Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F08G5_5
         (900 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ...   217   3e-55
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno...   206   4e-52
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno...   100   6e-20
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno...    98   2e-19
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno...    96   1e-18
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ...    96   1e-18
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ...    94   3e-18
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ...    93   7e-18
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ...    93   7e-18
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno...    84   6e-15
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno...    83   7e-15
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ...    83   1e-14
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno...    83   1e-14
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ...    83   1e-14
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno...    82   1e-14
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ...    82   2e-14
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno...    81   4e-14
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ...    81   4e-14
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ...    80   6e-14
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno...    76   1e-12
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno...    75   2e-12
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ...    75   3e-12
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno...    74   4e-12
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [...    69   1e-10
gi|687634|gb|AAA62504.1| collagen                                      67   5e-10
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [...    67   7e-10
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [...    64   6e-09
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno...    63   8e-09
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans]             62   2e-08
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [...    60   5e-08
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ...    60   7e-08
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C...    60   7e-08
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno...    59   1e-07
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [...    59   1e-07
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ...    58   3e-07
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ...    58   3e-07
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-...    57   4e-07
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno...    57   7e-07
gi|39590997|emb|CAE58777.1| Hypothetical protein CBG01972 [Caeno...    56   1e-06
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno...    56   1e-06
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno...    56   1e-06
gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [...    55   2e-06
gi|17570601|ref|NP_509692.1| COLlagen structural gene (28.7 kD) ...    55   2e-06
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ...    55   2e-06
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno...    55   2e-06
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno...    54   4e-06
gi|39593742|emb|CAE62035.1| Hypothetical protein CBG06051 [Caeno...    54   6e-06
gi|17540620|ref|NP_502115.1| COLlagen structural gene (col-126) ...    54   6e-06
gi|17540622|ref|NP_502116.1| predicted CDS, COLlagen structural ...    54   6e-06
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno...    53   8e-06
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno...    53   8e-06
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [...    53   8e-06
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno...    53   1e-05
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno...    53   1e-05
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno...    53   1e-05
gi|39594543|emb|CAE72121.1| Hypothetical protein CBG19217 [Caeno...    52   1e-05
gi|17557278|ref|NP_505375.1| COLlagen structural gene (28.8 kD) ...    52   1e-05
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ...    52   2e-05
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ...    51   3e-05
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]...    51   3e-05
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ...    51   3e-05
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ...    51   4e-05
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder...    51   4e-05
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ...    51   4e-05
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno...    50   5e-05
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ...    50   7e-05
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno...    50   9e-05
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel...    49   1e-04
gi|39593313|emb|CAE64783.1| Hypothetical protein CBG09576 [Caeno...    49   1e-04
gi|39593314|emb|CAE64784.1| Hypothetical protein CBG09577 [Caeno...    49   1e-04
gi|25385147|pir||A88640 protein C34H4.4 [imported] - Caenorhabdi...    49   1e-04
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno...    49   2e-04
gi|17507511|ref|NP_492619.1| COLlagen structural gene (col-64) [...    49   2e-04
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno...    49   2e-04
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [...    49   2e-04
gi|17557220|ref|NP_505647.1| COLlagen structural gene (col-150) ...    48   3e-04
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8]                  48   3e-04
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ...    48   3e-04
gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD) ...    48   3e-04
gi|17557218|ref|NP_505646.1| COLlagen structural gene (30.6 kD) ...    48   3e-04
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p...    47   4e-04
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [...    47   6e-04
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ...    47   6e-04
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno...    47   8e-04
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre...    46   0.001
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno...    45   0.002
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8]                 45   0.002
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc...    45   0.002
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col...    45   0.002
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ...    45   0.002
gi|39595235|emb|CAE60272.1| Hypothetical protein CBG03851 [Caeno...    45   0.002
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi...    44   0.004
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >...    44   0.005
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm...    44   0.005
gi|39596219|emb|CAE69856.1| Hypothetical protein CBG16184 [Caeno...    44   0.005
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ...    44   0.005
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno...    44   0.006
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami...    43   0.011
gi|17506643|ref|NP_492948.1| predicted CDS, COLlagen structural ...    43   0.011
gi|17531393|ref|NP_496311.1| nematode cuticle collagen, BLIstere...    43   0.011
gi|37619788|emb|CAA86755.2| Hypothetical protein C09G5.6 [Caenor...    43   0.011
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ...    42   0.014
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv...    42   0.014
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [...    42   0.019
gi|39597161|emb|CAE59388.1| Hypothetical protein CBG02745 [Caeno...    42   0.024
gi|17534799|ref|NP_493702.1| COLlagen structural gene (col-69) [...    41   0.032
gi|84434|pir||PS0036 collagen col-7 - Caenorhabditis elegans (fr...    41   0.032
gi|39587723|emb|CAE58661.1| Hypothetical protein CBG01830 [Caeno...    41   0.042
gi|17539090|ref|NP_502514.1| COLlagen structural gene (col-132) ...    41   0.042
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD...    41   0.042
gi|17542824|ref|NP_501756.1| COLlagen structural gene (col-123) ...    41   0.042
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [...    40   0.054
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ...    40   0.054
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno...    40   0.071
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ...    40   0.071
gi|39593522|emb|CAE61814.1| Hypothetical protein CBG05782 [Caeno...    40   0.071
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno...    40   0.071
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita]    40   0.071
gi|17535069|ref|NP_496535.1| COLlagen structural gene (col-84) [...    40   0.071
gi|39582634|emb|CAE73738.1| Hypothetical protein CBG21264 [Caeno...    40   0.092
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno...    40   0.092
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid...    40   0.092
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ...    40   0.092
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno...    40   0.092
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno...    39   0.12
gi|17539040|ref|NP_501123.1| COLlagen structural gene (35.6 kD) ...    39   0.12
gi|39587623|emb|CAE58561.1| Hypothetical protein CBG01723 [Caeno...    39   0.12
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [...    39   0.12
gi|49074246|ref|XP_401271.1| hypothetical protein UM03656.1 [Ust...    39   0.12
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno...    39   0.12
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (...    39   0.16
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ...    39   0.16
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno...    39   0.16
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ...    39   0.21
gi|17976864|emb|CAD19801.1| microtubule-associated protein EB1 [...    39   0.21
gi|546193|gb|AAB30382.1| cuticle collagen {N- and C-domains, clo...    39   0.21
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno...    39   0.21
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano...    39   0.21
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno...    39   0.21
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para...    38   0.27
gi|6746588|gb|AAF27637.1| ecdysone-inducible gene E1 [Drosophila...    38   0.27
gi|24660872|ref|NP_524849.2| CG32356-PA [Drosophila melanogaster...    38   0.27
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno...    38   0.27
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno...    38   0.27
gi|28829323|gb|AAO51865.1| similar to Dictyostelium discoideum (...    38   0.35
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi]             38   0.35
gi|4731916|gb|AAD28550.1| development protein DG1124 [Dictyostel...    38   0.35
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno...    38   0.35
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [...    38   0.35
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ...    37   0.46
gi|15618622|ref|NP_224908.1| FHA domain; (homology to adenylate ...    37   0.46
gi|17542298|ref|NP_501532.1| COLlagen structural gene (col-118) ...    37   0.46
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec...    37   0.46
gi|39597388|emb|CAE59617.1| Hypothetical protein CBG03026 [Caeno...    37   0.60
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno...    37   0.60
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu...    37   0.60
gi|17540078|ref|NP_500607.1| COLlagen structural gene (col-111) ...    37   0.78
gi|33285196|gb|AAF99925.2| Collagen protein 111 [Caenorhabditis ...    37   0.78
gi|2801529|gb|AAB97359.1| IgG immunoreactive antigen [Strongyloi...    37   0.78
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel...    37   0.78
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno...    37   0.78
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno...    37   0.78
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ...    36   1.0
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi...    36   1.0
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa...    36   1.0
gi|22750435|gb|AAN05465.1| polygalacturonase [Phytophthora cinna...    36   1.0
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno...    36   1.3
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno...    36   1.3
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel...    36   1.3
gi|16758108|ref|NP_445827.1| hyperpolarization-activated, cyclic...    36   1.3
gi|17506297|ref|NP_492086.1| COLlagen structural gene (col-35) [...    36   1.3
gi|31210519|ref|XP_314226.1| ENSANGP00000014464 [Anopheles gambi...    36   1.3
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo...    36   1.3
gi|49121568|ref|XP_412424.1| hypothetical protein AN8287.2 [Aspe...    36   1.3
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd...    36   1.3
gi|4581463|emb|CAA70874.1| MEMA [Homo sapiens]                         35   1.7
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [...    35   1.7
gi|3021392|emb|CAA71377.1| nuclear protein SDK3 [Homo sapiens]         35   1.7
gi|6563230|gb|AAF17209.1| nuclear protein SDK3 [Homo sapiens]          35   1.7
gi|39979119|emb|CAE85494.1| putative protein [Neurospora crassa]       35   1.7
gi|11320891|gb|AAG33941.1| pinin [Homo sapiens]                        35   1.7
gi|33356174|ref|NP_002678.2| pinin, desmosome associated protein...    35   1.7
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633...    35   1.7
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd...    35   1.7
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno...    35   1.7
gi|39589826|emb|CAE67061.1| Hypothetical protein CBG12469 [Caeno...    35   1.7
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ...    35   1.7
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno...    35   2.3
gi|39597664|emb|CAE68355.1| Hypothetical protein CBG14092 [Caeno...    35   2.3
gi|17569903|ref|NP_508386.1| COLlagen structural gene (38.6 kD) ...    35   2.3
gi|1076839|pir||S49313 protein kinase - slime mold (Dictyosteliu...    35   2.3
gi|17505428|ref|NP_492035.1| COLlagen structural gene (col-61) [...    35   2.3
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis]         35   3.0
gi|123736|sp|P13361|HUNB_DROVI Hunchback protein >gnl|BL_ORD_ID|...    35   3.0
gi|32129323|gb|AAP73850.1| putative magnesium chelatase subunit ...    35   3.0
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g...    35   3.0
gi|39596361|emb|CAE69999.1| Hypothetical protein CBG16406 [Caeno...    35   3.0
gi|17539868|ref|NP_501416.1| predicted CDS, COLlagen structural ...    34   3.9
gi|46125615|ref|XP_387361.1| hypothetical protein FG07185.1 [Gib...    34   3.9
gi|42734064|gb|AAS38936.1| similar to Plasmodium falciparum (iso...    34   3.9
gi|28850446|gb|AAO53210.1| similar to Plasmodium falciparum (iso...    34   3.9
gi|37680610|ref|NP_935219.1| conserved hypothetical protein [Vib...    34   3.9
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli...    34   3.9
gi|26522598|dbj|BAC44837.1| JESEBL [Plasmodium falciparum]             34   3.9
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida]                34   3.9
gi|24649873|ref|NP_651318.1| CG13648-PA [Drosophila melanogaster...    34   3.9
gi|17550712|ref|NP_510630.1| COLlagen structural gene (col-187) ...    34   3.9
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha...    34   3.9
gi|23613384|ref|NP_703228.1| Ebl-1 like protein, putative [Plasm...    34   3.9
gi|45549300|ref|NP_569958.2| CG3480-PA [Drosophila melanogaster]...    34   3.9
gi|33242070|ref|NP_877011.1| Forkhead domain protein [Chlamydoph...    34   3.9
gi|7022907|dbj|BAA91764.1| unnamed protein product [Homo sapiens...    34   5.1
gi|20129887|ref|NP_610708.1| CG13185-PA [Drosophila melanogaster...    34   5.1
gi|14043666|gb|AAH07803.1| ATAD3A protein [Homo sapiens] >gnl|BL...    34   5.1
gi|45185072|ref|NP_982789.1| ABL158Cp [Eremothecium gossypii] >g...    34   5.1
gi|42733854|gb|AAS38772.1| similar to Dictyostelium discoideum (...    34   5.1
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno...    34   5.1
gi|13752411|gb|AAK38647.1| TOB3 [Homo sapiens]                         34   5.1
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (...    34   5.1
gi|47223608|emb|CAF99217.1| unnamed protein product [Tetraodon n...    34   5.1
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA...    34   5.1
gi|49075432|ref|XP_401782.1| hypothetical protein UM04167.1 [Ust...    34   5.1
gi|24640806|ref|NP_572556.1| CG17446-PA [Drosophila melanogaster...    34   5.1
gi|28829619|gb|AAO52136.1| similar to Dictyostelium. Serine/thre...    34   5.1
gi|16198327|gb|AAL14009.1| SD07158p [Drosophila melanogaster]          34   5.1
gi|28829970|gb|AAO52460.1| similar to Dictyostelium discoideum (...    34   5.1
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa]                    34   5.1
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder...    34   5.1
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD...    34   5.1
gi|39596974|emb|CAE59201.1| Hypothetical protein CBG02512 [Caeno...    34   5.1
gi|21711795|gb|AAM75088.1| RH42893p [Drosophila melanogaster]          33   6.6
gi|28571703|ref|NP_788675.1| CG9297-PA [Drosophila melanogaster]...    33   6.6
gi|46409130|gb|AAS93722.1| RE64616p [Drosophila melanogaster]          33   6.6
gi|722336|gb|AAB03641.1| unknown protein                               33   6.6
gi|46442947|gb|EAL02232.1| hypothetical protein CaO19.8420 [Cand...    33   6.6
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand...    33   6.6
gi|39579123|emb|CAE56688.1| Hypothetical protein CBG24466 [Caeno...    33   6.6
gi|23613862|ref|NP_704883.1| vesicle transport protein, putative...    33   6.6
gi|11078661|gb|AAG29138.1| Ras guanine nucleotide exchange facto...    33   6.6
gi|24286634|gb|AAN46871.1| nucleotide exchange factor RasGEF B [...    33   6.6
gi|2135328|pir||I56208 heat shock protein 70 - human >gnl|BL_ORD...    33   6.6
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C...    33   6.6
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand...    33   6.6
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl...    33   6.6
gi|28571705|ref|NP_788674.1| CG9297-PB [Drosophila melanogaster]...    33   6.6
gi|46440639|gb|EAK99943.1| hypothetical protein CaO19.6260 [Cand...    33   6.6
gi|23508683|ref|NP_701352.1| antigen 332, putative [Plasmodium f...    33   6.6
gi|32475233|ref|NP_868227.1| hypothetical protein-putative trans...    33   6.6
gi|17538077|ref|NP_495159.1| COLlagen structural gene (col-74) [...    33   6.6
gi|17508941|ref|NP_491800.1| COLlagen structural gene (col-56) [...    33   6.6
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli...    33   6.6
gi|38327039|ref|NP_002145.3| heat shock 70kDa protein 4 isoform ...    33   6.6
gi|6226869|sp|P34932|HS74_HUMAN HEAT SHOCK 70 KDA PROTEIN 4 (HEA...    33   6.6
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa]                    33   6.6
gi|49456613|emb|CAG46627.1| PENK [Homo sapiens]                        33   8.7
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ...    33   8.7
gi|7512088|pir||T30282 calcium-binding protein - sea urchin (Str...    33   8.7
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (...    33   8.7
gi|1684847|gb|AAB48304.1| pinin [Homo sapiens]                         33   8.7
gi|39595642|emb|CAE67144.1| Hypothetical protein CBG12567 [Caeno...    33   8.7
gi|33942128|ref|NP_114127.2| AAA-ATPase  TOB3; AAA-ATPase TOB3 [...    33   8.7
gi|32479389|ref|NP_862242.1| YtpD [Corynebacterium striatum] >gn...    33   8.7
gi|17551634|ref|NP_508124.1| kinase (40.9 kD) (XB213) [Caenorhab...    33   8.7
gi|23509680|ref|NP_702347.1| hypothetical protein [Plasmodium fa...    33   8.7
gi|17557828|ref|NP_505635.1| COLlagen structural gene (col-148) ...    33   8.7
gi|6746586|gb|AAF27636.1| Sec12 [Pichia pastoris]                      33   8.7
gi|17557174|ref|NP_505670.1| COLlagen structural gene (col-151) ...    33   8.7


>gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD)
           (col-130) [Caenorhabditis elegans]
 gi|7498672|pir||T20605 hypothetical protein F08G5.4 -
           Caenorhabditis elegans
 gi|3875590|emb|CAA94581.1| Hypothetical protein F08G5.4
           [Caenorhabditis elegans]
          Length = 299

 Score =  217 bits (552), Expect = 3e-55
 Identities = 113/139 (81%), Positives = 113/139 (81%)
 Frame = -1

Query: 900 MSAKYVVTIASCFSGLAIVACLFTVGAIFKDINDLYDNVMDDMDEFKMFANNAWKDMIPV 721
           MSAKYVVTIASCFSGLAIVACLFTVGAIFKDINDLYDNVMDDMDEFKMFANNAWKDMIPV
Sbjct: 1   MSAKYVVTIASCFSGLAIVACLFTVGAIFKDINDLYDNVMDDMDEFKMFANNAWKDMIPV 60

Query: 720 TRPSLDNQSNLRAIFGREKRQAXXXXXXXXXXXXXXXXXXXXXXXXXXGDDGHAGEAGKT 541
           TRPSLDNQSNLRAIFGREKRQA                          GDDGHAGEAGKT
Sbjct: 61  TRPSLDNQSNLRAIFGREKRQAGQCNCGAQPNNCPPGPPGPPGAPGAPGDDGHAGEAGKT 120

Query: 540 GINGISLISHEGESGCIKC 484
           GINGISLISHEGESGCIKC
Sbjct: 121 GINGISLISHEGESGCIKC 139



 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 38/38 (100%), Positives = 38/38 (100%)
 Frame = -1

Query: 117 NAGQPGADAAYCPCPARTGAVENKPETSGYRRRVSKVV 4
           NAGQPGADAAYCPCPARTGAVENKPETSGYRRRVSKVV
Sbjct: 262 NAGQPGADAAYCPCPARTGAVENKPETSGYRRRVSKVV 299




[DB home][top]