Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F10E7_2
(375 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535695|ref|NP_495468.1| ribosomal Protein, Large subunit (1... 253 6e-67
gi|39582292|emb|CAE67541.1| Hypothetical protein CBG13066 [Caeno... 239 9e-63
gi|48109133|ref|XP_393102.1| similar to ribosomal protein L35A [... 147 5e-35
gi|15213788|gb|AAK92169.1| ribosomal protein L35A [Spodoptera fr... 147 5e-35
gi|38075333|ref|XP_357233.1| similar to ribosomal protein L35a [... 139 1e-32
gi|50540044|ref|NP_001002487.1| zgc:92859 [Danio rerio] >gnl|BL_... 138 2e-32
gi|10863991|ref|NP_067087.1| ribosomal protein L35a [Rattus norv... 138 2e-32
gi|16117791|ref|NP_000987.2| ribosomal protein L35a; 60S ribosom... 138 3e-32
gi|32450077|gb|AAH53771.1| Rpl35a-prov protein [Xenopus laevis] 138 3e-32
gi|29841382|gb|AAP06414.1| similar to GenBank Accession Number A... 137 4e-32
gi|22001893|sp|Q90YT3|R35A_ICTPU 60S ribosomal protein L35a >gnl... 137 4e-32
gi|50752315|ref|XP_422734.1| PREDICTED: similar to ribosomal pro... 137 4e-32
gi|38080231|ref|XP_358916.1| similar to ribosomal protein L35a [... 137 5e-32
gi|50416659|gb|AAH77673.1| Unknown (protein for MGC:89840) [Xeno... 137 5e-32
gi|132942|sp|P02434|R35A_XENLA 60S RIBOSOMAL PROTEIN L35A (L32) ... 137 5e-32
gi|3914537|sp|O55142|R35A_MOUSE 60S ribosomal protein L35a 137 7e-32
gi|26338025|dbj|BAC32698.1| unnamed protein product [Mus musculus] 136 9e-32
gi|12833486|dbj|BAB22541.1| unnamed protein product [Mus musculus] 135 2e-31
gi|71346|pir||R5HU35 ribosomal protein L35a - human >gnl|BL_ORD_... 135 2e-31
gi|47216491|emb|CAG02142.1| unnamed protein product [Tetraodon n... 133 7e-31
gi|21356927|ref|NP_649539.1| CG2099-PA [Drosophila melanogaster]... 133 7e-31
gi|38047825|gb|AAR09815.1| similar to Drosophila melanogaster CG... 133 7e-31
gi|38048243|gb|AAR10024.1| similar to Drosophila melanogaster CG... 133 7e-31
gi|38079935|ref|XP_356896.1| similar to ribosomal protein L35a [... 131 3e-30
gi|38080715|ref|XP_358953.1| similar to ribosomal protein L35a [... 131 3e-30
gi|38084044|ref|XP_357610.1| similar to ribosomal protein L35a [... 130 8e-30
gi|27674209|ref|XP_213423.1| similar to ribosomal protein L35a [... 128 2e-29
gi|27716007|ref|XP_213045.1| similar to ribosomal protein L35a [... 128 3e-29
gi|38078110|ref|XP_357366.1| similar to ribosomal protein L35a [... 125 2e-28
gi|49328003|gb|AAT58704.1| putative ribosomal protein L35A [Oryz... 125 3e-28
gi|14719290|gb|AAK73115.1| ribosomal protein L35A [Zea mays] 123 8e-28
gi|18092339|gb|AAL59231.1| ribosomal protein L35A [Zea mays] 123 1e-27
gi|49076558|ref|XP_402241.1| hypothetical protein UM04626.1 [Ust... 122 1e-27
gi|38090364|ref|XP_356455.1| similar to ribosomal protein L35a [... 120 6e-27
gi|47497154|dbj|BAD19202.1| putative ribosomal protein L35A [Ory... 119 2e-26
gi|13430186|gb|AAK25760.1| ribosomal protein L33 [Castanea sativa] 118 2e-26
gi|15221191|ref|NP_177567.1| 60S ribosomal protein L35a (RPL35aC... 117 7e-26
gi|31206435|ref|XP_312171.1| ENSANGP00000022149 [Anopheles gambi... 117 7e-26
gi|27659536|ref|XP_226576.1| similar to ribosomal protein L35a [... 116 1e-25
gi|27525284|emb|CAC82551.1| putative 60S ribosomal protein L35a ... 116 1e-25
gi|15222276|ref|NP_172188.1| 60S ribosomal protein L35a (RPL35aA... 115 2e-25
gi|15222338|ref|NP_174951.1| 60S ribosomal protein L35a (RPL35aB... 115 2e-25
gi|15228184|ref|NP_191134.1| 60S ribosomal protein L35a (RPL35aD... 115 3e-25
gi|34862732|ref|XP_345795.1| similar to ribosomal protein L35a [... 111 3e-24
gi|46229456|gb|EAK90274.1| 60S ribosomal protein L35A , transcri... 111 3e-24
gi|49091312|ref|XP_407117.1| hypothetical protein AN2980.2 [Aspe... 109 1e-23
gi|50557372|ref|XP_506094.1| hypothetical protein [Yarrowia lipo... 108 2e-23
gi|15214241|sp|Q9USX4|R33A_SCHPO 60S ribosomal protein L33-A (L37A) 108 3e-23
gi|50257256|gb|EAL19965.1| hypothetical protein CNBF2920 [Crypto... 107 7e-23
gi|19075364|ref|NP_587864.1| ribosomal protein l37 homolog [Schi... 106 9e-23
gi|3628748|dbj|BAA33367.1| ribosomal protein L37 homolog [Schizo... 106 1e-22
gi|23508627|ref|NP_701296.1| Ribosomal protein, putative [Plasmo... 105 2e-22
gi|50554507|ref|XP_504662.1| hypothetical protein [Yarrowia lipo... 105 2e-22
gi|45185806|ref|NP_983522.1| ACR120Cp [Eremothecium gossypii] >g... 103 8e-22
gi|50294085|ref|XP_449454.1| unnamed protein product [Candida gl... 103 1e-21
gi|6325114|ref|NP_015182.1| N-terminally acetylated ribosomal pr... 102 2e-21
gi|23481563|gb|EAA17804.1| Ribosomal protein L35Ae, putative [Pl... 102 2e-21
gi|50306833|ref|XP_453392.1| unnamed protein product [Kluyveromy... 100 5e-21
gi|6324808|ref|NP_014877.1| Ribosomal protein L37 of the large (... 100 5e-21
gi|46108792|ref|XP_381454.1| conserved hypothetical protein [Gib... 100 1e-20
gi|32170390|emb|CAD99404.1| rpl3701 [Schizosaccharomyces pombe] 94 5e-19
gi|19112786|ref|NP_595994.1| 60s ribosomal protein l37 [Schizosa... 94 8e-19
gi|50428141|ref|XP_458384.1| unnamed protein product [Debaryomyc... 91 4e-18
gi|65049|emb|CAA24701.1| unnamed protein product [Xenopus laevis] 91 4e-18
gi|38099349|gb|EAA46706.1| hypothetical protein MG09927.4 [Magna... 87 6e-17
gi|32422115|ref|XP_331501.1| hypothetical protein [Neurospora cr... 87 8e-17
gi|12802856|gb|AAK08095.1| putative 60S ribosomal protein L35a [... 77 8e-14
gi|38050490|ref|XP_354683.1| similar to ribosomal protein L35a [... 73 1e-12
gi|29248390|gb|EAA39925.1| GLP_479_47445_47074 [Giardia lamblia ... 69 2e-11
gi|19074009|ref|NP_584615.1| 60S RIBOSOMAL PROTEIN L35A (L33) [E... 65 2e-10
gi|32264424|gb|AAP78707.1| ribosomal protein L35a [Equus caballus] 64 5e-10
gi|41615092|ref|NP_963590.1| NEQ303 [Nanoarchaeum equitans Kin4-... 56 1e-07
gi|20093595|ref|NP_613442.1| Ribosomal protein L35AE/L33A [Metha... 51 5e-06
gi|7522571|pir||T39785 ribosomal protein l37 - fission yeast (Sc... 50 1e-05
gi|14520601|ref|NP_126076.1| LSU ribosomal protein L35AE. [Pyroc... 46 2e-04
gi|14591579|ref|NP_143661.1| 50S ribosomal protein L35 [Pyrococc... 46 2e-04
gi|18978244|ref|NP_579601.1| LSU ribosomal protein L35AE [Pyroco... 45 3e-04
gi|141176|sp|P20299|R35A_PYRWO 50S ribosomal protein L35Ae >gnl|... 45 3e-04
gi|50306831|ref|XP_453391.1| unnamed protein product [Kluyveromy... 44 0.001
gi|49088366|ref|XP_406015.1| hypothetical protein AN1878.2 [Aspe... 43 0.002
gi|2132204|pir||S70042 hypothetical protein YPL142c - yeast (Sac... 42 0.003
gi|38099337|gb|EAA46694.1| hypothetical protein MG09915.4 [Magna... 42 0.004
gi|28574039|ref|NP_523475.2| CG3047-PA [Drosophila melanogaster]... 41 0.005
gi|32566278|ref|NP_500256.2| predicted CDS, putative membrane pr... 40 0.008
gi|7209719|dbj|BAA92310.1| This gene is isolated by means of dif... 40 0.011
gi|39596379|emb|CAE70017.1| Hypothetical protein CBG16431 [Caeno... 40 0.014
gi|38073487|ref|XP_355243.1| similar to This gene is isolated by... 39 0.019
gi|50308337|ref|XP_454170.1| unnamed protein product [Kluyveromy... 39 0.032
gi|42409266|dbj|BAD10529.1| putative extensin precursor [Oryza s... 38 0.041
gi|50508930|dbj|BAD31835.1| putative high-affinity potassium tra... 38 0.054
gi|38104377|gb|EAA50954.1| predicted protein [Magnaporthe grisea... 37 0.071
gi|15675795|ref|NP_269969.1| hypothetical protein SPy2009 [Strep... 37 0.071
gi|45552064|ref|NP_788364.2| CG18250-PC [Drosophila melanogaster... 37 0.071
gi|15925493|ref|NP_373027.1| fibronectin-binding protein homolog... 37 0.071
gi|39592740|emb|CAE62354.1| Hypothetical protein CBG06432 [Caeno... 37 0.092
gi|5031925|ref|NP_005798.1| proteoglycan 4; megakaryocyte stimul... 37 0.092
gi|13559026|emb|CAC36090.1| bG174L6.2 (MSF: megakaryocyte stimul... 37 0.092
gi|34880471|ref|XP_213903.2| similar to This gene is isolated by... 37 0.092
gi|15231954|ref|NP_187479.1| expressed protein [Arabidopsis thal... 37 0.12
gi|25408663|pir||H84824 En/Spm-like transposon protein [imported... 37 0.12
gi|25367167|pir||B84869 probable SF16 protein (Helianthus annuus... 37 0.12
gi|38103994|gb|EAA50624.1| hypothetical protein MG04383.4 [Magna... 37 0.12
gi|42571215|ref|NP_973681.1| calmodulin-binding family protein [... 37 0.12
gi|6322209|ref|NP_012284.1| GPI-anchored cell surface glycoprote... 37 0.12
gi|42569785|ref|NP_181536.3| expressed protein [Arabidopsis thal... 37 0.12
gi|30689461|ref|NP_850399.1| calmodulin-binding family protein [... 37 0.12
gi|31204167|ref|XP_311032.1| ENSANGP00000019944 [Anopheles gambi... 36 0.16
gi|31232507|ref|XP_318717.1| ENSANGP00000004655 [Anopheles gambi... 36 0.16
gi|6323205|ref|NP_013277.1| DNA binding protein, homologous to a... 36 0.16
gi|1077406|pir||S51421 hypothetical protein YLR176c - yeast (Sac... 36 0.16
gi|40788894|dbj|BAA11487.2| KIAA0170 [Homo sapiens] 36 0.21
gi|15277229|dbj|BAB63322.1| Homologue to Drosophila photorecepto... 36 0.21
gi|19112060|ref|NP_595268.1| putative histone promoter control p... 36 0.21
gi|49093974|ref|XP_408448.1| hypothetical protein AN4311.2 [Aspe... 36 0.21
gi|42657611|ref|XP_376479.1| mediator of DNA damage checkpoint 1... 36 0.21
gi|27544394|dbj|BAC54931.1| homologue to Drosophila photorecepto... 36 0.21
gi|24639647|ref|NP_726915.1| CG32774-PA [Drosophila melanogaster... 35 0.27
gi|50258388|gb|EAL21077.1| hypothetical protein CNBD4530 [Crypto... 35 0.27
gi|50545139|ref|XP_500107.1| hypothetical protein [Yarrowia lipo... 35 0.27
gi|50556110|ref|XP_505463.1| hypothetical protein [Yarrowia lipo... 35 0.27
gi|469801|emb|CAA83515.1| predicted trithorax protein [Drosophil... 35 0.35
gi|17136558|ref|NP_476770.1| CG8651-PB [Drosophila melanogaster]... 35 0.35
gi|15292119|gb|AAK93328.1| LD39445p [Drosophila melanogaster] 35 0.35
gi|10720314|sp|O08550|TRX2_MOUSE Trithorax homolog 2 (WW domain ... 35 0.35
gi|47203986|emb|CAG14145.1| unnamed protein product [Tetraodon n... 35 0.35
gi|17136556|ref|NP_476769.1| CG8651-PD [Drosophila melanogaster]... 35 0.35
gi|12644002|sp|P20659|TRX_DROME Trithorax protein >gnl|BL_ORD_ID... 35 0.35
gi|48835894|ref|ZP_00292892.1| COG0642: Signal transduction hist... 35 0.35
gi|50555714|ref|XP_505265.1| hypothetical protein [Yarrowia lipo... 35 0.35
gi|158818|gb|AAA29025.1| zinc-binding protein 35 0.35
gi|85160|pir||A35085 trithorax protein - fruit fly (Drosophila m... 35 0.35
gi|25148379|ref|NP_505389.2| GRounDhog, hedgehog-like (grd-6) [C... 35 0.46
gi|50257170|gb|EAL19883.1| hypothetical protein CNBG0260 [Crypto... 35 0.46
gi|29826652|ref|NP_821286.1| hypothetical protein SAV112 [Strept... 35 0.46
gi|37515218|gb|AAA83334.3| Groundhog (hedgehog-like family) prot... 35 0.46
gi|39578750|emb|CAE57157.1| Hypothetical protein CBG25091 [Caeno... 35 0.46
gi|28829317|gb|AAO51859.1| similar to Homo sapiens (Human). Muci... 35 0.46
gi|41529174|dbj|BAD08434.1| NFBD1 [Sus scrofa] 35 0.46
gi|49074320|ref|XP_401302.1| hypothetical protein UM03687.1 [Ust... 35 0.46
gi|22209012|gb|AAC98688.2| surface antigen PHGST#5 [Trypanosoma ... 35 0.46
gi|50545475|ref|XP_500275.1| hypothetical protein [Yarrowia lipo... 35 0.46
gi|50290701|ref|XP_447783.1| unnamed protein product [Candida gl... 35 0.46
gi|7507924|pir||T29695 hypothetical protein T18H9.1 - Caenorhabd... 35 0.46
gi|50311575|ref|XP_455812.1| unnamed protein product [Kluyveromy... 34 0.60
gi|38105982|gb|EAA52344.1| hypothetical protein MG05036.4 [Magna... 34 0.60
gi|7513059|pir||T00365 hypothetical protein KIAA0670 - human (fr... 34 0.60
gi|27529720|dbj|BAA31645.2| KIAA0670 protein [Homo sapiens] 34 0.60
gi|47077384|dbj|BAD18580.1| unnamed protein product [Homo sapiens] 34 0.60
gi|46127731|ref|XP_388419.1| hypothetical protein FG08243.1 [Gib... 34 0.60
gi|48858653|ref|ZP_00312602.1| COG2730: Endoglucanase [Clostridi... 34 0.60
gi|50553410|ref|XP_504116.1| hypothetical protein [Yarrowia lipo... 34 0.60
gi|41400381|gb|AAS07042.1| minus agglutinin [Chlamydomonas reinh... 34 0.60
gi|7662238|ref|NP_055792.1| apoptotic chromatin condensation ind... 34 0.60
gi|41400384|gb|AAS07044.1| plus agglutinin [Chlamydomonas reinha... 34 0.60
gi|22538132|ref|NP_688983.1| cell wall surface anchor family pro... 34 0.60
gi|47900452|gb|AAT39228.1| putative receptor like protein kinase... 34 0.60
gi|32422413|ref|XP_331650.1| hypothetical protein [Neurospora cr... 34 0.78
gi|2129478|pir||S51939 chitinase (EC 3.2.1.14) precursor - beet ... 34 0.78
gi|50550623|ref|XP_502784.1| hypothetical protein [Yarrowia lipo... 34 0.78
gi|108693|pir||A40437 glutamic acid-rich protein, retinal - bovi... 34 0.78
gi|6180203|gb|AAF05845.1| truncated rod photoreceptor cGMP-gated... 34 0.78
gi|39582662|emb|CAE73766.1| Hypothetical protein CBG21308 [Caeno... 34 0.78
gi|24762383|ref|NP_611824.1| CG12491-PA [Drosophila melanogaster... 34 0.78
gi|22026893|ref|NP_611285.2| CG5765-PA [Drosophila melanogaster]... 34 0.78
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 34 0.78
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 34 0.78
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 34 0.78
gi|21392094|gb|AAM48401.1| RE16762p [Drosophila melanogaster] 34 0.78
gi|17137194|ref|NP_477159.1| CG3373-PA [Drosophila melanogaster]... 34 0.78
gi|30794328|ref|NP_851362.1| cyclic nucleotide gated channel bet... 34 0.78
gi|39579415|emb|CAE56721.1| Hypothetical protein CBG24508 [Caeno... 34 0.78
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 34 0.78
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 34 0.78
gi|23305778|gb|AAN17279.1| unknown [Schistosoma mansoni] 34 0.78
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 34 0.78
gi|50284799|ref|XP_444827.1| unnamed protein product [Candida gl... 34 0.78
gi|38077847|ref|XP_354923.1| DNA Segment, Chr 15 Massachusetts I... 34 0.78
gi|4154097|gb|AAD04750.1| unknown [Human herpesvirus 8] 34 0.78
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand... 33 1.0
gi|45825083|gb|AAS77449.1| AT25482p [Drosophila melanogaster] 33 1.0
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand... 33 1.0
gi|9845325|ref|NP_064139.1| pR34 [Rat cytomegalovirus] >gnl|BL_O... 33 1.0
gi|26331204|dbj|BAC29332.1| unnamed protein product [Mus musculus] 33 1.0
gi|34870903|ref|XP_342901.1| similar to sex comb on midleg homol... 33 1.0
gi|28273604|gb|AAO34127.1| obscurin [Rattus norvegicus] 33 1.0
gi|46432987|gb|EAK92446.1| hypothetical protein CaO19.8926 [Cand... 33 1.0
gi|32127786|dbj|BAC78176.1| homologue to Drosophila photorecepto... 33 1.0
gi|34870777|ref|XP_340808.1| similar to obscurin [Rattus norvegi... 33 1.0
gi|40215963|gb|AAR82806.1| GM08848p [Drosophila melanogaster] 33 1.0
gi|38109096|gb|EAA55016.1| hypothetical protein MG06673.4 [Magna... 33 1.0
gi|34393962|dbj|BAC83738.1| hypothetical protein [Oryza sativa (... 33 1.0
gi|48118669|ref|XP_393203.1| similar to RE38148p [Apis mellifera] 33 1.0
gi|39596378|emb|CAE70016.1| Hypothetical protein CBG16430 [Caeno... 33 1.0
gi|34809540|gb|AAQ82693.1| Epa3p [Candida glabrata] 33 1.0
gi|24645663|ref|NP_731472.1| CG12819-PB [Drosophila melanogaster... 33 1.0
gi|24645665|ref|NP_731473.1| CG12819-PA [Drosophila melanogaster... 33 1.0
gi|34533904|dbj|BAC86842.1| unnamed protein product [Homo sapiens] 30 1.0
gi|7446482|pir||S71558 probable cell wall-plasma membrane linker... 33 1.3
gi|21748558|dbj|BAC03416.1| FLJ00353 protein [Homo sapiens] 33 1.3
gi|17221110|gb|AAK61482.1| glycoprotein gp2 [Equine herpesvirus 1] 33 1.3
gi|19551977|ref|NP_599979.1| hypothetical protein NCgl0717 [Cory... 33 1.3
gi|17221106|gb|AAK61480.1| glycoprotein gp2 [Equine herpesvirus 1] 33 1.3
gi|1420865|emb|CAA56616.1| orf1 [Streptococcus pyogenes] 33 1.3
gi|17221098|gb|AAK61476.1| glycoprotein gp2 [Equine herpesvirus 1] 33 1.3
gi|27881703|gb|AAH44636.1| YLPM1 protein [Homo sapiens] 33 1.3
gi|17221104|gb|AAK61479.1| glycoprotein gp2 [Equine herpesvirus 1] 33 1.3
gi|2429362|gb|AAB70928.1| proline rich protein [Santalum album] 33 1.3
gi|30696750|ref|NP_176463.2| invertase/pectin methylesterase inh... 33 1.3
gi|44844160|emb|CAF24826.1| glycoprotein I [Human herpesvirus 1] 33 1.3
gi|11278206|pir||T45463 membrane glycoprotein [imported] - equin... 33 1.3
gi|34865933|ref|XP_343484.1| dystroglycan 1 [Rattus norvegicus] 33 1.3
gi|17221108|gb|AAK61481.1| glycoprotein gp2 [Equine herpesvirus 1] 33 1.3
gi|17221102|gb|AAK61478.1| glycoprotein gp2 [Equine herpesvirus 1] 33 1.3
gi|46432918|gb|EAK92380.1| hypothetical protein CaO19.3384 [Cand... 33 1.3
gi|17221100|gb|AAK61477.1| glycoprotein gp2 [Equine herpesvirus 1] 33 1.3
gi|7512280|pir||T03455 ALR protein - human >gnl|BL_ORD_ID|127332... 33 1.3
gi|17221116|gb|AAK61485.1| glycoprotein gp2 [Equine herpesvirus 1] 33 1.3
gi|1154855|emb|CAA64325.1| ribosomal protein L35a [Homo sapiens] 33 1.3
gi|50313312|ref|YP_053115.1| membrane glycoprotein [Equine herpe... 33 1.3
gi|42795202|gb|AAS45959.1| envelope glycoprotein [Equine herpesv... 33 1.3
gi|4505197|ref|NP_003473.1| myeloid/lymphoid or mixed-lineage le... 33 1.3
gi|46111129|ref|XP_382622.1| hypothetical protein FG02446.1 [Gib... 33 1.3
gi|17221112|gb|AAK61483.1| glycoprotein gp2 [Equine herpesvirus 1] 33 1.3
gi|49077504|ref|XP_402604.1| hypothetical protein UM04989.1 [Ust... 33 1.3
gi|15222149|ref|NP_175372.1| leucine-rich repeat family protein ... 33 1.3
gi|31238311|ref|XP_319745.1| ENSANGP00000006359 [Anopheles gambi... 33 1.3
gi|39592541|emb|CAE63618.1| Hypothetical protein CBG08111 [Caeno... 33 1.3
gi|17221114|gb|AAK61484.1| glycoprotein gp2 [Equine herpesvirus 1] 33 1.3
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens] 33 1.7
gi|7493929|pir||JW0067 chitinase (EC 3.2.1.14) A - Emericella ni... 33 1.7
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p... 33 1.7
gi|38103926|gb|EAA50562.1| hypothetical protein MG04321.4 [Magna... 33 1.7
gi|49087896|ref|XP_405832.1| hypothetical protein AN1695.2 [Aspe... 33 1.7
gi|46437620|gb|EAK96963.1| hypothetical protein CaO19.9736 [Cand... 33 1.7
gi|34875601|ref|XP_237056.2| similar to RW1 protein [Rattus norv... 33 1.7
gi|39597748|emb|CAE68440.1| Hypothetical protein CBG14225 [Caeno... 33 1.7
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ... 33 1.7
gi|24745919|dbj|BAC23043.1| pyruvate decarboxylase [Solanum tube... 33 1.7
gi|15215308|gb|AAH12740.1| Dystroglycan 1, precursor [Homo sapie... 33 1.7
gi|4758116|ref|NP_004384.1| dystroglycan 1 precursor; 156DAG; Dy... 33 1.7
gi|15222649|ref|NP_173940.1| protein kinase family protein [Arab... 33 1.7
gi|34809534|gb|AAQ82688.1| Epa4p [Candida glabrata] 33 1.7
gi|50254433|gb|EAL17182.1| hypothetical protein CNBN0110 [Crypto... 33 1.7
gi|46439060|gb|EAK98382.1| hypothetical protein CaO19.488 [Candi... 33 1.7
gi|20521149|dbj|BAA34474.2| KIAA0754 protein [Homo sapiens] 33 1.7
gi|24644030|ref|NP_649481.1| CG12586-PA [Drosophila melanogaster... 33 1.7
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|... 33 1.7
gi|50548313|ref|XP_501626.1| hypothetical protein [Yarrowia lipo... 33 1.7
gi|19527573|gb|AAL89901.1| RE37683p [Drosophila melanogaster] 33 1.7
gi|38105342|gb|EAA51783.1| hypothetical protein MG03378.4 [Magna... 33 1.7
gi|2276127|dbj|BAA21556.1| hepatitis A virus receptor [Cercopith... 33 1.7
gi|6324372|ref|NP_014442.1| Anchorage subunit of a-agglutinin of... 33 1.7
gi|34870936|ref|XP_220602.2| similar to zinc-finger helicase [Ra... 33 1.7
gi|4996369|dbj|BAA78427.1| polyprotein [Arabidopsis thaliana] 33 1.7
gi|100753|pir||S13383 hydroxyproline-rich glycoprotein - sorghum... 33 1.7
gi|49120840|ref|XP_412378.1| hypothetical protein AN8241.2 [Aspe... 33 1.7
gi|50746439|ref|XP_420498.1| PREDICTED: similar to nephronectin ... 33 1.7
gi|50748756|ref|XP_421392.1| PREDICTED: similar to Protein phosp... 33 1.7
gi|46164799|ref|ZP_00205189.1| hypothetical protein Paer021937 [... 32 2.3
gi|31540435|ref|NP_852703.1| DNA binding protein [Human adenovir... 32 2.3
gi|37048692|gb|AAQ84882.1| methuselah-like protein MTH-2 [Caenor... 32 2.3
gi|49072598|ref|XP_400588.1| predicted protein [Ustilago maydis ... 32 2.3
gi|32564127|ref|NP_494738.2| GPS domain containing protein (2E48... 32 2.3
gi|38492189|gb|AAR22399.1| antigenic cell wall protein MP2 [Aspe... 32 2.3
gi|2924287|emb|CAA60031.1| Dystroglycan [Mus musculus] 32 2.3
gi|25484567|pir||S59630 dystroglycan alpha precursor - mouse (fr... 32 2.3
gi|26343839|dbj|BAC35576.1| unnamed protein product [Mus musculus] 32 2.3
gi|33859532|ref|NP_034147.1| dystroglycan 1; dystrophin associat... 32 2.3
gi|42569297|ref|NP_180077.3| formin homology 2 domain-containing... 32 2.3
gi|28828844|gb|AAO51439.1| similar to Homo sapiens (Human). Muci... 32 2.3
gi|6562362|emb|CAB62568.1| dystroglycan [Canis familiaris] 32 2.3
gi|24583848|ref|NP_609552.1| CG17211-PA [Drosophila melanogaster... 32 2.3
gi|39579245|emb|CAE56975.1| Hypothetical protein CBG24828 [Caeno... 32 2.3
gi|39594556|emb|CAE72134.1| Hypothetical protein CBG19232 [Caeno... 32 2.3
gi|50748672|ref|XP_421354.1| PREDICTED: similar to zinc finger p... 32 2.3
gi|46110333|ref|XP_382224.1| hypothetical protein FG02048.1 [Gib... 32 2.3
gi|17566006|ref|NP_505150.1| putative protein (5I806) [Caenorhab... 32 2.3
gi|28828569|gb|AAO51173.1| similar to Dictyostelium discoideum (... 32 2.3
gi|38105465|gb|EAA51886.1| hypothetical protein MG03481.4 [Magna... 32 2.3
gi|47218675|emb|CAG12399.1| unnamed protein product [Tetraodon n... 32 2.3
gi|25412275|pir||F84643 hypothetical protein At2g25050 [imported... 32 2.3
gi|46108184|ref|XP_381150.1| hypothetical protein FG00974.1 [Gib... 32 2.3
gi|11278205|pir||T45462 membrane glycoprotein [imported] - equin... 32 2.3
gi|38105285|gb|EAA51728.1| hypothetical protein MG03323.4 [Magna... 32 2.3
gi|15599517|ref|NP_253011.1| hypothetical protein [Pseudomonas a... 32 2.3
gi|39579121|emb|CAE56545.1| Hypothetical protein CBG24276 [Caeno... 32 2.3
gi|3068553|gb|AAC14361.1| glycoprotein Ib [Canis familiaris] 32 2.3
gi|15232289|ref|NP_191587.1| uclacyanin 3 (UCC3) [Arabidopsis th... 32 2.3
gi|46576017|gb|AAT01378.1| unknown protein [Oryza sativa (japoni... 32 3.0
gi|46395989|sp|Q9H1U4|EFL5_HUMAN Multiple EGF-like-domain protei... 32 3.0
gi|47227297|emb|CAF96846.1| unnamed protein product [Tetraodon n... 32 3.0
gi|27820082|gb|AAO25067.1| GH08772p [Drosophila melanogaster] 32 3.0
gi|34915272|ref|NP_919093.1| DNA binding protein-like [Oryza sat... 32 3.0
gi|17230166|ref|NP_486714.1| ferrichrome-iron receptor [Nostoc s... 32 3.0
gi|49076938|ref|XP_402389.1| hypothetical protein UM04774.1 [Ust... 32 3.0
gi|20521788|dbj|BAA86501.2| KIAA1187 protein [Homo sapiens] 32 3.0
gi|6683068|dbj|BAA89014.1| Pf-Dlx [Ptychodera flava] 32 3.0
gi|37181865|gb|AAQ88736.1| EGFL5 [Homo sapiens] 32 3.0
gi|49487279|ref|YP_044500.1| fibronectin-binding protein precurs... 32 3.0
gi|17944206|gb|AAL47998.1| GM03761p [Drosophila melanogaster] 32 3.0
gi|46122573|ref|XP_385840.1| hypothetical protein FG05664.1 [Gib... 32 3.0
gi|21284150|ref|NP_647238.1| ORFID:MW2421~fibronectin-binding pr... 32 3.0
gi|21703910|ref|NP_663433.1| CG8726-like [Mus musculus] >gnl|BL_... 32 3.0
gi|17384256|emb|CAC83675.1| mucin 5 [Homo sapiens] 32 3.0
gi|49094882|ref|XP_408902.1| hypothetical protein AN4765.2 [Aspe... 32 3.0
gi|46125707|ref|XP_387407.1| hypothetical protein FG07231.1 [Gib... 32 3.0
gi|50427481|ref|XP_462353.1| unnamed protein product [Debaryomyc... 32 3.0
gi|28571918|ref|NP_788757.1| CG1658-PD [Drosophila melanogaster]... 32 3.0
gi|50287101|ref|XP_445980.1| unnamed protein product [Candida gl... 32 3.0
gi|2961494|gb|AAC41262.1| transcription factor [Takifugu rubripes] 32 3.0
gi|46441631|gb|EAL00927.1| hypothetical protein CaO19.14112 [Can... 32 3.9
gi|42659772|ref|XP_169227.2| similar to proline rich antigen 2 [... 32 3.9
gi|34868150|ref|XP_343327.1| similar to myeloid/lymphoid or mixe... 32 3.9
gi|30691615|ref|NP_195502.2| zinc finger (C3HC4-type RING finger... 32 3.9
gi|46397868|sp|Q8BGT6|MI13_MOUSE Molecule interacting with Rab13... 32 3.9
gi|26345642|dbj|BAC36472.1| unnamed protein product [Mus musculu... 32 3.9
gi|26449697|dbj|BAC41972.1| unknown protein [Arabidopsis thalian... 32 3.9
gi|39580295|emb|CAE56030.1| Hypothetical protein CBG23593 [Caeno... 32 3.9
gi|39590304|emb|CAE66043.1| Hypothetical protein CBG11242 [Caeno... 32 3.9
gi|45332244|gb|AAS58046.1| thrombospondin-related anonymous prot... 32 3.9
gi|9759597|dbj|BAB11454.1| unnamed protein product [Arabidopsis ... 32 3.9
gi|39590335|emb|CAE66074.1| Hypothetical protein CBG11288 [Caeno... 32 3.9
gi|38111677|gb|EAA57217.1| hypothetical protein MG08186.4 [Magna... 32 3.9
gi|44844178|emb|CAF24835.1| glycoprotein I [Human herpesvirus 1] 32 3.9
gi|44844134|emb|CAF24814.1| glycoprotein I [Human herpesvirus 1]... 32 3.9
gi|7485841|pir||T05616 hypothetical protein F20D10.10 - Arabidop... 32 3.9
gi|24652700|ref|NP_610672.1| CG13209-PA [Drosophila melanogaster... 32 3.9
gi|38074513|ref|XP_127323.2| RIKEN cDNA 1810073P09 [Mus musculus] 32 3.9
gi|44844152|emb|CAF24822.1| glycoprotein I [Human herpesvirus 1] 32 3.9
gi|44844186|emb|CAF24839.1| glycoprotein I [Human herpesvirus 1] 32 3.9
gi|6466801|gb|AAF13032.1| intestinal mucin 3 [Homo sapiens] 32 3.9
gi|112670|sp|P15711|104K_THEPA 104 KD MICRONEME-RHOPTRY ANTIGEN ... 32 3.9
gi|48836695|ref|ZP_00293691.1| COG0642: Signal transduction hist... 32 3.9
gi|4505285|ref|NP_002448.1| mucin 2 [Homo sapiens] >gnl|BL_ORD_I... 32 3.9
gi|46105392|ref|XP_380500.1| hypothetical protein FG00324.1 [Gib... 32 3.9
gi|8163672|gb|AAF73794.1| surface protein PspC [Streptococcus pn... 32 3.9
gi|13592175|gb|AAK31375.1| ppg3 [Leishmania major] 32 3.9
gi|584043|emb|CAA83860.1| G [Human respiratory syncytial virus] 32 3.9
gi|584038|emb|CAA83878.1| G [Human respiratory syncytial virus] 32 3.9
gi|48833363|ref|ZP_00290383.1| hypothetical protein Mmc102001083... 32 3.9
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno... 32 3.9
gi|2135765|pir||A43932 mucin 2 precursor, intestinal - human (fr... 32 3.9
gi|2853301|gb|AAC02272.1| mucin [Homo sapiens] 32 3.9
gi|50549423|ref|XP_502182.1| hypothetical protein [Yarrowia lipo... 32 3.9
gi|46138641|ref|XP_391011.1| hypothetical protein FG10835.1 [Gib... 32 3.9
gi|46124703|ref|XP_386905.1| hypothetical protein FG06729.1 [Gib... 32 3.9
gi|186396|gb|AAA59163.1| mucin 32 3.9
gi|50287103|ref|XP_445981.1| unnamed protein product [Candida gl... 32 3.9
gi|39937819|ref|NP_950095.1| conserved hypothetical protein [Rho... 32 3.9
gi|28386091|gb|AAH46464.1| 1810073P09Rik protein [Mus musculus] 32 3.9
gi|1280434|gb|AAC47118.1| hemomucin 32 3.9
gi|31211701|ref|XP_314820.1| ENSANGP00000005139 [Anopheles gambi... 32 3.9
gi|21749331|dbj|BAC03574.1| unnamed protein product [Homo sapiens] 32 3.9
gi|37994554|gb|AAH60187.1| 1810073P09Rik protein [Mus musculus] 32 3.9
gi|46805696|dbj|BAD17097.1| putative Blue copper protein precurs... 32 3.9
gi|38232690|ref|NP_938457.1| probable serine/threonine-protein k... 32 3.9
gi|21703974|ref|NP_663470.1| Ras and Rab interactor 1 [Mus muscu... 32 3.9
gi|49072000|ref|XP_400289.1| hypothetical protein UM02674.1 [Ust... 32 3.9
gi|33243412|gb|AAQ01368.1| glycoprotein [Human metapneumovirus] 32 3.9
gi|30691621|ref|NP_849514.1| zinc finger (C3HC4-type RING finger... 32 3.9
gi|37360542|dbj|BAC98249.1| mKIAA1760 protein [Mus musculus] 32 3.9
gi|37360502|dbj|BAC98229.1| mKIAA1668 protein [Mus musculus] 32 3.9
gi|9545989|gb|AAF88146.1| Mud protein [Drosophila melanogaster] 32 3.9
gi|44844182|emb|CAF24837.1| glycoprotein I [Human herpesvirus 1] 32 3.9
gi|20138131|sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1... 32 3.9
gi|31711510|gb|AAN78098.1| PC10A [Plasmodium chabaudi chabaudi] 32 3.9
gi|50754169|ref|XP_414269.1| PREDICTED: similar to alpha dystrog... 32 3.9
gi|38078180|ref|XP_354929.1| similar to myeloid/lymphoid or mixe... 32 3.9
gi|42632365|gb|AAS22105.1| attachment glycoprotein [Human metapn... 31 5.1
gi|49119281|gb|AAH73328.1| XNopp180 protein [Xenopus laevis] 31 5.1
gi|7444420|pir||T01397 LTR gag/pol polyprotein homolog T4I9.16 -... 31 5.1
gi|22507337|ref|NP_683734.1| nuclear pore membrane protein 121 [... 31 5.1
gi|50255354|gb|EAL18089.1| hypothetical protein CNBK1100 [Crypto... 31 5.1
gi|47219799|emb|CAG03426.1| unnamed protein product [Tetraodon n... 31 5.1
gi|50257403|gb|EAL20112.1| hypothetical protein CNBF4380 [Crypto... 31 5.1
gi|47213296|emb|CAG12378.1| unnamed protein product [Tetraodon n... 31 5.1
gi|32967039|gb|AAP92353.1| DNA binding protein [Human adenovirus... 31 5.1
gi|11967898|emb|CAC19493.1| nematicidal protein 2 [Xenorhabdus b... 31 5.1
gi|172526|gb|AAA35015.1| S1 protein 31 5.1
gi|21954552|dbj|BAC06345.1| gamete and mating-type specific prot... 31 5.1
gi|38078847|ref|XP_357389.1| similar to hypothetical protein FLJ... 31 5.1
gi|7494069|pir||S20075 promastigote surface antigen P2 (clone 2.... 31 5.1
gi|50510549|dbj|BAD32260.1| mKIAA0618 protein [Mus musculus] 31 5.1
gi|49067126|ref|XP_397853.1| hypothetical protein UM00238.1 [Ust... 31 5.1
gi|32405586|ref|XP_323406.1| hypothetical protein [Neurospora cr... 31 5.1
gi|47217029|emb|CAG01657.1| unnamed protein product [Tetraodon n... 31 5.1
gi|7499479|pir||T21138 hypothetical protein F20C5.1 - Caenorhabd... 31 5.1
gi|14141974|ref|NP_115455.1| putative movement protein [Maize ra... 31 5.1
gi|28143942|gb|AAO26316.1| poly ADP-ribose metabolism enzyme-3 l... 31 5.1
gi|41052930|dbj|BAD07841.1| hypothetical protein [Oryza sativa (... 31 5.1
gi|29827695|ref|NP_822329.1| hypothetical protein SAV1154 [Strep... 31 5.1
gi|15839196|ref|NP_299884.1| ribonuclease E [Xylella fastidiosa ... 31 5.1
gi|28422180|gb|AAH46866.1| B230399n07-prov protein [Xenopus laevis] 31 5.1
gi|27806449|ref|NP_776587.1| RAB7, member RAS oncogene family [B... 31 5.1
gi|2134123|pir||I51618 nucleolar phosphoprotein - African clawed... 31 5.1
gi|21913144|gb|AAK84946.1| transcriptional activator Mut3p [Pich... 31 5.1
gi|39937027|ref|NP_949303.1| hypothetical protein RPA3966 [Rhodo... 31 5.1
gi|46365161|ref|ZP_00227672.1| COG1123: ATPase components of var... 31 5.1
gi|29251297|gb|EAA42780.1| GLP_81_193899_193471 [Giardia lamblia... 31 5.1
gi|4996363|dbj|BAA78424.1| polyprotein [Arabidopsis thaliana] 31 5.1
gi|37359812|dbj|BAC97884.1| mKIAA0170 protein [Mus musculus] 31 5.1
gi|46107518|ref|XP_380818.1| hypothetical protein FG00642.1 [Gib... 31 5.1
gi|5420387|emb|CAB46679.1| proteophosphoglycan [Leishmania major] 31 5.1
gi|4996367|dbj|BAA78426.1| polyprotein [Arabidopsis thaliana] 31 5.1
gi|17402521|dbj|BAB78732.1| dextranase [Streptococcus downei] 31 5.1
gi|32028643|ref|ZP_00131799.1| COG5295: Autotransporter adhesin ... 31 5.1
gi|50548263|ref|XP_501601.1| hypothetical protein [Yarrowia lipo... 31 5.1
gi|1082604|pir||S53363 mucin 5AC (clone JER58) - human (fragment... 31 5.1
gi|47223531|emb|CAF98018.1| unnamed protein product [Tetraodon n... 31 5.1
gi|114941|sp|P06219|BGAL_KLEPN BETA-GALACTOSIDASE (LACTASE) >gnl... 31 5.1
gi|23105033|ref|ZP_00091491.1| hypothetical protein [Azotobacter... 31 5.1
gi|35670781|gb|AAN17478.1| DNA-binding protein [Human adenovirus... 31 5.1
gi|50256825|gb|EAL19543.1| hypothetical protein CNBG1720 [Crypto... 31 5.1
gi|37962894|gb|AAR05801.1| ICHIT [Anopheles gambiae] 31 5.1
gi|16198344|gb|AAF89163.2| Mud protein [Drosophila melanogaster] 31 5.1
gi|49092838|ref|XP_407880.1| hypothetical protein AN3743.2 [Aspe... 31 5.1
gi|20128875|ref|NP_569927.1| CG14796-PA [Drosophila melanogaster... 31 5.1
gi|32566024|ref|NP_501508.2| poly ADP-ribose Metabolism Enzyme (... 31 5.1
gi|119713|sp|P24152|EXTN_SORBI Extensin precursor (Proline-rich ... 31 5.1
gi|49081142|ref|XP_404011.1| hypothetical protein UM06396.1 [Ust... 31 5.1
gi|28972614|dbj|BAC65723.1| mKIAA1096 protein [Mus musculus] 31 5.1
gi|27370871|gb|AAH41236.1| XNopp180 protein [Xenopus laevis] 31 5.1
gi|50760019|ref|XP_417865.1| PREDICTED: similar to Rho GTPase-ac... 31 5.1
gi|31418614|gb|AAH53101.1| Nuclear pore membrane protein 121 [Mu... 31 5.1
gi|33243414|gb|AAQ01369.1| glycoprotein [Human metapneumovirus] 31 5.1
gi|97812|pir||A32192 fibronectin-binding protein - Staphylococcu... 31 5.1
gi|120457|sp|P14738|FNBA_STAAU Fibronectin-binding protein precu... 31 5.1
gi|44889881|gb|AAS48468.1| attachment glycoprotein [Human metapn... 31 6.6
gi|44889919|gb|AAS48487.1| attachment glycoprotein [Human metapn... 31 6.6
gi|39583566|emb|CAE65670.1| Hypothetical protein CBG10736 [Caeno... 31 6.6
gi|49081014|ref|XP_403961.1| hypothetical protein UM06346.1 [Ust... 31 6.6
gi|47214483|emb|CAG12488.1| unnamed protein product [Tetraodon n... 31 6.6
gi|50511109|dbj|BAD32540.1| mKIAA1783 protein [Mus musculus] 31 6.6
gi|188864|gb|AAA59875.1| mucin 31 6.6
gi|48781795|ref|ZP_00278377.1| hypothetical protein Bcep02006945... 31 6.6
gi|111978|pir||S24169 mucin - rat 31 6.6
gi|38091968|ref|XP_354650.1| similar to KIAA1783 protein [Mus mu... 31 6.6
gi|34911862|ref|NP_917278.1| pherophorin - like protein [Oryza s... 31 6.6
gi|46434432|gb|EAK93842.1| hypothetical protein CaO19.8907 [Cand... 31 6.6
gi|46434465|gb|EAK93874.1| hypothetical protein CaO19.1327 [Cand... 31 6.6
gi|27881486|ref|NP_775078.1| zonadhesin isoform 1 [Homo sapiens]... 31 6.6
gi|15721995|gb|AAL04410.1| zonadhesin splice variant 1 [Homo sap... 31 6.6
gi|27881494|ref|NP_775082.1| zonadhesin isoform 6 [Homo sapiens]... 31 6.6
gi|15721998|gb|AAL04413.1| zonadhesin splice variant 6 [Homo sap... 31 6.6
gi|50291887|ref|XP_448376.1| unnamed protein product [Candida gl... 31 6.6
gi|24664998|ref|NP_648831.1| CG13075-PA [Drosophila melanogaster... 31 6.6
gi|22095027|ref|NP_038911.1| sex comb on midleg homolog 1; sex c... 31 6.6
gi|17543234|ref|NP_501173.1| putative protein (4I100) [Caenorhab... 31 6.6
gi|49124753|ref|XP_412621.1| hypothetical protein AN8484.2 [Aspe... 31 6.6
gi|32410967|ref|XP_325964.1| predicted protein [Neurospora crass... 31 6.6
gi|7018420|emb|CAB59245.2| hypothetical protein [Homo sapiens] 31 6.6
gi|11360318|pir||T43481 probable mucin DKFZp434C196.1 - human (f... 31 6.6
gi|3220006|sp|P16952|SSP5_STRGN Agglutinin receptor precursor (S... 31 6.6
gi|15722000|gb|AAL04415.1| zonadhesin splice variant 2 [Homo sap... 31 6.6
gi|39585491|emb|CAE70574.1| Hypothetical protein CBG17230 [Caeno... 31 6.6
gi|27881488|ref|NP_775079.1| zonadhesin isoform 2 [Homo sapiens]... 31 6.6
gi|46123837|ref|XP_386472.1| hypothetical protein FG06296.1 [Gib... 31 6.6
gi|21961378|gb|AAH34667.1| Scmh1 protein [Mus musculus] 31 6.6
gi|97885|pir||A35186 salivary agglutinin receptor precursor - St... 31 6.6
gi|50256056|gb|EAL18783.1| hypothetical protein CNBI0440 [Crypto... 31 6.6
gi|16120265|ref|NP_395853.1| Vng6368h [Halobacterium sp. NRC-1] ... 31 6.6
gi|41208907|ref|XP_372740.1| similar to ENSANGP00000004655 [Homo... 31 6.6
gi|725477|gb|AAA63914.1| merozoite surface antigen 2 [Plasmodium... 31 6.6
gi|5911959|emb|CAB55954.1| hypothetical protein [Homo sapiens] 31 6.6
gi|30425518|ref|NP_848648.1| hypothetical protein MGC44505 [Homo... 31 6.6
gi|46444373|gb|EAL03648.1| hypothetical protein CaO19.9067 [Cand... 31 6.6
gi|13811951|ref|NP_113079.1| 60S ribosomal protein 35A [Guillard... 31 6.6
gi|16554449|ref|NP_003377.1| zonadhesin isoform 3 [Homo sapiens]... 31 6.6
gi|27924006|sp|Q9Y493|ZAN_HUMAN Zonadhesin precursor >gnl|BL_ORD... 31 6.6
gi|46127847|ref|XP_388477.1| hypothetical protein FG08301.1 [Gib... 31 6.6
gi|33241834|ref|NP_876775.1| hypothetical protein [Chlamydophila... 31 6.6
gi|16752560|ref|NP_444822.1| hypothetical protein [Chlamydophila... 31 6.6
gi|27881492|ref|NP_775081.1| zonadhesin isoform 5 [Homo sapiens]... 31 6.6
gi|31204643|ref|XP_311270.1| ENSANGP00000017524 [Anopheles gambi... 31 6.6
gi|9963982|gb|AAG09787.1| repressed by TUP1 protein 1; Rbt1p [Ca... 31 6.6
gi|15721997|gb|AAL04412.1| zonadhesin splice variant 5 [Homo sap... 31 6.6
gi|46445432|gb|EAL04701.1| hypothetical protein CaO19.12372 [Can... 31 6.6
gi|27881490|ref|NP_775080.1| zonadhesin isoform 4 [Homo sapiens]... 31 6.6
gi|15721999|gb|AAL04414.1| zonadhesin splice variant 4 [Homo sap... 31 6.6
gi|46431905|gb|EAK91424.1| hypothetical protein CaO19.9168 [Cand... 31 6.6
gi|19112055|ref|NP_595263.1| hypothetical protein [Schizosacchar... 31 6.6
gi|32419393|ref|XP_330140.1| hypothetical protein [Neurospora cr... 31 6.6
gi|31543259|ref|NP_034943.2| max binding protein [Mus musculus] ... 31 6.6
gi|1841930|emb|CAA68878.1| ROX protein [Mus musculus] >gnl|BL_OR... 31 6.6
gi|422832|pir||B46629 mucin 6, gastric (3-repeat clone) - human ... 31 6.6
gi|45199230|ref|NP_986259.1| AFR711Cp [Eremothecium gossypii] >g... 31 6.6
gi|34909284|ref|NP_915989.1| P0454H12.25 [Oryza sativa (japonica... 31 6.6
gi|38106248|gb|EAA52581.1| hypothetical protein MG05273.4 [Magna... 31 6.6
gi|24641527|ref|NP_572797.1| CG11245-PA [Drosophila melanogaster... 31 6.6
gi|15618394|ref|NP_224679.1| hypothetical protein [Chlamydophila... 31 6.6
gi|15836014|ref|NP_300538.1| hypothetical protein [Chlamydophila... 31 6.6
gi|46362996|ref|ZP_00225794.1| hypothetical protein Krad06004438... 31 6.6
gi|24647644|ref|NP_650611.1| CG4090-PA [Drosophila melanogaster]... 31 6.6
gi|42572181|ref|NP_974181.1| DNA repair protein RAD23, putative ... 30 8.7
gi|46432914|gb|EAK92376.1| hypothetical protein CaO19.3380 [Cand... 30 8.7
gi|50747896|ref|XP_421035.1| PREDICTED: similar to Mucin 2 precu... 30 8.7
gi|18568263|gb|AAL75995.1| ornithine carbamoyltransferase [Zea m... 30 8.7
gi|2497729|sp|Q49537|VLPE_MYCHR Variant surface antigen E precur... 30 8.7
gi|15805485|ref|NP_294181.1| hypothetical protein [Deinococcus r... 30 8.7
gi|50288747|ref|XP_446803.1| unnamed protein product [Candida gl... 30 8.7
>gi|17535695|ref|NP_495468.1| ribosomal Protein, Large subunit (13.8
kD) (rpl-33) [Caenorhabditis elegans]
gi|1350742|sp|P49180|R35A_CAEEL 60S ribosomal protein L35a
gi|7498835|pir||T34207 ribosomal protein L35a - Caenorhabditis
elegans
gi|1086831|gb|AAA82422.1| Ribosomal protein, large subunit protein
33 [Caenorhabditis elegans]
Length = 124
Score = 253 bits (646), Expect = 6e-67
Identities = 124/124 (100%), Positives = 124/124 (100%)
Frame = +1
Query: 1 MADTAVARRPSAPTTGRLYVKAIFTGFKRGLRTQSEHTSLLKLEGVFNKEDAGFYAGKRV 180
MADTAVARRPSAPTTGRLYVKAIFTGFKRGLRTQSEHTSLLKLEGVFNKEDAGFYAGKRV
Sbjct: 1 MADTAVARRPSAPTTGRLYVKAIFTGFKRGLRTQSEHTSLLKLEGVFNKEDAGFYAGKRV 60
Query: 181 VYLYKAHNKTLKTGHTVATRTRAIWGKITRPHGNAGAVRAKFHHNIPPSALGKRIRVLLY 360
VYLYKAHNKTLKTGHTVATRTRAIWGKITRPHGNAGAVRAKFHHNIPPSALGKRIRVLLY
Sbjct: 61 VYLYKAHNKTLKTGHTVATRTRAIWGKITRPHGNAGAVRAKFHHNIPPSALGKRIRVLLY 120
Query: 361 PSNI 372
PSNI
Sbjct: 121 PSNI 124