi|25402606|pir||C86239 protein T10O24.21 [imported] - Arabidops... 101 3e-20
gi|31213405|ref|XP_315646.1| ENSANGP00000021697 [Anopheles gambi... 101 3e-20
gi|32408987|ref|XP_324974.1| hypothetical protein [Neurospora cr... 101 3e-20
gi|47214090|emb|CAF95347.1| unnamed protein product [Tetraodon n... 101 3e-20
gi|47679343|gb|AAT36652.1| Tup1p [Exophiala dermatitidis] 100 4e-20
gi|34851989|ref|XP_226577.2| similar to RIKEN cDNA 1110005N04 [R... 100 4e-20
gi|49522519|gb|AAH75582.1| Unknown (protein for MGC:89568) [Xeno... 100 4e-20
gi|50414726|gb|AAH77273.1| Unknown (protein for IMAGE:4031030) [... 100 4e-20
gi|4127781|emb|CAA10070.1| Notchless protein [Drosophila melanog... 100 4e-20
gi|24640523|ref|NP_572452.1| CG10763-PA [Drosophila melanogaster... 100 4e-20
gi|38455441|gb|AAR20840.1| antigenic WD protein [Leishmania amaz... 100 4e-20
gi|45549090|ref|NP_477294.2| CG2863-PA [Drosophila melanogaster]... 100 4e-20
gi|19527184|ref|NP_598727.1| TAF5-like RNA polymerase II, p300/C... 100 4e-20
gi|11875643|gb|AAG40737.1| Bap1 [Myxococcus xanthus] 100 4e-20
gi|17229844|ref|NP_486392.1| WD-40 repeat protein [Nostoc sp. PC... 100 4e-20
gi|28828113|gb|AAO50796.1| similar to Anabaena sp. (strain PCC 7... 100 5e-20
gi|17488592|gb|AAL40359.1| unknown protein [Takifugu rubripes] 100 5e-20
gi|49079792|ref|XP_403502.1| hypothetical protein UM05887.1 [Ust... 100 5e-20
gi|15218190|ref|NP_172998.1| transducin family protein / WD-40 r... 100 7e-20
gi|47211691|emb|CAF91816.1| unnamed protein product [Tetraodon n... 100 7e-20
gi|17228167|ref|NP_484715.1| WD-repeat protein [Nostoc sp. PCC 7... 100 7e-20
gi|47551119|ref|NP_999734.1| katanin p80 subunit [Strongylocentr... 100 7e-20
gi|5103844|gb|AAD39674.1| Strong similarity to gb|X95263 Periodi... 100 7e-20
gi|32264056|gb|AAO45688.1| activated protein kinase C receptor [... 100 7e-20
gi|42571491|ref|NP_973836.1| transducin family protein / WD-40 r... 100 7e-20
gi|39586585|emb|CAE73712.1| Hypothetical protein CBG21225 [Caeno... 100 7e-20
gi|31240155|ref|XP_320491.1| ENSANGP00000008643 [Anopheles gambi... 100 7e-20
gi|32411159|ref|XP_326060.1| hypothetical protein [Neurospora cr... 100 7e-20
gi|2494901|sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 ... 100 7e-20
gi|47059149|ref|NP_082016.1| similar to TUWD12 [Mus musculus] >g... 100 7e-20
gi|34534989|dbj|BAC87175.1| unnamed protein product [Homo sapiens] 100 9e-20
gi|8922428|ref|NP_060566.1| Notchless gene homolog; similar to b... 100 9e-20
gi|21703860|ref|NP_663406.1| Notchless gene homolog; Notchless g... 100 9e-20
gi|34872912|ref|XP_220770.2| similar to Notchless gene homolog; ... 100 9e-20
gi|18415801|ref|NP_568194.1| transducin family protein / WD-40 r... 100 9e-20
gi|23612749|ref|NP_704288.1| guanine nucleotide-binding protein,... 100 9e-20
gi|12856025|dbj|BAB30542.1| unnamed protein product [Mus musculu... 100 9e-20
gi|157529|gb|AAA73103.1| [Drosophila melanogaster guanine nucleo... 100 9e-20
gi|24666913|ref|NP_523720.2| CG8770-PA [Drosophila melanogaster]... 100 9e-20
gi|33877287|gb|AAH02884.2| FLJ10458 protein [Homo sapiens] 100 9e-20
gi|50556994|ref|XP_505905.1| hypothetical protein [Yarrowia lipo... 100 9e-20
gi|45360769|ref|NP_989058.1| hypothetical protein MGC75813 [Xeno... 100 9e-20
gi|10178281|emb|CAC08339.1| katanin p80 subunit-like protein [Ar... 100 9e-20
gi|7512942|pir||T17256 hypothetical protein DKFZp586O1922.1 - hu... 99 1e-19
gi|34880600|ref|XP_346308.1| similar to RIKEN cDNA 1110005N04 [R... 99 1e-19
gi|46134331|ref|ZP_00157731.2| COG2319: FOG: WD40 repeat [Anabae... 99 2e-19
gi|3646272|emb|CAA08816.1| putative transcription factor [Homo s... 99 2e-19
gi|50758306|ref|XP_415857.1| PREDICTED: similar to Nle-pending-p... 99 2e-19
gi|48895476|ref|ZP_00328460.1| COG2319: FOG: WD40 repeat [Tricho... 99 2e-19
gi|18139935|gb|AAL60198.1| WD40-repeat-containing protein [Chlam... 99 2e-19
gi|17533647|ref|NP_494926.1| g-protein beta WD-40 repeat (2F320)... 99 2e-19
gi|7657439|ref|NP_055224.1| PCAF associated factor 65 beta; TAF5... 99 2e-19
gi|23126356|ref|ZP_00108255.1| COG2319: FOG: WD40 repeat [Nostoc... 99 2e-19
gi|50741419|ref|XP_419579.1| PREDICTED: similar to TAF5-like RNA... 99 2e-19
gi|15240637|ref|NP_199834.1| transducin family protein / WD-40 r... 99 2e-19
gi|46438963|gb|EAK98286.1| hypothetical protein CaO19.11259 [Can... 99 2e-19
gi|19112396|ref|NP_595604.1| WD repeat protein; prl1/prl2 phosph... 99 2e-19
gi|24210418|emb|CAD54457.1| LIS1 protein [Dictyostelium discoide... 99 2e-19
gi|14042835|dbj|BAB55412.1| unnamed protein product [Homo sapiens] 99 2e-19
gi|21355245|ref|NP_648990.1| CG6322-PA [Drosophila melanogaster]... 99 2e-19
gi|49086626|ref|XP_405345.1| hypothetical protein AN1208.2 [Aspe... 99 2e-19
gi|38099099|gb|EAA46486.1| hypothetical protein MG08829.4 [Magna... 99 2e-19
gi|37530382|ref|NP_919493.1| putative notchless protein homolog ... 99 2e-19
gi|40823395|gb|AAR92280.1| At5g50230 [Arabidopsis thaliana] 99 2e-19
gi|3687833|gb|AAC62236.1| notchless [Xenopus laevis] 99 2e-19
gi|27882062|gb|AAH44710.1| Nle-pending-prov protein [Xenopus lae... 99 2e-19
gi|20091353|ref|NP_617428.1| WD40-repeat containing protein [Met... 98 3e-19
gi|18401203|ref|NP_566557.1| PP1/PP2A phosphatases pleiotropic r... 98 3e-19
gi|19068020|gb|AAL11438.1| G-protein beta subunit 1 [Phytophthor... 98 3e-19
gi|41281679|ref|NP_619733.1| guanine nucleotide-binding protein,... 98 3e-19
gi|1076382|pir||S49821 PRL2 protein - Arabidopsis thaliana (frag... 98 3e-19
gi|47227921|emb|CAF97550.1| unnamed protein product [Tetraodon n... 98 3e-19
gi|15809828|gb|AAL06842.1| AT3g16650/MGL6_10 [Arabidopsis thaliana] 98 3e-19
gi|32406548|ref|XP_323887.1| hypothetical protein [Neurospora cr... 98 3e-19
gi|13174235|gb|AAK14409.1| putative angio-associated migratory c... 98 3e-19
gi|6754018|ref|NP_034443.1| guanine nucleotide-binding protein, ... 98 3e-19
gi|11994619|dbj|BAB02756.1| PP1/PP2A phosphatases pleiotropic re... 98 3e-19
gi|20302751|gb|AAM18877.1| unknown [Branchiostoma floridae] 98 3e-19
gi|17737533|ref|NP_523922.1| CG15010-PC [Drosophila melanogaster... 98 3e-19
gi|23123730|ref|ZP_00105782.1| COG2319: FOG: WD40 repeat [Nostoc... 98 3e-19
gi|45525517|ref|ZP_00176748.1| COG2319: FOG: WD40 repeat [Crocos... 98 3e-19
gi|5729852|ref|NP_006569.1| guanine nucleotide-binding protein, ... 98 3e-19
gi|28628611|gb|AAO49276.1| G protein beta subunit 5 short varian... 98 3e-19
gi|20336270|ref|NP_057278.2| guanine nucleotide-binding protein,... 98 3e-19
gi|2494899|sp|P56093|TUP1_CANAL Transcriptional repressor TUP1 >... 98 3e-19
gi|45190361|ref|NP_984615.1| AEL246Cp [Eremothecium gossypii] >g... 97 4e-19
gi|48097292|ref|XP_391870.1| similar to ENSANGP00000017965 [Apis... 97 4e-19
gi|38683868|ref|NP_060444.2| APG16 autophagy 16-like isoform 2; ... 97 4e-19
gi|46812257|gb|AAT02217.1| guanine nucleotide binding protein be... 97 4e-19
gi|31742530|ref|NP_110430.4| APG16 autophagy 16-like isoform 1; ... 97 4e-19
gi|45198717|ref|NP_985746.1| AFR199Cp [Eremothecium gossypii] >g... 97 4e-19
gi|48891514|ref|ZP_00325021.1| COG2319: FOG: WD40 repeat [Tricho... 97 4e-19
gi|48735323|gb|AAH71846.1| APG16L protein [Homo sapiens] 97 4e-19
gi|627169|pir||S33263 transcription initiation factor IID-associ... 97 4e-19
gi|17136870|ref|NP_476957.1| CG7704-PA [Drosophila melanogaster]... 97 4e-19
gi|49093204|ref|XP_408063.1| hypothetical protein AN3926.2 [Aspe... 97 4e-19
gi|14599401|emb|CAC43453.1| probable nuclear migration protein [... 97 4e-19
gi|47216991|emb|CAG04933.1| unnamed protein product [Tetraodon n... 97 6e-19
gi|50080321|gb|AAT69655.1| 'unknown protein, WD domain, G-beta r... 97 6e-19
gi|49076880|ref|XP_402367.1| hypothetical protein UM04752.1 [Ust... 97 6e-19
gi|15237273|ref|NP_200094.1| WD-40 repeat family protein / notch... 97 6e-19
gi|46438885|gb|EAK98209.1| hypothetical protein CaO19.3778 [Cand... 97 6e-19
gi|50256823|gb|EAL19541.1| hypothetical protein CNBG1700 [Crypto... 97 6e-19
gi|11066216|gb|AAG28504.1| TUPA [Emericella nidulans] 97 6e-19
gi|6624971|emb|CAB61534.1| transducin beta like 1 [Mus musculus] 97 6e-19
gi|50752931|ref|XP_413801.1| PREDICTED: similar to guanine nucle... 97 6e-19
gi|49098364|ref|XP_410642.1| hypothetical protein AN6505.2 [Aspe... 97 6e-19
gi|47085751|ref|NP_998183.1| zgc:56071 [Danio rerio] >gnl|BL_ORD... 97 6e-19
gi|28849825|gb|AAO46882.1| heterotrimeric guanine nucleotide-bin... 97 6e-19
gi|31198029|ref|XP_307962.1| ENSANGP00000013415 [Anopheles gambi... 97 6e-19
gi|47224591|emb|CAG03575.1| unnamed protein product [Tetraodon n... 97 6e-19
gi|50311047|ref|XP_455547.1| TUP1_KLULA [Kluyveromyces lactis] >... 97 7e-19
gi|2494900|sp|P56094|TUP1_KLULA Transcriptional repressor TUP1 >... 97 7e-19
gi|48099312|ref|XP_394888.1| similar to Hypothetical protein MGC... 97 7e-19
gi|38111610|gb|EAA57164.1| hypothetical protein MG08133.4 [Magna... 96 1e-18
gi|47271481|ref|NP_775750.2| hypothetical protein LOC126248 [Hom... 96 1e-18
gi|39593406|emb|CAE64876.1| Hypothetical protein CBG09688 [Caeno... 96 1e-18
gi|19352022|dbj|BAB85908.1| guaninenucleotide-binding protein be... 96 1e-18
gi|71874|pir||RGMSB4 GTP-binding regulatory protein beta-4 chain... 96 1e-18
gi|26354532|dbj|BAC40894.1| unnamed protein product [Mus musculus] 96 1e-18
gi|46108910|ref|XP_381513.1| hypothetical protein FG01337.1 [Gib... 96 1e-18
gi|19112881|ref|NP_596089.1| pre-mrna splicing factor, WD repeat... 96 1e-18
gi|50419087|ref|XP_458066.1| unnamed protein product [Debaryomyc... 96 1e-18
gi|41054303|ref|NP_956049.1| Unknown (protein for MGC:65943); mg... 96 1e-18
gi|14029844|gb|AAK52836.1| G-protein beta 5 [Ambystoma tigrinum] 96 1e-18
gi|23129645|ref|ZP_00111471.1| COG2319: FOG: WD40 repeat [Nostoc... 96 1e-18
gi|11055998|ref|NP_067642.1| guanine nucleotide-binding protein,... 96 1e-18
gi|21411480|gb|AAH31227.1| LOC126248 protein [Homo sapiens] 96 1e-18
gi|47498030|ref|NP_998874.1| hypothetical protein MGC69344 [Xeno... 96 1e-18
gi|27694663|gb|AAH43772.1| Katnb1-prov protein [Xenopus laevis] 96 1e-18
gi|41054115|ref|NP_956146.1| Unknown (protein for MGC:63765); wu... 96 1e-18
gi|7507018|pir||T24399 hypothetical protein T03F6.5 - Caenorhabd... 96 1e-18
gi|34854574|ref|XP_218024.2| similar to RIKEN cDNA 1110005N04 [R... 96 1e-18
gi|12845754|dbj|BAB26884.1| unnamed protein product [Mus musculus] 96 2e-18
gi|45190866|ref|NP_985120.1| AER263Cp [Eremothecium gossypii] >g... 96 2e-18
gi|47209012|emb|CAF91370.1| unnamed protein product [Tetraodon n... 96 2e-18
gi|25402650|pir||E86245 hypothetical protein [imported] - Arabid... 96 2e-18
gi|50416375|gb|AAH77313.1| Unknown (protein for MGC:80243) [Xeno... 96 2e-18
gi|33585633|gb|AAH56002.1| Gnb3-prov protein [Xenopus laevis] 96 2e-18
gi|31542899|ref|NP_038559.2| guanine nucleotide-binding protein,... 96 2e-18
gi|20257506|gb|AAM15922.1| guanine nucleotide binding protein be... 96 2e-18
gi|16331137|ref|NP_441865.1| beta transducin-like protein [Synec... 96 2e-18
gi|30584393|gb|AAP36445.1| Homo sapiens katanin p80 (WD40-contai... 96 2e-18
gi|26329699|dbj|BAC28588.1| unnamed protein product [Mus musculu... 96 2e-18
gi|26327487|dbj|BAC27487.1| unnamed protein product [Mus musculus] 96 2e-18
gi|12655011|gb|AAH01353.1| Katanin p80 subunit B 1 [Homo sapiens... 96 2e-18
gi|29465691|gb|AAL99251.1| TupA protein [Penicillium marneffei] 96 2e-18
gi|7160787|emb|CAB76452.1| guanine nucleotide-binding protein be... 96 2e-18
gi|31240845|ref|XP_320836.1| ENSANGP00000017965 [Anopheles gambi... 96 2e-18
gi|34863779|ref|XP_219965.2| similar to RIKEN cDNA 6330528C20 ge... 95 2e-18
gi|30354079|gb|AAH52268.1| TAF5 protein [Homo sapiens] 95 2e-18
gi|1491718|emb|CAA64777.1| hTAFII100 [Homo sapiens] 95 2e-18
gi|38344202|emb|CAE05767.2| OSJNBa0064G10.18 [Oryza sativa (japo... 95 2e-18
gi|28893469|ref|NP_796316.1| TAF5 RNA polymerase II, TATA box bi... 95 2e-18
gi|1732075|gb|AAC50902.1| TBP-associated factor [Homo sapiens] 95 2e-18
gi|47117222|sp|Q8C092|TAF5_MOUSE Transcription initiation factor... 95 2e-18
gi|45359810|gb|AAS59142.1| G-protein beta 4 subunit [Rattus norv... 95 2e-18
gi|50545651|ref|XP_500364.1| hypothetical protein [Yarrowia lipo... 95 2e-18
gi|21071067|ref|NP_008882.2| TBP-associated factor 5; TATA box b... 95 2e-18
gi|48139204|ref|XP_393446.1| similar to ENSANGP00000015224 [Apis... 95 2e-18
gi|6686341|sp|Q15542|TAF5_HUMAN Transcription initiation factor ... 95 2e-18
gi|27777650|ref|NP_084122.2| APG16L beta isoform; autophagy 16-l... 95 3e-18
gi|27552519|dbj|BAC55091.1| Apg16L beta [Mus musculus] 95 3e-18
gi|47221781|emb|CAG08835.1| unnamed protein product [Tetraodon n... 95 3e-18
gi|46109034|ref|XP_381575.1| hypothetical protein FG01399.1 [Gib... 95 3e-18
gi|48838134|ref|ZP_00295082.1| COG2319: FOG: WD40 repeat [Methan... 95 3e-18
gi|4505895|ref|NP_002660.1| pleiotropic regulator 1 (PRL1homolog... 95 3e-18
gi|18088489|gb|AAH20786.1| PLRG1 protein [Homo sapiens] 95 3e-18
gi|45508210|ref|ZP_00160550.1| COG2319: FOG: WD40 repeat [Anabae... 95 3e-18
gi|17232369|ref|NP_488917.1| WD-repeat protein [Nostoc sp. PCC 7... 95 3e-18
gi|29144977|gb|AAH49122.1| Apg16l protein [Mus musculus] 95 3e-18
gi|27552521|dbj|BAC55092.1| Apg16L gamma [Mus musculus] 95 3e-18
gi|46439108|gb|EAK98430.1| hypothetical protein CaO19.536 [Candi... 95 3e-18
gi|27552517|dbj|BAC55090.1| Apg16L alpha [Mus musculus] 95 3e-18
gi|49098072|ref|XP_410496.1| SCOB_EMENI Sulfur metabolite repres... 94 4e-18
gi|3122851|sp|Q00659|SCOB_EMENI Sulfur metabolite repression con... 94 4e-18
gi|37362268|gb|AAQ91262.1| pleiotropic regulator 1 [Danio rerio] 94 4e-18
gi|30688991|ref|NP_197734.2| transducin family protein / WD-40 r... 94 4e-18
gi|50289957|ref|XP_447410.1| unnamed protein product [Candida gl... 94 4e-18
gi|50726890|ref|NP_998367.1| similar to GNB3 protein [Danio reri... 94 4e-18
gi|30688988|ref|NP_851064.1| transducin family protein / WD-40 r... 94 4e-18
gi|39590492|emb|CAE66232.1| Hypothetical protein CBG11475 [Caeno... 94 4e-18
gi|41152187|ref|NP_957040.1| hypothetical protein MGC73196 [Dani... 94 4e-18
gi|50305243|ref|XP_452581.1| unnamed protein product [Kluyveromy... 94 4e-18
gi|339937|gb|AAA63265.1| transducin beta-1 subunit 94 5e-18
gi|3387984|gb|AAC28655.1| beta-subunit signal transducing protei... 94 5e-18
gi|6680045|ref|NP_032168.1| guanine nucleotide-binding protein, ... 94 5e-18
gi|4139469|pdb|1A0R|B Chain B, Heterotrimeric Complex Of Phosduc... 94 5e-18
gi|28461181|ref|NP_786971.1| guanine nucleotide binding protein ... 94 5e-18
gi|50582979|ref|NP_998605.1| pleiotropic regulator 1 [Danio reri... 94 5e-18
gi|15451392|dbj|BAB64500.1| hypothetical protein [Macaca fascicu... 94 5e-18
gi|15451370|dbj|BAB64489.1| hypothetical protein [Macaca fascicu... 94 5e-18
gi|50757510|ref|XP_415544.1| PREDICTED: similar to U4/U6 small n... 94 5e-18
gi|31242369|ref|XP_321615.1| ENSANGP00000011640 [Anopheles gambi... 94 5e-18
gi|11120706|ref|NP_068525.1| pleiotropic regulator 1 [Rattus nor... 94 5e-18
gi|30185730|gb|AAH51639.1| Prpf4 protein [Mus musculus] 94 6e-18
gi|50752442|ref|XP_422782.1| PREDICTED: similar to guanine nucle... 94 6e-18
gi|49257618|gb|AAH74250.1| Unknown (protein for MGC:84000) [Xeno... 94 6e-18
gi|11127727|gb|AAG31060.1| G-protein B1 subunit [Ambystoma tigri... 94 6e-18
gi|3023838|sp|P79959|GBB1_XENLA Guanine nucleotide-binding prote... 94 6e-18
gi|1730213|sp|P54311|GBB1_RAT Guanine nucleotide-binding protein... 94 6e-18
gi|13591874|ref|NP_112249.1| guanine nucleotide-binding protein,... 94 6e-18
gi|49899896|gb|AAH76910.1| Unknown (protein for MGC:89081) [Xeno... 94 6e-18
gi|19075402|ref|NP_587902.1| tfiid subunit taf72p. [Schizosaccha... 94 6e-18
gi|26354947|dbj|BAC41100.1| unnamed protein product [Mus musculus] 94 6e-18
gi|20832158|ref|XP_131444.1| PRP4 pre-mRNA processing factor 4 h... 94 6e-18
gi|7504252|pir||T22703 hypothetical protein F55B12.3 - Caenorhab... 93 8e-18
gi|21356791|ref|NP_650766.1| CG5451-PA [Drosophila melanogaster]... 93 8e-18
gi|14530480|emb|CAC42307.1| C. elegans SEL-10 protein (correspon... 93 8e-18
gi|13472512|ref|NP_104079.1| WD-repeart protein, beta transducin... 93 8e-18
gi|4502123|ref|NP_001151.1| apoptotic protease activating factor... 93 8e-18
gi|45508332|ref|ZP_00160671.1| COG2319: FOG: WD40 repeat [Anabae... 93 8e-18
gi|17563260|ref|NP_506421.1| Suppressor/Enhancer of Lin-12 SEL-1... 93 8e-18
gi|5869876|emb|CAB55582.1| apoptotic protease activating factor ... 93 8e-18
gi|32483361|ref|NP_863658.1| apoptotic protease activating facto... 93 8e-18
gi|5869872|emb|CAB55580.1| apoptotic protease activating factor ... 93 8e-18
gi|50746132|ref|XP_420368.1| PREDICTED: similar to Pleiotropic r... 93 8e-18
gi|15240036|ref|NP_199205.1| transducin family protein / WD-40 r... 93 8e-18
gi|36958731|gb|AAQ87199.1| Vegetatible incompatibility protein H... 93 8e-18
gi|47216288|emb|CAF96584.1| unnamed protein product [Tetraodon n... 93 8e-18
gi|50309993|ref|XP_455010.1| unnamed protein product [Kluyveromy... 93 8e-18
gi|34868449|ref|XP_233022.2| similar to U4/U6 small nuclear ribo... 93 1e-17
gi|31237851|ref|XP_319677.1| ENSANGP00000021381 [Anopheles gambi... 93 1e-17
gi|50552157|ref|XP_503553.1| hypothetical protein [Yarrowia lipo... 93 1e-17
gi|32419421|ref|XP_330154.1| hypothetical protein ( probable ple... 93 1e-17
gi|50309791|ref|XP_454908.1| unnamed protein product [Kluyveromy... 93 1e-17
gi|34853578|ref|XP_213170.2| similar to guanine nucleotide-bindi... 93 1e-17
gi|3122317|sp|P90648|KMHB_DICDI Myosin heavy chain kinase B (MHC... 93 1e-17
gi|33416638|gb|AAH55978.1| Loc60449-prov protein [Xenopus laevis] 93 1e-17
gi|37577053|gb|AAQ94086.1| guanine nucleotide binding protein be... 93 1e-17
>gi|17551498|ref|NP_509886.1| u5 snRNP-specific protein (XL916)
[Caenorhabditis elegans]
gi|7498658|pir||T20593 hypothetical protein F08G12.2 -
Caenorhabditis elegans
gi|3875654|emb|CAA91460.1| Hypothetical protein F08G12.2
[Caenorhabditis elegans]
Length = 331
Score = 687 bits (1772), Expect = 0.0
Identities = 331/331 (100%), Positives = 331/331 (100%)
Frame = -1
Query: 996 MALVTSSGQQLVSSGFPQQTAQRFSNLMAPTMVLLGHEGEIYTGAFSPDGTCLATSGYDQ 817
MALVTSSGQQLVSSGFPQQTAQRFSNLMAPTMVLLGHEGEIYTGAFSPDGTCLATSGYDQ
Sbjct: 1 MALVTSSGQQLVSSGFPQQTAQRFSNLMAPTMVLLGHEGEIYTGAFSPDGTCLATSGYDQ 60
Query: 816 KIFFWNVYGECENFSTIKGHSGAVMDLKFTTDSSSLVSCGTDKSVRVWDMETGTCARRFR 637
KIFFWNVYGECENFSTIKGHSGAVMDLKFTTDSSSLVSCGTDKSVRVWDMETGTCARRFR
Sbjct: 61 KIFFWNVYGECENFSTIKGHSGAVMDLKFTTDSSSLVSCGTDKSVRVWDMETGTCARRFR 120
Query: 636 THTDFVNAVHPSRRGVTLVASASDDGTCRVHDMRTKEPVKTYTNRYQQTAVTFNDSSDQV 457
THTDFVNAVHPSRRGVTLVASASDDGTCRVHDMRTKEPVKTYTNRYQQTAVTFNDSSDQV
Sbjct: 121 THTDFVNAVHPSRRGVTLVASASDDGTCRVHDMRTKEPVKTYTNRYQQTAVTFNDSSDQV 180
Query: 456 ISGGIDNVLKVWDMRRDEITYTLTGHRDTITGISLSPSGKFIISNSMDCTVRQWDIRPFV 277
ISGGIDNVLKVWDMRRDEITYTLTGHRDTITGISLSPSGKFIISNSMDCTVRQWDIRPFV
Sbjct: 181 ISGGIDNVLKVWDMRRDEITYTLTGHRDTITGISLSPSGKFIISNSMDCTVRQWDIRPFV 240
Query: 276 PGQRSVGVFAGHNHNFEKNLLKCSWSPCERFITAGSSDRFLYVWETLSKKIVYKLPGHMG 97
PGQRSVGVFAGHNHNFEKNLLKCSWSPCERFITAGSSDRFLYVWETLSKKIVYKLPGHMG
Sbjct: 241 PGQRSVGVFAGHNHNFEKNLLKCSWSPCERFITAGSSDRFLYVWETLSKKIVYKLPGHMG 300
Query: 96 SVNCTDFHPKEPIMLSCGSDKRVFLGEIDMS 4
SVNCTDFHPKEPIMLSCGSDKRVFLGEIDMS
Sbjct: 301 SVNCTDFHPKEPIMLSCGSDKRVFLGEIDMS 331