Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F10B5_3
(645 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17533037|ref|NP_495707.1| ribosomal Protein, Large subunit (2... 447 e-125
gi|39587265|emb|CAE57733.1| Hypothetical protein CBG00744 [Caeno... 421 e-117
gi|37951186|emb|CAC80049.1| putative tumor suppressor [Suberites... 328 7e-89
gi|28630283|gb|AAN73368.1| ribosomal protein L10 [Petromyzon mar... 327 1e-88
gi|5174431|ref|NP_006004.1| ribosomal protein L10; QM gene; 60S ... 323 2e-87
gi|13592053|ref|NP_112362.1| ribosomal protein L10 [Rattus norve... 323 2e-87
gi|27807465|ref|NP_777185.1| ribosomal protein L10 [Bos taurus] ... 323 2e-87
gi|49671118|gb|AAH75477.1| Unknown (protein for MGC:89303) [Xeno... 322 5e-87
gi|37723970|gb|AAN85578.1| QM protein [Pinctada fucata] 322 5e-87
gi|18202261|sp|O96647|RL10_BOMMA 60S ribosomal protein L10 (QM p... 321 9e-87
gi|20909742|ref|XP_138143.1| similar to 60S ribosomal protein L1... 320 1e-86
gi|14794489|gb|AAK73358.1| QM protein [Bombyx mori] 320 2e-86
gi|28279932|gb|AAH44716.1| Rpl10-prov protein [Xenopus laevis] 319 3e-86
gi|41053337|ref|NP_956321.1| ribosomal protein L10; wu:fa93d03 [... 318 6e-86
gi|29841379|gb|AAP06411.1| similar to GenBank Accession Number A... 318 6e-86
gi|41151097|ref|XP_209178.3| similar to 60S ribosomal protein L1... 318 7e-86
gi|14010642|gb|AAK52067.1| QM protein [Heliothis virescens] 317 1e-85
gi|15293885|gb|AAK95135.1| ribosomal protein L10 [Ictalurus punc... 317 2e-85
gi|18152783|ref|NP_542784.1| ribosomal protein L10-like protein ... 316 2e-85
gi|49532896|dbj|BAD26683.1| QM protein [Plutella xylostella] 316 3e-85
gi|28200274|gb|AAO31769.1| ribosomal protein L10 [Branchiostoma ... 315 4e-85
gi|19423868|gb|AAL88713.1| ribosomal protein L10 [Homo sapiens] 315 5e-85
gi|48107653|ref|XP_393092.1| similar to QM protein [Apis mellifera] 315 5e-85
gi|47212090|emb|CAF90584.1| unnamed protein product [Tetraodon n... 315 6e-85
gi|31207187|ref|XP_312560.1| ENSANGP00000014921 [Anopheles gambi... 313 2e-84
gi|31200393|ref|XP_309144.1| ENSANGP00000023750 [Anopheles gambi... 313 2e-84
gi|33337358|gb|AAQ13347.1| ribosomal protein L10 [Hydra vulgaris] 312 4e-84
gi|41146945|ref|XP_371781.1| similar to 60S ribosomal protein L1... 311 7e-84
gi|38047831|gb|AAR09818.1| similar to Drosophila melanogaster qm... 310 2e-83
gi|1172811|sp|P45635|R101_ORYSA 60S RIBOSOMAL PROTEIN L10-1 (PUT... 310 2e-83
gi|21355359|ref|NP_651954.1| CG17521-PA [Drosophila melanogaster... 309 3e-83
gi|2500354|sp|P93847|RL10_SOLME 60S RIBOSOMAL PROTEIN L10 (EQM) ... 309 3e-83
gi|34878287|ref|XP_344656.1| similar to 60S ribosomal protein L1... 308 8e-83
gi|1172809|sp|P45633|RL10_MAIZE 60S RIBOSOMAL PROTEIN L10 (QM PR... 305 4e-82
gi|1172808|sp|Q08200|RL10_CHICK 60S RIBOSOMAL PROTEIN L10 (JUN-B... 305 6e-82
gi|20886513|ref|XP_134291.1| similar to 60S ribosomal protein L1... 303 1e-81
gi|2500353|sp|Q40649|R103_ORYSA 60S ribosomal protein L10-3 (QM/... 303 1e-81
gi|46137461|ref|XP_390422.1| hypothetical protein FG10246.1 [Gib... 303 2e-81
gi|11036950|gb|AAG27431.1| QM-like protein [Elaeis guineensis] 301 5e-81
gi|18203445|sp|Q9SPB3|RL10_VITRI 60S ribosomal protein L10 (QM p... 301 7e-81
gi|23509362|ref|NP_702029.1| ribosomal protein L10, putative [Pl... 301 9e-81
gi|38105068|gb|EAA51541.1| hypothetical protein MG03136.4 [Magna... 300 2e-80
gi|23484604|gb|EAA19879.1| Ribosomal L10, putative [Plasmodium y... 300 2e-80
gi|28797723|gb|AAO47090.1| ribosomal L10 protein [Paracoccidioid... 300 2e-80
gi|46359878|gb|AAS88810.1| 'putative 60S ribosomal protein, L10'... 299 4e-80
gi|18203270|sp|Q9M5M7|RL10_EUPES 60S ribosomal protein L10 >gnl|... 298 5e-80
gi|50313215|gb|AAT74554.1| QM family protein [Caragana jubata] 295 5e-79
gi|32421825|ref|XP_331356.1| hypothetical protein [Neurospora cr... 295 7e-79
gi|15223382|ref|NP_174013.1| 60S ribosomal protein L10 (RPL10B) ... 295 7e-79
gi|49861132|gb|AAT68777.1| QM-like protein [Camellia sinensis] 294 1e-78
gi|18408550|ref|NP_564878.1| 60S ribosomal protein L10 (RPL10C) ... 293 1e-78
gi|30683726|ref|NP_563945.2| 60S ribosomal protein L10 (RPL10A) ... 293 3e-78
gi|1172813|sp|P45636|R102_ORYSA 60S RIBOSOMAL PROTEIN L10-2 (PUT... 292 3e-78
gi|6093994|sp|O22431|RL10_PINTA 60S ribosomal protein L10 (Wilm'... 291 7e-78
gi|50259788|gb|EAL22456.1| hypothetical protein CNBB3350 [Crypto... 291 7e-78
gi|32398995|emb|CAD98460.1| ribsomal protein L10, probable [Cryp... 290 2e-77
gi|478401|pir||JQ2244 ribosomal protein L10.e, cytosolic - Arabi... 290 2e-77
gi|38048395|gb|AAR10100.1| similar to Drosophila melanogaster qm... 290 2e-77
gi|49097520|ref|XP_410220.1| hypothetical protein AN6083.2 [Aspe... 289 3e-77
gi|45185467|ref|NP_983184.1| ABR235Wp [Eremothecium gossypii] >g... 289 4e-77
gi|50292683|ref|XP_448774.1| unnamed protein product [Candida gl... 287 1e-76
gi|28630281|gb|AAN73367.1| ribosomal protein L10 [Myxine glutinosa] 286 2e-76
gi|6323104|ref|NP_013176.1| Protein component of the large (60S)... 285 7e-76
gi|29246114|gb|EAA37723.1| GLP_260_5617_4985 [Giardia lamblia AT... 284 1e-75
gi|28630279|gb|AAN73366.1| ribosomal protein L10 [Branchiostoma ... 283 2e-75
gi|19112642|ref|NP_595850.1| 60s ribosomal protein l10 [Schizosa... 283 3e-75
gi|19115227|ref|NP_594315.1| 60s ribosomal protein l10 [Schizosa... 282 3e-75
gi|50550607|ref|XP_502776.1| hypothetical protein [Yarrowia lipo... 282 3e-75
gi|49073436|ref|XP_400937.1| hypothetical protein UM03322.1 [Ust... 281 8e-75
gi|2130476|pir||JC4755 ribosomal protein L10.e, cytosolic - fiss... 281 8e-75
gi|8977991|emb|CAB95736.1| putative ribosomal protein L10 [Leish... 280 1e-74
gi|12311801|emb|CAC22619.1| 60S ribosomal protein L10 [Leishmani... 280 2e-74
gi|50306677|ref|XP_453312.1| unnamed protein product [Kluyveromy... 280 2e-74
gi|50418174|ref|XP_457757.1| unnamed protein product [Debaryomyc... 279 3e-74
gi|14091455|gb|AAK53755.1| QM-like protein [Trypanosoma brucei] 279 4e-74
gi|10443488|gb|AAG17477.1| QM protein [Oryza sativa] 278 5e-74
gi|38079574|ref|XP_357453.1| similar to 60S ribosomal protein L1... 278 5e-74
gi|46443070|gb|EAL02354.1| hypothetical protein CaO19.10452 [Can... 276 2e-73
gi|2500352|sp|Q39724|RL10_EUGGR 60S RIBOSOMAL PROTEIN L10 >gnl|B... 267 1e-70
gi|21309663|gb|AAL68397.1| ribosomal protein L10 [Entamoeba hist... 261 8e-69
gi|49258847|pdb|1S1I|I Chain I, Structure Of The Ribosomal 80s-E... 253 2e-66
gi|28317134|gb|AAO39584.1| LD24589p [Drosophila melanogaster] 249 2e-65
gi|19173482|ref|NP_597285.1| 60S RIBOSOMAL PROTEIN L10 [Encephal... 249 2e-65
gi|2500351|sp|Q29195|RL10_PIG 60S ribosomal protein L10 (QM prot... 244 8e-64
gi|32400770|gb|AAP80617.1| QM [Triticum aestivum] 242 4e-63
gi|13812375|ref|NP_113493.1| 60S ribosomal protein L10 [Guillard... 235 6e-61
gi|27673533|ref|XP_236837.1| similar to 60S ribosomal protein L1... 233 3e-60
gi|1305525|gb|AAA99158.1| Wilms' tumor-related protein QM 233 3e-60
gi|249371|gb|AAB22173.1| laminin receptor homolog [Homo sapiens] 231 9e-60
gi|25313186|pir||F96691 probable 60S ribosomal protein L10 [impo... 225 5e-58
gi|3642643|gb|AAC36512.1| QM protein [Mus musculus] 201 1e-50
gi|1881378|dbj|BAA19414.1| QM family protein [Solanum melongena] 193 2e-48
gi|100689|pir||S19224 ribosomal protein L10.e, cytosolic - rice ... 185 7e-46
gi|45454240|gb|AAS65799.1| ribosomal protein L10 [Balanus glandula] 180 2e-44
gi|2500355|sp|Q40592|RL10_TOBAC 60S RIBOSOMAL PROTEIN L10 (QM PR... 177 2e-43
gi|28189767|dbj|BAC56498.1| similar to ribosomal protein L10 [Bo... 170 2e-41
gi|12802858|gb|AAK08096.1| putative 60S ribosomal protein L10 [C... 169 4e-41
gi|28189218|dbj|BAC56300.1| similar to ribosomal protein [Bos ta... 156 3e-37
gi|20093691|ref|NP_613538.1| Ribosomal protein L16/L10E [Methano... 140 2e-32
gi|14190449|gb|AAK55705.1| At1g14320/F14L17_28 [Arabidopsis thal... 132 7e-30
gi|18314160|ref|NP_560827.1| ribosomal protein L10 [Pyrobaculum ... 128 8e-29
gi|14600720|ref|NP_147241.1| 50S ribosomal protein L10 [Aeropyru... 128 1e-28
gi|11498937|ref|NP_070168.1| ubiquinol-cytochrome C reductase co... 125 7e-28
gi|34860624|ref|XP_345292.1| similar to 60S ribosomal protein L1... 123 3e-27
gi|15668723|ref|NP_247522.1| ubiquinol-cytochrome C reductase co... 122 6e-27
gi|14590524|ref|NP_142592.1| ubiquinol-cytochrome c reductase co... 117 1e-25
gi|18977651|ref|NP_579008.1| LSU ribosomal protein L10 [Pyrococc... 117 2e-25
gi|14521607|ref|NP_127083.1| ribosomal protein L10 [Pyrococcus a... 117 2e-25
gi|38075481|ref|XP_356702.1| similar to 60S ribosomal protein L1... 116 3e-25
gi|37549454|ref|XP_209500.2| similar to 60S ribosomal protein L1... 115 6e-25
gi|20978621|sp|Q96YA4|RL10_SULTO 50S ribosomal protein L10e 114 1e-24
gi|15922595|ref|NP_378264.1| 179aa long hypothetical 50S ribosom... 114 1e-24
gi|38075339|ref|XP_357237.1| similar to 60S ribosomal protein L1... 114 1e-24
gi|45358852|ref|NP_988409.1| Ribosomal protein L10E [Methanococc... 113 4e-24
gi|34875567|ref|XP_344457.1| similar to 60S ribosomal protein L1... 113 4e-24
gi|21227578|ref|NP_633500.1| LSU ribosomal protein L10AE [Methan... 111 1e-23
gi|34853952|ref|XP_345353.1| similar to 60S ribosomal protein L1... 110 2e-23
gi|20089081|ref|NP_615156.1| ribosomal protein L10e [Methanosarc... 110 2e-23
gi|15679130|ref|NP_276247.1| ribosomal protein L10 [Methanotherm... 110 3e-23
gi|16082585|ref|NP_394517.1| 50S ribosomal protein L10E [Thermop... 109 4e-23
gi|15789424|ref|NP_279248.1| 50S ribosomal protein L10E; Rpl10e ... 109 4e-23
gi|50513477|pdb|1S72|H Chain H, Refined Crystal Structure Of The... 109 4e-23
gi|48852457|ref|ZP_00306643.1| COG0197: Ribosomal protein L16/L1... 106 4e-22
gi|48838840|ref|ZP_00295778.1| COG0197: Ribosomal protein L16/L1... 105 7e-22
gi|13541370|ref|NP_111058.1| 50S ribosomal protein L10E [Thermop... 105 7e-22
gi|41719065|ref|ZP_00147998.1| COG0197: Ribosomal protein L16/L1... 103 3e-21
gi|41146967|ref|XP_373100.1| similar to 60S ribosomal protein L1... 103 3e-21
gi|48477787|ref|YP_023493.1| 50S ribosomal protein L10e [Picroph... 103 3e-21
gi|15897239|ref|NP_341844.1| LSU ribosomal protein L10E (rpl10E)... 102 5e-21
gi|10640371|emb|CAC12185.1| probable 50S ribosomal protein L10 [... 102 5e-21
gi|42662033|ref|XP_377511.1| similar to 60S ribosomal protein L1... 99 5e-20
gi|15825950|pdb|1JJ2|H Chain H, Fully Refined Crystal Structure ... 97 2e-19
gi|42655641|ref|XP_372759.2| similar to 60S ribosomal protein L1... 96 5e-19
gi|45477178|sp|P60617|RL10_HALMA 50S ribosomal protein L10e 93 4e-18
gi|41150291|ref|XP_372638.1| similar to 60S ribosomal protein L1... 89 7e-17
gi|41148524|ref|XP_373233.1| similar to 60S ribosomal protein L1... 88 1e-16
gi|3164202|dbj|BAA28595.1| ribosomal protein L10 [Homo sapiens] 85 1e-15
gi|41201798|ref|XP_372471.1| similar to 60S ribosomal protein L1... 82 7e-15
gi|41148614|ref|XP_373242.1| similar to 60S ribosomal protein L1... 82 9e-15
gi|23491778|dbj|BAC19833.1| ribosomal protein L10-like [Homo sap... 80 3e-14
gi|23573620|gb|AAN38746.1| QM protein [Spodoptera frugiperda] 76 6e-13
gi|34869421|ref|XP_344032.1| similar to 60S ribosomal protein L1... 75 8e-13
gi|27675530|ref|XP_223490.1| similar to 60S ribosomal protein L1... 74 3e-12
gi|41615235|ref|NP_963733.1| NEQ450 [Nanoarchaeum equitans Kin4-... 72 1e-11
gi|4426935|gb|AAD20612.1| senescence-associated protein [Arabido... 69 1e-10
gi|34853948|ref|XP_345351.1| similar to 60S ribosomal protein L1... 68 2e-10
gi|41147214|ref|XP_373091.1| similar to 60S ribosomal protein L1... 65 1e-09
gi|2131768|pir||S64908 hypothetical protein YLR076c - yeast (Sac... 64 3e-09
gi|38086457|ref|XP_358222.1| similar to 60S ribosomal protein L1... 63 6e-09
gi|37731958|gb|AAO72743.1| 60S ribosomal protein L10 [Pteris vit... 60 3e-08
gi|10120925|pdb|1FFK|F Chain F, Crystal Structure Of The Large R... 59 8e-08
gi|34873037|ref|XP_222255.2| similar to polymerase (DNA directed... 57 2e-07
gi|14278046|pdb|1GIY|P Chain P, Crystal Structure Of The Ribosom... 53 6e-06
gi|29246115|gb|EAA37724.1| GLP_260_5730_5329 [Giardia lamblia AT... 52 1e-05
gi|50306679|ref|XP_453313.1| unnamed protein product [Kluyveromy... 52 1e-05
gi|38077452|ref|XP_358479.1| hypothetical protein XP_358479 [Mus... 50 4e-05
gi|39938693|ref|NP_950459.1| ribosomal protein L16/L10E [Onion y... 40 0.039
gi|34871337|ref|XP_343889.1| similar to 60S ribosomal protein L1... 39 0.11
gi|15896376|ref|NP_349725.1| Ribosomal protein L16 [Clostridium ... 37 0.25
gi|17566006|ref|NP_505150.1| putative protein (5I806) [Caenorhab... 37 0.43
gi|42661244|ref|XP_375430.1| similar to 60S ribosomal protein L1... 36 0.73
gi|1170843|sp|P41929|LYC1_YARLI Lysine acetyltransferase (Lysine... 34 2.1
gi|33862107|ref|NP_893668.1| 50S ribosomal protein L16 [Prochlor... 33 3.6
gi|23097581|ref|NP_691047.1| 50S ribosomal protein L16 [Oceanoba... 33 3.6
gi|33866606|ref|NP_898165.1| 50S ribosomal protein L16 [Synechoc... 33 4.7
gi|33241154|ref|NP_876096.1| Ribosomal protein L16/L10E [Prochlo... 33 4.7
gi|29374858|ref|NP_814011.1| ribosomal protein L16 [Enterococcus... 33 4.7
gi|16120860|ref|NP_404173.1| 3-isopropylmalate dehydratase large... 33 6.2
gi|34014969|gb|AAQ56240.1| taxadiene 5-alpha hydroxylase [Taxus ... 33 6.2
gi|31216799|ref|XP_316302.1| ENSANGP00000020616 [Anopheles gambi... 33 6.2
gi|9931588|gb|AAG02220.1| ribosomal protein L16 [Enterococcus fa... 33 6.2
gi|48824729|ref|ZP_00286068.1| COG0197: Ribosomal protein L16/L1... 33 6.2
gi|22127521|ref|NP_670944.1| 3-isopropylmalate isomerase (dehydr... 33 6.2
gi|21674991|ref|NP_663056.1| ribosomal protein L16 [Chlorobium t... 33 6.2
gi|3649741|emb|CAA03985.1| mucin [Homo sapiens] 32 8.0
gi|15965569|ref|NP_385922.1| HYPOTHETICAL TRANSMEMBRANE PROTEIN ... 32 8.0
gi|722279|gb|AAA63900.1| alpha-amylase [Bacillus sp. TS-23] 32 8.0
gi|20143937|ref|NP_060876.2| mucin 4 isoform a [Homo sapiens] 32 8.0
gi|20877676|ref|XP_139081.1| similar to interleukin 17D precurso... 32 8.0
gi|20143924|ref|NP_612156.1| mucin 4 isoform c [Homo sapiens] 32 8.0
gi|34874216|ref|XP_224165.2| similar to Recessive polycystic kid... 32 8.0
gi|22003886|ref|NP_665836.1| interleukin 17D; interleukin 27A [M... 32 8.0
gi|21779851|gb|AAM77567.1| IL-17D [Mus musculus] 32 8.0
gi|3551821|gb|AAC34750.1| mucin 4 [Homo sapiens] 32 8.0
gi|20143920|ref|NP_612155.1| mucin 4 isoform b [Homo sapiens] 32 8.0
gi|38101084|gb|EAA48105.1| hypothetical protein MG09642.4 [Magna... 32 8.0
gi|33300082|emb|CAE17706.1| Hypothetical protein C30H6.11 [Caeno... 32 8.0
>gi|17533037|ref|NP_495707.1| ribosomal Protein, Large subunit (24.7
kD) (rpl-10) [Caenorhabditis elegans]
gi|1172807|sp|Q09533|RL10_CAEEL 60S ribosomal protein L10 (QM
protein homolog)
gi|7498787|pir||T20688 hypothetical protein F10B5.1 -
Caenorhabditis elegans
gi|3875709|emb|CAA88308.1| Hypothetical protein F10B5.1
[Caenorhabditis elegans]
Length = 214
Score = 447 bits (1151), Expect = e-125
Identities = 214/214 (100%), Positives = 214/214 (100%)
Frame = +1
Query: 1 MGRRPARCYRYIKNKPYPKSRFCRGVPDAKIRIFDLGNKRANVDTFPACVHMMSNEREHL 180
MGRRPARCYRYIKNKPYPKSRFCRGVPDAKIRIFDLGNKRANVDTFPACVHMMSNEREHL
Sbjct: 1 MGRRPARCYRYIKNKPYPKSRFCRGVPDAKIRIFDLGNKRANVDTFPACVHMMSNEREHL 60
Query: 181 SSEALEAARICANKYMVKNCGKDGFHLRVRKHPFHVTRINKMLSCAGADRLQTGMRGAYG 360
SSEALEAARICANKYMVKNCGKDGFHLRVRKHPFHVTRINKMLSCAGADRLQTGMRGAYG
Sbjct: 61 SSEALEAARICANKYMVKNCGKDGFHLRVRKHPFHVTRINKMLSCAGADRLQTGMRGAYG 120
Query: 361 KPQGLVARVDIGDILFSMRIKEGNVKHAIEAFRRAKFKFPGRQIIVSSRKWGFTKWDRED 540
KPQGLVARVDIGDILFSMRIKEGNVKHAIEAFRRAKFKFPGRQIIVSSRKWGFTKWDRED
Sbjct: 121 KPQGLVARVDIGDILFSMRIKEGNVKHAIEAFRRAKFKFPGRQIIVSSRKWGFTKWDRED 180
Query: 541 YERMRAEGRLRSDGVGVQLQREHGPLTKWIENPI 642
YERMRAEGRLRSDGVGVQLQREHGPLTKWIENPI
Sbjct: 181 YERMRAEGRLRSDGVGVQLQREHGPLTKWIENPI 214