Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F10G7_8
         (2745 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17533087|ref|NP_494839.1| domain protein (100.8 kD) (2E999) [...  1602   0.0
gi|39583106|emb|CAE60646.1| Hypothetical protein CBG04292 [Caeno...  1422   0.0
gi|50511303|dbj|BAD32626.1| 4SNc-Tudor domain protein [Takifugu ...   700   0.0
gi|45429977|ref|NP_991353.1| 100 kDa coactivator [Bos taurus] >g...   695   0.0
gi|32879913|gb|AAP88787.1| EBNA-2 co-activator (100kD) [Homo sap...   694   0.0
gi|26352950|dbj|BAC40105.1| unnamed protein product [Mus musculus]    693   0.0
gi|50511304|dbj|BAD32627.1| 4SNc-Tudor domain protein [Takifugu ...   692   0.0
gi|28175411|gb|AAH45115.1| MGC53332 protein [Xenopus laevis]          692   0.0
gi|27697028|gb|AAH43884.1| 2e999-prov protein [Xenopus laevis]        687   0.0
gi|33869218|gb|AAH17180.2| Staphylococcal nuclease domain contai...   686   0.0
gi|7657431|ref|NP_055205.1| staphylococcal nuclease domain conta...   685   0.0
gi|37514837|gb|AAH07126.2| Snd1-pending protein [Mus musculus]        684   0.0
gi|47939011|gb|AAH72471.1| Unknown (protein for MGC:91679) [Ratt...   684   0.0
gi|9790067|ref|NP_062750.1| staphylococcal nuclease domain conta...   683   0.0
gi|33504513|ref|NP_878285.1| staphylococcal nuclease domain cont...   681   0.0
gi|45361211|ref|NP_989183.1| hypothetical protein MGC76153 [Xeno...   681   0.0
gi|20130403|ref|NP_612021.1| CG7008-PA [Drosophila melanogaster]...   681   0.0
gi|50417388|gb|AAH77133.1| Staphylococcal nuclease domain contai...   679   0.0
gi|28849222|dbj|BAC65164.1| 4SNc-Tudor domain protein [Seriola q...   672   0.0
gi|28372320|dbj|BAC56985.1| 4SNc-Tudor domain protein [Danio rer...   665   0.0
gi|30844237|dbj|BAC76713.1| 4SNc-Tudor domain protein short form...   657   0.0
gi|31213491|ref|XP_315689.1| ENSANGP00000021797 [Anopheles gambi...   653   0.0
gi|12083649|ref|NP_073185.1| p105 coactivator [Rattus norvegicus...   644   0.0
gi|16660153|gb|AAL27548.1| transcriptional coactivator p100 [Gal...   534   e-150
gi|47218375|emb|CAG01896.1| unnamed protein product [Tetraodon n...   507   e-142
gi|41015990|dbj|BAD07399.1| 4SNc-Tudor protein [Seriola quinquer...   506   e-141
gi|29727037|gb|AAN76663.2| P100-like protein short variant [Dani...   467   e-130
gi|17862058|gb|AAL39506.1| LD06532p [Drosophila melanogaster]         358   3e-97
gi|49084348|ref|XP_404379.1| hypothetical protein AN0242.2 [Aspe...   339   2e-91
gi|32492578|gb|AAP85377.1| RNA binding protein Rp120 [Oryza sati...   338   4e-91
gi|50259785|gb|EAL22453.1| hypothetical protein CNBB3320 [Crypto...   338   5e-91
gi|15240352|ref|NP_200986.1| tudor domain-containing protein / n...   337   9e-91
gi|49388258|dbj|BAD25376.1| RNA binding protein Rp120 [Oryza sat...   337   9e-91
gi|22326646|ref|NP_196352.2| tudor domain-containing protein / n...   336   2e-90
gi|11358274|pir||T49874 hypothetical protein T2I1.60 - Arabidops...   330   1e-88
gi|21929220|dbj|BAC06184.1| 110 kDa 4SNc-Tudor domain protein [P...   330   1e-88
gi|49070600|ref|XP_399589.1| hypothetical protein UM01974.1 [Ust...   330   1e-88
gi|46128689|ref|XP_388898.1| hypothetical protein FG08722.1 [Gib...   314   8e-84
gi|32417692|ref|XP_329324.1| hypothetical protein [Neurospora cr...   308   3e-82
gi|3135013|emb|CAA06786.1| 100 kDa protein [Ajellomyces capsulatus]   308   6e-82
gi|21740629|emb|CAD40787.1| OSJNBb0012E08.11 [Oryza sativa (japo...   253   1e-65
gi|19075617|ref|NP_588117.1| putative transcription factor [Schi...   243   2e-62
gi|13111324|dbj|BAB32793.1| 110 kDa 4SNc-Tudor domain protein [P...   238   6e-61
gi|50545872|ref|XP_500474.1| hypothetical protein [Yarrowia lipo...   226   3e-57
gi|46438131|gb|EAK97467.1| hypothetical protein CaO19.7328 [Cand...   206   3e-51
gi|50405623|ref|XP_456448.1| unnamed protein product [Debaryomyc...   198   7e-49
gi|47218373|emb|CAG01894.1| unnamed protein product [Tetraodon n...   167   1e-39
gi|21929218|dbj|BAC06183.1| 110kDa protein HMP [Pisum sativum]        151   9e-35
gi|28839773|gb|AAH47835.1| Snd1 protein [Danio rerio]                 102   6e-20
gi|29249274|gb|EAA40789.1| GLP_29_16343_19180 [Giardia lamblia A...    94   2e-17
gi|48096440|ref|XP_392455.1| similar to Hypothetical protein CBG...    86   5e-15
gi|23485654|gb|EAA20519.1| Unknown protein [Plasmodium yoelii yo...    84   2e-14
gi|50405099|ref|YP_054191.1| Transcription factor, Tudor domain,...    80   2e-13
gi|50749817|ref|XP_421768.1| PREDICTED: similar to tudor domain ...    62   6e-08
gi|23508565|ref|NP_701234.1| hypothetical protein [Plasmodium fa...    62   1e-07
gi|38505161|ref|NP_942090.1| tudor domain containing 1; tudor do...    59   5e-07
gi|10437099|dbj|BAB14982.1| unnamed protein product [Homo sapiens]     59   5e-07
gi|17368689|sp|Q9BXT4|TDR1_HUMAN Tudor domain containing protein...    59   5e-07
gi|50745340|ref|XP_426227.1| PREDICTED: similar to tudor domain ...    59   8e-07
gi|34858027|ref|XP_227438.2| similar to hypothetical protein [Ra...    57   2e-06
gi|50251160|dbj|BAD27578.1| tudor domain containing 1 protein [M...    56   4e-06
gi|13878217|ref|NP_113564.1| tudor domain containing 1 isoform 4...    56   4e-06
gi|50355696|ref|NP_001002238.1| tudor domain containing 1 isofor...    56   4e-06
gi|26325742|dbj|BAC26625.1| unnamed protein product [Mus musculus]     56   4e-06
gi|136475|sp|P25823|TUD_DROME Maternal tudor protein >gnl|BL_ORD...    56   4e-06
gi|17136560|ref|NP_476773.1| CG9450-PA [Drosophila melanogaster]...    56   4e-06
gi|14602443|ref|NP_113602.2| serine/threonine kinase 31 isoform ...    55   7e-06
gi|17368698|sp|Q9BXU1|ST31_HUMAN Serine/threonine-protein kinase...    55   7e-06
gi|13272526|gb|AAK17193.1| protein kinase NYD-SPK [Homo sapiens]       55   7e-06
gi|14602445|ref|NP_116562.1| serine/threonine kinase 31 isoform ...    55   7e-06
gi|50732694|ref|XP_418720.1| PREDICTED: similar to serine/threon...    55   9e-06
gi|34784958|gb|AAH57030.1| Tdrkh protein [Mus musculus]                55   9e-06
gi|38077873|ref|XP_131021.3| RIKEN cDNA 2700091C21 [Mus musculus...    55   9e-06
gi|34864564|ref|XP_217641.2| similar to tudor repeat protein [Ra...    55   9e-06
gi|37747870|gb|AAH59374.1| Serine/threonine kinase 31, isoform a...    55   1e-05
gi|16552896|dbj|BAB71405.1| unnamed protein product [Homo sapiens]     55   1e-05
gi|38648822|gb|AAH63133.1| TDRD1 protein [Homo sapiens]                53   3e-05
gi|16041180|dbj|BAB69757.1| hypothetical protein [Macaca fascicu...    53   4e-05
gi|7109258|gb|AAF36701.1| tudor and KH domain-containing protein...    53   4e-05
gi|21595812|gb|AAH32690.1| TDRKH protein [Homo sapiens]                53   4e-05
gi|5803195|ref|NP_006853.1| tudor and KH domain containing; puta...    53   4e-05
gi|31222627|ref|XP_317203.1| ENSANGP00000012036 [Anopheles gambi...    51   1e-04
gi|31222621|ref|XP_317202.1| ENSANGP00000011900 [Anopheles gambi...    51   1e-04
gi|47221269|emb|CAG13205.1| unnamed protein product [Tetraodon n...    51   2e-04
gi|31044416|ref|NP_084192.1| serine threonine kinase 31 [Mus mus...    51   2e-04
gi|48139215|ref|XP_396982.1| similar to ENSANGP00000011900 [Apis...    50   4e-04
gi|15021902|dbj|BAB62226.1| tudor protein [Xenopus laevis]             49   8e-04
gi|50745091|ref|XP_419980.1| PREDICTED: similar to tudor domain ...    48   0.001
gi|47219687|emb|CAG12609.1| unnamed protein product [Tetraodon n...    47   0.002
gi|50369151|gb|AAH76962.1| Unknown (protein for MGC:89399) [Xeno...    47   0.002
gi|16758478|ref|NP_446117.1| A-kinase anchor protein 1 [Rattus n...    46   0.004
gi|14521263|ref|NP_126738.1| thermonuclease precursor [Pyrococcu...    46   0.004
gi|6753030|ref|NP_033778.1| A-kinase anchor protein 1; A kinase ...    46   0.004
gi|50758418|ref|XP_415913.1| PREDICTED: similar to A-kinase anch...    46   0.005
gi|42657656|ref|XP_166443.3| similar to tudor domain containing ...    46   0.005
gi|39932241|sp|O60522|TDR6_HUMAN Tudor domain containing protein...    46   0.005
gi|50782511|ref|XP_423400.1| PREDICTED: similar to Tudor and KH ...    45   0.009
gi|14591032|ref|NP_143107.1| thermonuclease [Pyrococcus horikosh...    45   0.012
gi|24648008|ref|NP_650735.1| CG14303-PA [Drosophila melanogaster...    45   0.012
gi|21391916|gb|AAM48312.1| AT14886p [Drosophila melanogaster]          45   0.012
gi|34863316|ref|XP_233972.2| similar to tudor protein [Rattus no...    45   0.012
gi|38049316|ref|XP_137954.2| similar to tudor protein [Mus muscu...    44   0.016
gi|38073520|ref|XP_129603.2| similar to Tudor domain containing ...    44   0.016
gi|4502015|ref|NP_003479.1| A-kinase anchor protein 1 isoform 1 ...    44   0.021
gi|18977670|ref|NP_579027.1| putative endonuclease [Pyrococcus f...    44   0.021
gi|21358205|ref|NP_650324.1| CG9925-PA [Drosophila melanogaster]...    44   0.027
gi|20151477|gb|AAM11098.1| GM03859p [Drosophila melanogaster]          44   0.027
gi|5032113|ref|NP_005862.1| survival motor neuron domain contain...    44   0.027
gi|42734388|ref|NP_694591.1| tudor domain containing 9; hypoxia-...    43   0.035
gi|21757550|dbj|BAC05144.1| unnamed protein product [Homo sapiens]     43   0.046
gi|27369569|ref|NP_766017.1| RIKEN cDNA 2410004J23 [Mus musculus...    43   0.046
gi|47086827|ref|NP_997766.1| survival motor neuron domain contai...    43   0.046
gi|21739458|emb|CAD38771.1| hypothetical protein [Homo sapiens]        43   0.046
gi|21757183|dbj|BAC05047.1| unnamed protein product [Homo sapiens]     43   0.046
gi|38073756|ref|XP_127120.2| RIKEN cDNA 4930441E05 [Mus musculus]      42   0.060
gi|13475193|ref|NP_106757.1| hypothetical protein mlr6217 [Mesor...    42   0.060
gi|34875088|ref|XP_224231.2| similar to hypothetical protein [Ra...    42   0.079
gi|38076314|ref|XP_354818.1| similar to Tudor domain containing ...    42   0.10
gi|26325626|dbj|BAC26567.1| unnamed protein product [Mus musculus]     42   0.10
gi|50749781|ref|XP_421753.1| PREDICTED: similar to Survival of m...    42   0.10
gi|22122663|ref|NP_666254.1| tudor domain containing 7 [Mus musc...    41   0.13
gi|34864382|ref|XP_213506.2| similar to RIKEN cDNA 2410004J23 [R...    41   0.13
gi|20302032|ref|NP_620226.1| tudor repeat associator with PCTAIR...    41   0.13
gi|47230141|emb|CAG10555.1| unnamed protein product [Tetraodon n...    41   0.13
gi|34880846|ref|XP_222763.2| similar to Tudor domain containing ...    41   0.13
gi|21358245|ref|NP_648724.1| CG13472-PA [Drosophila melanogaster...    41   0.18
gi|47222697|emb|CAG00131.1| unnamed protein product [Tetraodon n...    41   0.18
gi|41123792|ref|XP_371480.1| similar to tudor domain containing ...    40   0.30
gi|38174568|gb|AAH60876.1| Tudor domain containing 3 [Homo sapiens]    40   0.30
gi|24307951|ref|NP_055105.1| tudor domain containing 7; tudor re...    40   0.30
gi|34935513|ref|XP_234559.2| similar to hypothetical protein [Ra...    40   0.30
gi|13540576|ref|NP_110421.1| tudor domain containing 3 [Homo sap...    40   0.30
gi|4887238|gb|AAD32245.1| A-kinase anchor protein [Takifugu rubr...    40   0.30
gi|5002383|gb|AAD37448.1| A-kinase-anchor-protein 84 [Takifugu r...    40   0.30
gi|26329049|dbj|BAC28263.1| unnamed protein product [Mus musculus]     40   0.39
gi|16769358|gb|AAL28898.1| LD28068p [Drosophila melanogaster]          39   0.51
gi|31216850|ref|XP_316313.1| ENSANGP00000020645 [Anopheles gambi...    39   0.51
gi|46250124|gb|AAH68798.1| MGC81371 protein [Xenopus laevis]           39   0.51
gi|29337071|sp|Q8NAT2|TDR5_HUMAN Tudor domain containing protein 5     39   0.51
gi|21750664|dbj|BAC03815.1| unnamed protein product [Homo sapiens]     39   0.51
gi|29337147|sp|Q9NUY9|TDR4_HUMAN Tudor domain containing protein...    39   0.51
gi|40789259|ref|NP_061911.2| tudor domain containing 4 [Homo sap...    39   0.51
gi|40255178|ref|NP_775804.2| tudor domain containing 5 [Homo sap...    39   0.51
gi|15451269|dbj|BAB64438.1| hypothetical protein [Macaca fascicu...    39   0.67
gi|38259208|ref|NP_940810.1| tudor repeat 2; NY-CO-45-like; tudo...    39   0.67
gi|33593012|ref|NP_880656.1| putative nuclease [Bordetella pertu...    39   0.87
gi|33596956|ref|NP_884599.1| putative nuclease [Bordetella parap...    39   0.87
gi|34874783|ref|XP_236991.2| similar to colon cancer antigen NY-...    38   1.1
gi|47212869|emb|CAF93226.1| unnamed protein product [Tetraodon n...    38   1.1
gi|42490791|gb|AAH66144.1| Tdrd3 protein [Mus musculus]                38   1.5
gi|31982087|ref|NP_766193.2| tudor domain containing 3 [Mus musc...    38   1.5
gi|47077425|dbj|BAD18600.1| unnamed protein product [Homo sapiens]     38   1.5
gi|26324558|dbj|BAC26033.1| unnamed protein product [Mus musculus]     38   1.5
gi|31206993|ref|XP_312463.1| ENSANGP00000021985 [Anopheles gambi...    38   1.5
gi|33416597|gb|AAH55609.1| Zgc:77174 protein [Danio rerio]             37   1.9
gi|20804039|emb|CAD31616.1| HYPOTHETICAL CONSERVED TRANSMEMBRANE...    37   1.9
gi|34875440|ref|XP_224400.2| similar to RIKEN cDNA 4732418C03 [R...    37   1.9
gi|49227351|ref|NP_001001823.1| zgc:77174 [Danio rerio] >gnl|BL_...    37   1.9
gi|21355719|ref|NP_651092.1| CG4771-PA [Drosophila melanogaster]...    37   2.5
gi|15284020|dbj|BAB63452.1| putative gp18.7 kDa protein [Human a...    37   2.5
gi|12584630|emb|CAC27400.1| survival motor neuron protein [Plati...    37   2.5
gi|50731075|ref|XP_417153.1| PREDICTED: similar to tudor domain ...    36   4.3
gi|20091927|ref|NP_618002.1| predicted protein [Methanosarcina a...    36   4.3
gi|37181502|gb|AAQ88562.1| RGSF9380 [Homo sapiens]                     36   5.7
gi|47125173|gb|AAH70694.1| MGC83165 protein [Xenopus laevis]           36   5.7
gi|37679125|ref|NP_933734.1| conserved hypothetical protein [Vib...    36   5.7
gi|47211280|emb|CAF90398.1| unnamed protein product [Tetraodon n...    36   5.7
gi|27542753|gb|AAO16686.1| putative Rp1-like protein [Sorghum bi...    36   5.7
gi|26346362|dbj|BAC36832.1| unnamed protein product [Mus musculus]     36   5.7
gi|31982535|ref|NP_849245.2| expressed sequence AI661438 [Mus mu...    36   5.7
gi|45361623|ref|NP_989385.1| hypothetical protein MGC76148 [Xeno...    35   7.4
gi|31201223|ref|XP_309559.1| ENSANGP00000003926 [Anopheles gambi...    35   7.4
gi|45547562|ref|ZP_00187608.1| COG1525: Micrococcal nuclease (th...    35   7.4
gi|48127540|ref|XP_396611.1| similar to hypothetical protein [Ap...    35   7.4
gi|45547564|ref|ZP_00187610.1| COG1525: Micrococcal nuclease (th...    35   7.4
gi|30248424|ref|NP_840494.1| Ribosomal protein S3:Type 2 KH doma...    35   9.7
gi|31208387|ref|XP_313160.1| ENSANGP00000023099 [Anopheles gambi...    35   9.7


>gi|17533087|ref|NP_494839.1| domain protein (100.8 kD) (2E999)
            [Caenorhabditis elegans]
 gi|25352985|pir||B88131 protein F10G7.2 [imported] - Caenorhabditis
            elegans
 gi|1055161|gb|AAA81130.1| Tudor staphylococcal nuclease homolog
            protein 1 [Caenorhabditis elegans]
          Length = 914

 Score = 1602 bits (4148), Expect = 0.0
 Identities = 818/914 (89%), Positives = 818/914 (89%)
 Frame = +1

Query: 1    MTDXXXXXXXXXXXXXXXXXXXXRRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTA 180
            MTD                    RRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTA
Sbjct: 1    MTDAAAATPTVPPPAASSANPAVRRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTA 60

Query: 181  PRLGRRPTDSASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSP 360
            PRLGRRPTDSASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSP
Sbjct: 61   PRLGRRPTDSASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSP 120

Query: 361  ADAENVAEGAVSAGLLEVRQGKVADEYSTKLLELQEQAKSAGRGKWNSNAGTIRDIRWVI 540
            ADAENVAEGAVSAGLLEVRQGKVADEYSTKLLELQEQAKSAGRGKWNSNAGTIRDIRWVI
Sbjct: 121  ADAENVAEGAVSAGLLEVRQGKVADEYSTKLLELQEQAKSAGRGKWNSNAGTIRDIRWVI 180

Query: 541  DNPRELVDKYAQKPIDAVIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXX 720
            DNPRELVDKYAQKPIDAVIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAAD
Sbjct: 181  DNPRELVDKYAQKPIDAVIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADSR 240

Query: 721  XXXXXXXXXXXXXXXLLQRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWS 900
                           LLQRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWS
Sbjct: 241  AEAFSEEAKFFAESRLLQRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWS 300

Query: 901  IGLCTGGAQKLRDAERQAKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQK 1080
            IGLCTGGAQKLRDAERQAKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQK
Sbjct: 301  IGLCTGGAQKLRDAERQAKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQK 360

Query: 1081 DDGSEVKLHLSSIRLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQ 1260
            DDGSEVKLHLSSIRLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQ
Sbjct: 361  DDGSEVKLHLSSIRLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQ 420

Query: 1261 IDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXX 1440
            IDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDT
Sbjct: 421  IDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTLLAAEA 480

Query: 1441 XXXXXXXXXFADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLR 1620
                     FADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLR
Sbjct: 481  NAEKGKKGLFADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLR 540

Query: 1621 IYIPKETVLITFLLGGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVE 1800
            IYIPKETVLITFLLGGINCPKGARVGPGGVSTG            TRKLVLQHEVQLEVE
Sbjct: 541  IYIPKETVLITFLLGGINCPKGARVGPGGVSTGAAEPFADEAAAFTRKLVLQHEVQLEVE 600

Query: 1801 STDKNGNFVGYLYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXX 1980
            STDKNGNFVGYLYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHY
Sbjct: 601  STDKNGNFVGYLYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYNALLSAENKAKK 660

Query: 1981 XXXXXXXXFTXXXXXXXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEK 2160
                    FT            ADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEK
Sbjct: 661  AKKNIWANFTEEQHQEEVEVQQADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEK 720

Query: 2161 MTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQAEIVYIDYGNR 2340
            MTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQAEIVYIDYGNR
Sbjct: 721  MTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQAEIVYIDYGNR 780

Query: 2341 ETIEAVKLAQIPAGFANFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSE 2520
            ETIEAVKLAQIPAGFANFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSE
Sbjct: 781  ETIEAVKLAQIPAGFANFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSE 840

Query: 2521 YKVGTSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSR 2700
            YKVGTSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSR
Sbjct: 841  YKVGTSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSR 900

Query: 2701 KNIWEYGDFTGNDI 2742
            KNIWEYGDFTGNDI
Sbjct: 901  KNIWEYGDFTGNDI 914


>gi|39583106|emb|CAE60646.1| Hypothetical protein CBG04292
            [Caenorhabditis briggsae]
          Length = 913

 Score = 1422 bits (3682), Expect = 0.0
 Identities = 710/891 (79%), Positives = 769/891 (85%)
 Frame = +1

Query: 70   RRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDSASATPDEPYAWDS 249
            RRGLVKSVLSGDAVILQGQP NGPPPEWTVYLSNV+APRLGRRPTDSA ATPDEPYAW++
Sbjct: 24   RRGLVKSVLSGDAVILQGQPQNGPPPEWTVYLSNVSAPRLGRRPTDSAPATPDEPYAWEA 83

Query: 250  REYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGKV 429
            RE+LR KLVGQFVTFVRDFTATSGRDHGR+YLGGTSPADAENVAE AV+AGLLEVRQGK+
Sbjct: 84   REFLRGKLVGQFVTFVRDFTATSGRDHGRVYLGGTSPADAENVAEEAVAAGLLEVRQGKI 143

Query: 430  ADEYSTKLLELQEQAKSAGRGKWNSNAGTIRDIRWVIDNPRELVDKYAQKPIDAVIEMVR 609
             D+Y+TKLLELQEQAK++G+GKW+S  GTIR+IRWVIDNPRELVDKYAQKPIDAVIEMVR
Sbjct: 144  TDDYTTKLLELQEQAKASGKGKWSSTPGTIREIRWVIDNPRELVDKYAQKPIDAVIEMVR 203

Query: 610  DGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQI 789
            DGSTVRAFLLPN+EYITLQLSGVRAPST+NP + D                 LLQRDVQI
Sbjct: 204  DGSTVRAFLLPNYEYITLQLSGVRAPSTKNPTSHDSRAEPFSEEAKFFVESRLLQRDVQI 263

Query: 790  ILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRL 969
            ILESTSNQNFVGSI+HPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKR+
Sbjct: 264  ILESTSNQNFVGSIIHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRV 323

Query: 970  RLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDK 1149
            RLWKSY P +S YSGDRKAF+ KVVE+VL+DAVVVQK+DG+E+KLHLSS+RLP+E+ +DK
Sbjct: 324  RLWKSYTPAASGYSGDRKAFSAKVVEVVLNDAVVVQKEDGTEMKLHLSSVRLPKETAEDK 383

Query: 1150 ATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKSENFPEKTCATIKIGD 1329
                 GRQFRPLYD+PFMFQAREFLRKR+ GKKVQ+QIDYVQPK++NFPEKTCATIK GD
Sbjct: 384  QP-SVGRQFRPLYDVPFMFQAREFLRKRIHGKKVQVQIDYVQPKTDNFPEKTCATIKHGD 442

Query: 1330 QNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKTAEKKDTHRI 1509
             NIAEGLISRGLSKVVRHRADDENRS EYD                FADKTAEKKDT RI
Sbjct: 443  LNIAEGLISRGLSKVVRHRADDENRSCEYDLLLAAEANAEKGKKGLFADKTAEKKDTLRI 502

Query: 1510 QEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGINCPKGA 1689
            QEI GD+AK+KQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGINCPKG+
Sbjct: 503  QEIAGDVAKSKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGINCPKGS 562

Query: 1690 RVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDGNTSRA 1869
            RVGPGGV+ G            TRKLVLQHEVQLEVESTDKNGNFVGYL+VSPDGNTSR
Sbjct: 563  RVGPGGVTIGAAEPFADEAAAFTRKLVLQHEVQLEVESTDKNGNFVGYLFVSPDGNTSRG 622

Query: 1870 INLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXXXXXXXXXA 2049
            INLSEALVE GLA+LHFTAERSGHY                    +T            A
Sbjct: 623  INLSEALVEAGLATLHFTAERSGHYNALLAAENRAKKAKKNIWANYTEEQQQEEVEVQQA 682

Query: 2050 DTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGSYTTKR 2229
            DTSERKQN+RQVAVTD+APGALRFSAQNIEDG KIEKMT+EMRQA+A+HPPLAGSY  KR
Sbjct: 683  DTSERKQNYRQVAVTDLAPGALRFSAQNIEDGAKIEKMTSEMRQAIADHPPLAGSYAAKR 742

Query: 2230 GDLCVAKFSQDGQWYRCKVESVRAGQAEIVYIDYGNRETIEAVKLAQIPAGFANFPAGVR 2409
            GDLCVAKFS+DG WYR KVESVR GQAEIVYIDYGNRET+EA KLAQIP GFA+FPAGV+
Sbjct: 743  GDLCVAKFSEDGLWYRAKVESVRQGQAEIVYIDYGNRETVEAAKLAQIPGGFASFPAGVK 802

Query: 2410 EYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTVYYDSGNKKVDIG 2589
            EYNLAL KLPNEDYVQLT DAFAQYL+GHSSVF+NSEYKVGT+EYVTVY+D GNKKVDIG
Sbjct: 803  EYNLALVKLPNEDYVQLTLDAFAQYLYGHSSVFVNSEYKVGTAEYVTVYFDMGNKKVDIG 862

Query: 2590 KSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTGNDI 2742
            KSL+ EGLALAD RREPRLQTL N+Y + E+ ARKSRKNIWEYGDFTGNDI
Sbjct: 863  KSLVEEGLALADSRREPRLQTLCNEYKSAEDKARKSRKNIWEYGDFTGNDI 913


>gi|50511303|dbj|BAD32626.1| 4SNc-Tudor domain protein [Takifugu
            rubripes]
          Length = 911

 Score =  700 bits (1807), Expect = 0.0
 Identities = 391/909 (43%), Positives = 551/909 (60%), Gaps = 19/909 (2%)
 Frame = +1

Query: 70   RRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYA 240
            +RG+VK VLSG A+I++GQP  GPPPE  + LSN+ A  + RR   S      TPDEP+A
Sbjct: 19   QRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGAMARRAAQSQPDTKDTPDEPWA 78

Query: 241  WDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ 420
            + +RE+LR+KL+G+ V F  +   TSGR++G +YLG       EN+AE  VS GL  VR+
Sbjct: 79   FQAREFLRKKLIGKEVCFTVETKTTSGREYGVVYLG--KDTTGENIAESLVSEGLATVRR 136

Query: 421  ----GKVADEYSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKP 582
                G + ++   +L E+++QAKS+ +G W    G  TIRD+++ I++PR  VD   QKP
Sbjct: 137  EGIRGNIPEQ--VRLCEIEDQAKSSKKGCWTEAGGLQTIRDLKYTIESPRNFVDSLHQKP 194

Query: 583  IDAVIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXX 762
            ++A+IE VRDGS VRA LLP++  +T+ LSGV+ P  R
Sbjct: 195  VNAIIEHVRDGSVVRALLLPDYYLVTVMLSGVKCPVFRREADGTETPEPFAAEAKFFTES 254

Query: 763  XLLQRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDA 942
             LLQRDVQIILES  NQ  +G+I+HP GNI E LL+EG+A+CVDWS+ + T GA+KLR A
Sbjct: 255  RLLQRDVQIILESCPNQIILGTILHPNGNITELLLKEGFARCVDWSMAVYTQGAEKLRAA 314

Query: 943  ERQAKEKRLRLWKSY-QPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSI 1119
            ER AKE+++R+WK Y  PT++    DR+ F  KV++++ +DA+VV+ + G    +HLSSI
Sbjct: 315  ERSAKERKVRIWKDYVAPTANLDQKDRQ-FVAKVMQVLNADAMVVKLNSGEYKTIHLSSI 373

Query: 1120 RLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPK------ 1281
            R PR  G++K      ++FRPLYDIP+MF+AREFLRK+L+GKKV + +DY++
Sbjct: 374  RPPRNEGEEK-NKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATGPAEG 432

Query: 1282 SENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXX 1461
            +  F E+TCAT+ IG  NIAE L+S+GL+ V+R+R DD+ RSS YD
Sbjct: 433  TPTFAERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGK 492

Query: 1462 XXFADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKET 1641
               + K   +   HR+ +I+G+  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET
Sbjct: 493  GLHSKK---EVPIHRVADISGETQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKET 549

Query: 1642 VLITFLLGGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGN 1821
             LITFLL GI CP+ +R  P  V T             T++LVLQ EV++EVES DK GN
Sbjct: 550  CLITFLLAGIECPRSSRNTP--VGTQVAEPFSNEAMLFTKELVLQREVEVEVESMDKAGN 607

Query: 1822 FVGYLYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXX 2001
            F+G+L++  DG     +NLS ALVEN L+ +HFTAERS +Y
Sbjct: 608  FIGWLHI--DG-----VNLSVALVENALSKVHFTAERSSYYKTLVSAEEGCRQRKEKVWA 660

Query: 2002 XFTXXXXXXXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQ 2181
             +             ++  ER   +R V VT+I    L F  Q++E G ++E +   MR
Sbjct: 661  NY--EEKPAEEFVHVSEEKERVAKYRAVYVTEIT-DTLHFYTQDVETGAQLESLMETMRA 717

Query: 2182 ALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAV 2358
             +A HPP+ GSY  +RGD C+AKF+ DG+WYR +VE V +  +  + YIDYGNRE + +
Sbjct: 718  EIAAHPPVEGSYAARRGDCCIAKFA-DGEWYRARVEKVESPAKVHVFYIDYGNREVVPST 776

Query: 2359 KLAQIPAGFA--NFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVG 2532
            +LA IP  F     PA   EY  A  ++P ++  +            +S   +N EY
Sbjct: 777  RLAAIPPAFGVRTLPAQATEYTFAYIQVPEDEDARADVVDCVVRDIHNSQCLLNVEYSGP 836

Query: 2533 TSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIW 2712
            T  +VT+ +  G+ K D G  L+ EGL + D R+E  LQ +V +Y  ++E A+ +R NIW
Sbjct: 837  TCPHVTIQF--GDTKDDAGLGLVKEGLVMVDVRKEKHLQKMVTEYLNSQESAKTARLNIW 894

Query: 2713 EYGDFTGND 2739
             YGDF  +D
Sbjct: 895  RYGDFRADD 903


>gi|45429977|ref|NP_991353.1| 100 kDa coactivator [Bos taurus]
 gi|30523262|gb|AAP31682.1| 100 kDa coactivator [Bos taurus]
          Length = 910

 Score =  695 bits (1793), Expect = 0.0
 Identities = 382/905 (42%), Positives = 546/905 (60%), Gaps = 15/905 (1%)
 Frame = +1

Query: 70   RRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPT---DSASATPDEPYA 240
            +RG+VK VLSG A+I++GQP  GPPPE  + LSN+ A  L RR       A  TPDEP+A
Sbjct: 20   QRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAVAQPDAKDTPDEPWA 79

Query: 241  WDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ 420
            + +RE+LR+KL+G+ V F  +     GR++G IYLG     + EN+AE  V+ GL   R+
Sbjct: 80   FPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLATRRE 137

Query: 421  GKVADE-YSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDA 591
            G  A+     +L E +EQAK++ +G W+   G  TIRD+++ I+NPR  VD + QKP++A
Sbjct: 138  GMRANNPEQNRLAECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNA 197

Query: 592  VIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLL 771
            +IE VRDGS VRA LLP++  +T+ LSG++ P+ R                       LL
Sbjct: 198  IIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLL 257

Query: 772  QRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQ 951
            QRDVQIILES  NQN +G+I+HP GNI E LL+EG+A+CVDWSI + T GA+KLR AER
Sbjct: 258  QRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERF 317

Query: 952  AKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPR 1131
            AKE+RLR+W+ Y   ++      K F  KV++++ +DA+VV+ + G    +HLSSIR PR
Sbjct: 318  AKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPR 377

Query: 1132 ESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENF 1293
              G++  T    ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++P S        F
Sbjct: 378  LEGEN--TQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATDTVPAF 435

Query: 1294 PEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFA 1473
             E+TCAT+ IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 +
Sbjct: 436  SERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHS 495

Query: 1474 DKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLIT 1653
             K   +   HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LIT
Sbjct: 496  KK---EVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLIT 552

Query: 1654 FLLGGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGY 1833
            FLL GI CP+GAR  PG V  G            T++LVLQ EV++EVES DK GNF+G+
Sbjct: 553  FLLAGIECPRGARNLPGLVQEG--EPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGW 610

Query: 1834 LYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTX 2013
            L++  DG      NLS  LVE+ L+ +HFTAERS +Y                    +
Sbjct: 611  LHI--DG-----ANLSVLLVEHALSKVHFTAERSAYYKSLLSAEEAAKQKKEKVWAHY-- 661

Query: 2014 XXXXXXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAE 2193
                        +  ER  +++ V VT+I    L F  Q++E G ++EK+   MR  +A
Sbjct: 662  EEQPVEELMPVLEEKERSASYKPVFVTEITDD-LHFYVQDVETGTQLEKLMENMRNDIAS 720

Query: 2194 HPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQ 2370
            HPP+ GSY  +RG+ C+AKF  DG+WYR +VE V +  +  + YIDYGNRE + + +L
Sbjct: 721  HPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGT 779

Query: 2371 IPAGFAN--FPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEY 2544
            +P  F+    PA   EY  A  ++P ++  +  +         ++   +N E+      +
Sbjct: 780  LPPAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPH 839

Query: 2545 VTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGD 2724
            VT+ +   + K D+G  L+ EGL + + R+E + Q ++ +Y   +E A+ +R N+W YGD
Sbjct: 840  VTLQF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGD 897

Query: 2725 FTGND 2739
            F  +D
Sbjct: 898  FRADD 902


>gi|32879913|gb|AAP88787.1| EBNA-2 co-activator (100kD) [Homo sapiens]
          Length = 910

 Score =  694 bits (1790), Expect = 0.0
 Identities = 382/905 (42%), Positives = 546/905 (60%), Gaps = 15/905 (1%)
 Frame = +1

Query: 70   RRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYA 240
            +RG++K VLSG A+I++GQP  GPPPE  + LSN+ A  L RR   +   A  TPDEP+A
Sbjct: 20   QRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDAKDTPDEPWA 79

Query: 241  WDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ 420
            + +RE+LR+KL+G+ V F  +     GR++G IYLG     + EN+AE  V+ GL   R+
Sbjct: 80   FPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLATRRE 137

Query: 421  GKVADE-YSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDA 591
            G  A+     +L E +EQAK+A +G W+   G  TIRD+++ I+NPR  VD + QKP++A
Sbjct: 138  GMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNA 197

Query: 592  VIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLL 771
            +IE VRDGS VRA LLP++  +T+ LSG++ P+ R                       LL
Sbjct: 198  IIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLL 257

Query: 772  QRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQ 951
            QRDVQIILES  NQN +G+I+HP GNI E LL+EG+A+CVDWSI + T GA+KLR AER
Sbjct: 258  QRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERF 317

Query: 952  AKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPR 1131
            AKE+RLR+W+ Y   ++      K F  KV++++ +DA+VV+ + G    +HLSSIR PR
Sbjct: 318  AKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPR 377

Query: 1132 ESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENF 1293
              G++  T    ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++P S        F
Sbjct: 378  LEGEN--TQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAF 435

Query: 1294 PEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFA 1473
             E+TCAT+ IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 +
Sbjct: 436  SERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHS 495

Query: 1474 DKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLIT 1653
             K   +   HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LIT
Sbjct: 496  KK---EVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLIT 552

Query: 1654 FLLGGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGY 1833
            FLL GI CP+GAR  PG V  G            T++LVLQ EV++EVES DK GNF+G+
Sbjct: 553  FLLAGIECPRGARNLPGLVQEG--EPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGW 610

Query: 1834 LYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTX 2013
            L++  DG      NLS  LVE+ L+ +HFTAERS +Y                    +
Sbjct: 611  LHI--DG-----ANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAHY-- 661

Query: 2014 XXXXXXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAE 2193
                        +  ER  +++ V VT+I    L F  Q++E G ++EK+   MR  +A
Sbjct: 662  EEQPVEEVMPVLEEKERSASYKPVFVTEITDD-LHFYVQDVETGTQLEKLMENMRNDIAS 720

Query: 2194 HPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQ 2370
            HPP+ GSY  +RG+ C+AKF  DG+WYR +VE V +  +  + YIDYGNRE + + +L
Sbjct: 721  HPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGT 779

Query: 2371 IPAGFAN--FPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEY 2544
            +   F+    PA   EY  A  ++P +D  +  +         ++   +N E+      +
Sbjct: 780  LSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPH 839

Query: 2545 VTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGD 2724
            VT+ +   + K D+G  L+ EGL + + R+E + Q ++ +Y   +E A+ +R N+W YGD
Sbjct: 840  VTLQF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGD 897

Query: 2725 FTGND 2739
            F  +D
Sbjct: 898  FRADD 902


>gi|26352950|dbj|BAC40105.1| unnamed protein product [Mus musculus]
          Length = 910

 Score =  693 bits (1788), Expect = 0.0
 Identities = 381/905 (42%), Positives = 544/905 (60%), Gaps = 15/905 (1%)
 Frame = +1

Query: 70   RRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYA 240
            +RG+VK VLSG A+I++GQP  GPPPE  + LSN+ A  L RR   +      TPDEP+A
Sbjct: 20   QRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWA 79

Query: 241  WDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ 420
            + +RE+LR+KL+G+ V F  +     GR++G IYLG     + EN+AE  V+ GL   R+
Sbjct: 80   FPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLATRRE 137

Query: 421  GKVADE-YSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDA 591
            G  A+     +L E +EQAK++ +G W+   G  TIRD+++ I+NPR  VD + QKP++A
Sbjct: 138  GMRANNPEQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNA 197

Query: 592  VIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLL 771
            +IE VRDGS VRA LLP    +T+ LSG++ P+ R                       LL
Sbjct: 198  IIEHVRDGSVVRALLLPGHHLVTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLL 257

Query: 772  QRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQ 951
            QRDVQIILES  NQN +G+I+HP GNI E LL+EG+A+CVDWSI + T GA+KLR AER
Sbjct: 258  QRDVQIILESCHNQNLLGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERF 317

Query: 952  AKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPR 1131
            AKE+RLR+W+ Y P ++      K F  KV++++ +DA+VV+ + G    +HLSSIR PR
Sbjct: 318  AKERRLRIWRDYVPPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPR 377

Query: 1132 ESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENF 1293
              GD+       ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++P S        F
Sbjct: 378  LEGDN--IQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAF 435

Query: 1294 PEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFA 1473
             E+TCAT+ IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 +
Sbjct: 436  SERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHS 495

Query: 1474 DKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLIT 1653
             K   +   HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LIT
Sbjct: 496  KK---EVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLIT 552

Query: 1654 FLLGGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGY 1833
            FLL GI CP+GAR  PG V  G            T++LVLQ EV++EVES DK GNF+G+
Sbjct: 553  FLLAGIECPRGARNLPGLVQEG--EPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGW 610

Query: 1834 LYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTX 2013
            L++  DG      NLS  LVE  L+ +HFTAERS +Y                    +
Sbjct: 611  LHM--DG-----ANLSVLLVEQALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWAHY-- 661

Query: 2014 XXXXXXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAE 2193
                        +  ER  +++ V VT+I    L F  Q++E G ++EK+   MR  ++
Sbjct: 662  EERPVEEVMPVLEEKERSASYKPVFVTEITDD-LHFYVQDVETGTQLEKLMENMRNDISS 720

Query: 2194 HPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQ 2370
            HPP+ GSY  +RG+ C+AKF  DG+WYR +VE V +  +  + YIDYGNRE + + +L
Sbjct: 721  HPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGT 779

Query: 2371 IPAGFAN--FPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEY 2544
            +P  F+    PA   EY  A  ++P ++  +  +         ++   +N E+   +  +
Sbjct: 780  LPPAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSASCPH 839

Query: 2545 VTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGD 2724
            VT+ +   + K D+G  L+ EGL + + R+E + Q ++ +Y   +E A+ +R N+W YGD
Sbjct: 840  VTLQF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGD 897

Query: 2725 FTGND 2739
            F  +D
Sbjct: 898  FRADD 902


>gi|50511304|dbj|BAD32627.1| 4SNc-Tudor domain protein [Takifugu
            rubripes]
          Length = 887

 Score =  692 bits (1785), Expect = 0.0
 Identities = 387/902 (42%), Positives = 545/902 (59%), Gaps = 19/902 (2%)
 Frame = +1

Query: 91   VLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYAWDSREYL 261
            VLSG A+I++GQP  GPPPE  + LSN+ A  + RR   S      TPDEP+A+ +RE+L
Sbjct: 2    VLSGCAIIVRGQPRGGPPPERQINLSNIRAGAMARRAAQSQPDTKDTPDEPWAFQAREFL 61

Query: 262  RQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ----GKV 429
            R+KL+G+ V F  +   TSGR++G +YLG       EN+AE  VS GL  VR+    G +
Sbjct: 62   RKKLIGKEVCFTVETKTTSGREYGVVYLG--KDTTGENIAESLVSEGLATVRREGIRGNI 119

Query: 430  ADEYSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDAVIEM 603
             ++   +L E+++QAKS+ +G W    G  TIRD+++ I++PR  VD   QKP++A+IE
Sbjct: 120  PEQ--VRLCEIEDQAKSSKKGCWTEAGGLQTIRDLKYTIESPRNFVDSLHQKPVNAIIEH 177

Query: 604  VRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDV 783
            VRDGS VRA LLP++  +T+ LSGV+ P  R                       LLQRDV
Sbjct: 178  VRDGSVVRALLLPDYYLVTVMLSGVKCPVFRREADGTETPEPFAAEAKFFTESRLLQRDV 237

Query: 784  QIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEK 963
            QIILES  NQ  +G+I+HP GNI E LL+EG+A+CVDWS+ + T GA+KLR AER AKE+
Sbjct: 238  QIILESCPNQIILGTILHPNGNITELLLKEGFARCVDWSMAVYTQGAEKLRAAERSAKER 297

Query: 964  RLRLWKSY-QPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESG 1140
            ++R+WK Y  PT++    DR+ F  KV++++ +DA+VV+ + G    +HLSSIR PR  G
Sbjct: 298  KVRIWKDYVAPTANLDQKDRQ-FVAKVMQVLNADAMVVKLNSGEYKTIHLSSIRPPRNEG 356

Query: 1141 DDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPK------SENFPEK 1302
            ++K      ++FRPLYDIP+MF+AREFLRK+L+GKKV + +DY++        +  F E+
Sbjct: 357  EEK-NKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATGPAEGTPTFAER 415

Query: 1303 TCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKT 1482
            TCAT+ IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 + K
Sbjct: 416  TCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKK- 474

Query: 1483 AEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLL 1662
              +   HR+ +I+G+  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LITFLL
Sbjct: 475  --EVPIHRVADISGETQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLL 532

Query: 1663 GGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYV 1842
             GI CP+ +R  P  V T             T++LVLQ EV++EVES DK GNF+G+L++
Sbjct: 533  AGIECPRSSRNTP--VGTQVAEPFSNEAMLFTKELVLQREVEVEVESMDKAGNFIGWLHI 590

Query: 1843 SPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXX 2022
              DG     +NLS ALVEN L+ +HFTAERS +Y                    +
Sbjct: 591  --DG-----VNLSVALVENALSKVHFTAERSSYYKTLVSAEEGCRQRKEKVWANY--EEK 641

Query: 2023 XXXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPP 2202
                    ++  ER   +R V VT+I    L F  Q++E G ++E +   MR  +A HPP
Sbjct: 642  PAEEFVHVSEEKERVAKYRAVYVTEIT-DTLHFYTQDVETGAQLESLMETMRAEIAAHPP 700

Query: 2203 LAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQIPA 2379
            + GSY  +RGD C+AKF+ DG+WYR +VE V +  +  + YIDYGNRE + + +LA IP
Sbjct: 701  VEGSYAARRGDCCIAKFA-DGEWYRARVEKVESPAKVHVFYIDYGNREVVPSTRLAAIPP 759

Query: 2380 GFA--NFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTV 2553
             F     PA   EY  A  ++P ++  +            +S   +N EY   T  +VT+
Sbjct: 760  AFGVRTLPAQATEYTFAYIQVPEDEDARADVVDCVVRDIHNSQCLLNVEYSGPTCPHVTI 819

Query: 2554 YYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTG 2733
             +  G+ K D G  L+ EGL + D R+E  LQ +V +Y  ++E A+ +R NIW YGDF
Sbjct: 820  QF--GDTKDDAGLGLVKEGLVMVDVRKEKHLQKMVTEYLNSQESAKTARLNIWRYGDFRA 877

Query: 2734 ND 2739
            +D
Sbjct: 878  DD 879


>gi|28175411|gb|AAH45115.1| MGC53332 protein [Xenopus laevis]
          Length = 906

 Score =  692 bits (1785), Expect = 0.0
 Identities = 385/906 (42%), Positives = 547/906 (59%), Gaps = 16/906 (1%)
 Frame = +1

Query: 70   RRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYA 240
            +RG+VK+VLSG A+I++GQP  GPPPE  + LSN+ A  L RR   S   +  TPDEP+A
Sbjct: 16   QRGIVKTVLSGCAIIVRGQPRGGPPPERQINLSNIRAGALARRAAASQQDSKDTPDEPWA 75

Query: 241  WDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ 420
            + +RE+LR+KL+G+ V F  ++    GR++G +YLG       EN+AE  V+ GL   R+
Sbjct: 76   FPAREFLRKKLIGKEVCFTVEYKTPQGREYGMVYLG--KDTSGENIAESLVAEGLASRRE 133

Query: 421  GKVADE-YSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDA 591
            G  A+    ++L EL+EQA+SA +G W+   G  T+RDI++ I+NPR  VD   QKP++A
Sbjct: 134  GVRANTPEQSRLAELEEQARSAKKGVWSEGTGSQTVRDIKYTIENPRHFVDSMHQKPVNA 193

Query: 592  VIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLL 771
            +IE VRDGS VRA LLP+   +T+ LSG++ P+ +                       LL
Sbjct: 194  IIEHVRDGSVVRALLLPDCYIVTVMLSGIKCPTFKREADGTETPEPFAAEAKFFTESRLL 253

Query: 772  QRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQ 951
            QRDVQIILES  NQN +G+I+HP GNI E LL+EG+A+CVDWSI + T G++KLR AER
Sbjct: 254  QRDVQIILESCHNQNVLGTILHPNGNITELLLKEGFARCVDWSIAIYTQGSEKLRAAERF 313

Query: 952  AKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPR 1131
            AKE + R+W+ Y   ++      K F  KVV+I+ +DA+VV+ + G    +HLSSIR PR
Sbjct: 314  AKEHKTRIWRDYVAPTANLDQKDKQFVAKVVQILNADAMVVKLNSGDYKTIHLSSIRPPR 373

Query: 1132 ESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENF 1293
              G+        ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++  S        F
Sbjct: 374  LEGE--GAQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVNVDYIRSASTATETVPAF 431

Query: 1294 PEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFA 1473
            PE+TCAT+ IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 +
Sbjct: 432  PERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNAKGLHS 491

Query: 1474 DKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLIT 1653
             K   +   HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LIT
Sbjct: 492  KK---EVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLIT 548

Query: 1654 FLLGGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGY 1833
            FLL GI CP+G+R  P GV  G            T++LVLQ EV++EVE+ DK GNF+G+
Sbjct: 549  FLLAGIECPRGSRNMPSGVQEG--EPFSEEAMLFTKELVLQREVEVEVEAMDKAGNFIGW 606

Query: 1834 LYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTX 2013
            L+V  DG     +N+S ALVE+ L+ +HFTAERS +Y
Sbjct: 607  LHV--DG-----VNISVALVEHALSKVHFTAERSNYYKTLLAAEEGPKQRKDKVWS--KV 657

Query: 2014 XXXXXXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAE 2193
                        +  ER  N++ V VT+I    L F  Q++E G ++EK+   MR  +A
Sbjct: 658  EEQQVEEVVTVVEEKERNANYKPVLVTEIT-DELHFYVQDVETGTQLEKLMESMRSEIAS 716

Query: 2194 HPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVR-AGQAEIVYIDYGNRETIEAVKLAQ 2370
            +PPL GS++ +RGD C+AK+  DG+WYR +VE V  A +  + YIDYGNRE + + +L
Sbjct: 717  NPPLEGSFSPRRGDYCIAKY-MDGEWYRARVEKVESAAKVHVFYIDYGNREVLPSTRLGP 775

Query: 2371 IPAGFA--NFPAGVREYNLALAKLP-NEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSE 2541
            +P  F+    PA   EY  A  ++P +ED      D   + +  ++   +N EY
Sbjct: 776  LPQSFSIRTLPAQAIEYCFAFIQVPIDEDARTDVVDNIVRDI-QNTQCLLNVEYSGAGCP 834

Query: 2542 YVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYG 2721
            +VT+ +   + K D+G  L+ EGL + + R+E +   L+ +Y   +E A+ SR N+W YG
Sbjct: 835  HVTLQF--ADSKDDVGLGLVKEGLVMVEVRKEKQFHKLIGEYVAAQESAKASRLNLWRYG 892

Query: 2722 DFTGND 2739
            DF  +D
Sbjct: 893  DFRADD 898


>gi|27697028|gb|AAH43884.1| 2e999-prov protein [Xenopus laevis]
          Length = 906

 Score =  687 bits (1774), Expect = 0.0
 Identities = 379/905 (41%), Positives = 543/905 (59%), Gaps = 15/905 (1%)
 Frame = +1

Query: 70   RRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYA 240
            +RG+VK VLSG A+I++GQP  GPPPE  + LSN+ A  L RR   S   +  TPDEP+A
Sbjct: 16   QRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGALARRAAASQQDSKDTPDEPWA 75

Query: 241  WDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ 420
            + +RE+LR+KL+G+ V F  ++    GR++G +YLG       EN+AE  V+ GL   R+
Sbjct: 76   FPAREFLRKKLIGKEVCFTVEYKTPQGREYGTVYLG--KDTSGENIAESLVAEGLASRRE 133

Query: 421  GKVADE-YSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDA 591
            G  A+    ++L EL+EQA+SA +G W+   G  T+RD+++ I+NPR  VD   QKP++A
Sbjct: 134  GVRANTPEQSRLAELEEQARSAKKGVWSEGTGSHTVRDVKYTIENPRHFVDSMHQKPVNA 193

Query: 592  VIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLL 771
            VIE VRDGS VRA LLP+   +T+ LSG++ P+ +                       LL
Sbjct: 194  VIEHVRDGSVVRALLLPDCYLVTVMLSGIKCPTFKREADGTESPEAFAAEAKFFTESRLL 253

Query: 772  QRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQ 951
            QRDVQIILES  NQN +G+I+HP GNI E LL+EG+A+CVDWSI + T G++KLR AER
Sbjct: 254  QRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVYTQGSEKLRAAERF 313

Query: 952  AKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPR 1131
            AKE + R+W+ Y   ++      K F  KVV+I+ +DA+VV+ + G    +HLSSIR PR
Sbjct: 314  AKEHKTRIWRDYVAPTANLDQKDKQFVAKVVQILNADAMVVKLNSGDYKTIHLSSIRPPR 373

Query: 1132 ESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENF 1293
              G+        ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++  S        F
Sbjct: 374  LEGE--GAQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVNVDYIRSASTATETVPAF 431

Query: 1294 PEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFA 1473
             E+TCAT+ IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 +
Sbjct: 432  SERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNAKGLHS 491

Query: 1474 DKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLIT 1653
             K   +   HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LIT
Sbjct: 492  KK---EVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLIT 548

Query: 1654 FLLGGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGY 1833
            FLL GI CP+G+R  P GV  G            T++LVLQ EV++EVE+ DK GNF+G+
Sbjct: 549  FLLAGIECPRGSRNMPSGVQEG--EPFSEEAMLFTKELVLQREVEVEVEAMDKAGNFIGW 606

Query: 1834 LYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTX 2013
            L++  DG     +N+S ALVE+ L+ +HFTAERS +Y                    F
Sbjct: 607  LHI--DG-----VNISVALVEHALSKVHFTAERSNYYKTLLAAEEGPKQRKEKVWSKF-- 657

Query: 2014 XXXXXXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAE 2193
                        +  ER  N++ V VT+I    L F  Q++E G ++EK+   MR  +A
Sbjct: 658  EEQPVEEVVTVVEEKERNANYKPVLVTEIT-DELHFYIQDVETGTQLEKLMESMRSEIAS 716

Query: 2194 HPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQ 2370
            +PPL GS++ +RGD C+AK+  DG+WYR +VE V +  +  + YIDYGNRE + + +L
Sbjct: 717  NPPLEGSFSPRRGDYCIAKY-MDGEWYRARVEKVESTAKVHVFYIDYGNREVLPSTRLGT 775

Query: 2371 IPAGF--ANFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEY 2544
            +P  F  +  PA   EY  A  ++P ++  +            ++   +N EY      +
Sbjct: 776  LPQSFSISTLPAQAIEYCFAFIQVPADEDARADVVDNVVRDIQNTQCLLNVEYSGAGCPH 835

Query: 2545 VTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGD 2724
            VT+ +   + K D+G  L+ EGL + + R+E +   L+ +Y   +E A+ +R N+W YGD
Sbjct: 836  VTLQFT--DSKDDVGLGLVKEGLVMVEVRKEKQFHKLIGEYVAAQESAKAARLNLWRYGD 893

Query: 2725 FTGND 2739
            F  +D
Sbjct: 894  FRADD 898


>gi|33869218|gb|AAH17180.2| Staphylococcal nuclease domain containing
            1 [Homo sapiens]
          Length = 885

 Score =  686 bits (1769), Expect = 0.0
 Identities = 379/898 (42%), Positives = 540/898 (59%), Gaps = 15/898 (1%)
 Frame = +1

Query: 91   VLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYAWDSREYL 261
            VLSG A+I++GQP  GPPPE  + LSN+ A  L RR   +   A  TPDEP+A+ +RE+L
Sbjct: 2    VLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDAKDTPDEPWAFPAREFL 61

Query: 262  RQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGKVADE- 438
            R+KL+G+ V F  +     GR++G IYLG     + EN+AE  V+ GL   R+G  A+
Sbjct: 62   RKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLATRREGMRANNP 119

Query: 439  YSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRD 612
               +L E +EQAK+A +G W+   G  TIRD+++ I+NPR  VD + QKP++A+IE VRD
Sbjct: 120  EQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRD 179

Query: 613  GSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQII 792
            GS VRA LLP++  +T+ LSG++ P+ R                       LLQRDVQII
Sbjct: 180  GSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQII 239

Query: 793  LESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLR 972
            LES  NQN +G+I+HP GNI E LL+EG+A+CVDWSI + T GA+KLR AER AKE+RLR
Sbjct: 240  LESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLR 299

Query: 973  LWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKA 1152
            +W+ Y   ++      K F  KV++++ +DA+VV+ + G    +HLSSIR PR  G++
Sbjct: 300  IWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGEN-- 357

Query: 1153 TGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENFPEKTCAT 1314
            T    ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++P S        F E+TCAT
Sbjct: 358  TQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCAT 417

Query: 1315 IKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKTAEKK 1494
            + IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 + K   +
Sbjct: 418  VTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKK---EV 474

Query: 1495 DTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGIN 1674
              HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LITFLL GI
Sbjct: 475  PIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIE 534

Query: 1675 CPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDG 1854
            CP+GAR  PG V  G            T++LVLQ EV++EVES DK GNF+G+L++  DG
Sbjct: 535  CPRGARNLPGLVQEG--EPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHI--DG 590

Query: 1855 NTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXXXXX 2034
                  NLS  LVE+ L+ +HFTAERS +Y                    +
Sbjct: 591  -----ANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAHY--EEQPVEE 643

Query: 2035 XXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGS 2214
                 +  ER  +++ V VT+I    L F  Q++E G ++EK+   MR  +A HPP+ GS
Sbjct: 644  VMPVLEEKERSASYKPVFVTEITDD-LHFYVQDVETGTQLEKLMENMRNDIASHPPVEGS 702

Query: 2215 YTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQIPAGFAN 2391
            Y  +RG+ C+AKF  DG+WYR +VE V +  +  + YIDYGNRE + + +L  +   F+
Sbjct: 703  YAPRRGEFCIAKF-VDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFST 761

Query: 2392 --FPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTVYYDS 2565
               PA   EY  A  ++P +D  +  +         ++   +N E+      +VT+ +
Sbjct: 762  RVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHVTLQF-- 819

Query: 2566 GNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTGND 2739
             + K D+G  L+ EGL + + R+E + Q ++ +Y   +E A+ +R N+W YGDF  +D
Sbjct: 820  ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADD 877



 Score = 70.9 bits (172), Expect = 2e-10
 Identities = 80/328 (24%), Positives = 145/328 (43%), Gaps = 25/328 (7%)
 Frame = +1

Query: 82   VKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDSASATP----DEPYAWDS 249
            V  VL+ DA++++    +      T++LS++  PRL    T   +       D PY +++
Sbjct: 322  VMQVLNADAIVVKLNSGDYK----TIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEA 377

Query: 250  REYLRQKLVGQFVTFVRDFT-----------ATSGRDHGRIYLGGTSPADAENVAEGAVS 396
            RE+LR+KL+G+ V    D+            A S R    + +GG       N+AE  VS
Sbjct: 378  REFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGI------NIAEALVS 431

Query: 397  AGLLEVRQGKVADEYST----KLLELQEQAKSAGRGKWNSNAGTIRDIRWVIDNPRELVD 564
             GL  V + +  D+  +    +LL  + +A   G+G  +     I  +  +  + ++
Sbjct: 432  KGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQ 491

Query: 565  --KYAQKP--IDAVIEMVRDGSTVRAFLLPNFEYITLQLSGVRAP-STRNPNAADXXXXX 729
               + Q+    +AV+E V  GS ++ +L      IT  L+G+  P   RN
Sbjct: 492  FLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEP 551

Query: 730  XXXXXXXXXXXXLLQRDVQIILESTSNQ-NFVGSIVHPKGNIAESLLREGYAKCVDWSIG 906
                        +LQR+V++ +ES     NF+G +     N++  L+    +K V ++
Sbjct: 552  FSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSK-VHFTAE 610

Query: 907  LCTGGAQKLRDAERQAKEKRLRLWKSYQ 990
              +   + L  AE  AK+K+ ++W  Y+
Sbjct: 611  R-SSYYKSLLSAEEAAKQKKEKVWAHYE 637


>gi|7657431|ref|NP_055205.1| staphylococcal nuclease domain containing
            1; EBNA-2 co-activator (100kD); EBNA2 coactivator p100
            [Homo sapiens]
 gi|7512259|pir||I38968 100 kDa coactivator - human
 gi|799177|gb|AAA80488.1| 100 kDa coactivator
          Length = 885

 Score =  685 bits (1767), Expect = 0.0
 Identities = 379/898 (42%), Positives = 539/898 (59%), Gaps = 15/898 (1%)
 Frame = +1

Query: 91   VLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYAWDSREYL 261
            VLSG A+I++GQP  GPPPE  + LSN+ A  L RR   +   A  TPDEP+A+ +RE+L
Sbjct: 2    VLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDAKDTPDEPWAFPAREFL 61

Query: 262  RQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGKVADE- 438
            R+KL+G+ V F  +     GR++G IYLG     + EN+AE  V+ GL   R+G  A+
Sbjct: 62   RKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLATRREGMRANNP 119

Query: 439  YSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRD 612
               +L E +EQAK+A +G W+   G  TIRD+++ I+NPR  VD + QKP++A+IE VRD
Sbjct: 120  EQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRD 179

Query: 613  GSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQII 792
            GS VRA LLP++  +T+ LSG++ P+ R                       LLQRDVQII
Sbjct: 180  GSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQII 239

Query: 793  LESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLR 972
            LES  NQN VG+I+HP GNI E LL+EG+A+CVDWSI + T GA+KLR AER AKE+RLR
Sbjct: 240  LESCHNQNIVGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLR 299

Query: 973  LWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKA 1152
            +W+ Y   ++      K F  KV++++ +DA+VV+ + G    +HLSSIR PR  G++
Sbjct: 300  IWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGEN-- 357

Query: 1153 TGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENFPEKTCAT 1314
            T    ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++P S        F E+TCAT
Sbjct: 358  TQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCAT 417

Query: 1315 IKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKTAEKK 1494
            + IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 + K   +
Sbjct: 418  VTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKK---EV 474

Query: 1495 DTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGIN 1674
              HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LITFLL GI
Sbjct: 475  PIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIE 534

Query: 1675 CPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDG 1854
            CP+GAR  PG V  G            T++LVLQ EV++EVES DK GNF+G+L++  DG
Sbjct: 535  CPRGARNLPGLVQEG--EPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHI--DG 590

Query: 1855 NTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXXXXX 2034
                  NLS  LVE+ L+ +HFTAERS +Y                    +
Sbjct: 591  -----ANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAHY--EEQPVEE 643

Query: 2035 XXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGS 2214
                 +  ER  +++ V VT+I    L F  Q++E G + +K+   MR  +A HPP+ GS
Sbjct: 644  VMPVLEEKERSASYKPVFVTEITDD-LHFYVQDVETGTQFQKLMENMRNDIASHPPVEGS 702

Query: 2215 YTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQIPAGFAN 2391
            Y  +RG+ C+AKF  DG+WYR +VE V +  +  + YIDYGNRE + + +L  +   F+
Sbjct: 703  YAPRRGEFCIAKF-VDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFST 761

Query: 2392 --FPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTVYYDS 2565
               PA   EY  A  ++P +D  +  +         ++   +N E+      +VT+ +
Sbjct: 762  RVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHVTLQF-- 819

Query: 2566 GNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTGND 2739
             + K D+G  L+ EGL + + R+E + Q ++ +Y   +E A+ +R N+W YGDF  +D
Sbjct: 820  ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADD 877



 Score = 70.9 bits (172), Expect = 2e-10
 Identities = 80/328 (24%), Positives = 145/328 (43%), Gaps = 25/328 (7%)
 Frame = +1

Query: 82   VKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDSASATP----DEPYAWDS 249
            V  VL+ DA++++    +      T++LS++  PRL    T   +       D PY +++
Sbjct: 322  VMQVLNADAIVVKLNSGDYK----TIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEA 377

Query: 250  REYLRQKLVGQFVTFVRDFT-----------ATSGRDHGRIYLGGTSPADAENVAEGAVS 396
            RE+LR+KL+G+ V    D+            A S R    + +GG       N+AE  VS
Sbjct: 378  REFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGI------NIAEALVS 431

Query: 397  AGLLEVRQGKVADEYST----KLLELQEQAKSAGRGKWNSNAGTIRDIRWVIDNPRELVD 564
             GL  V + +  D+  +    +LL  + +A   G+G  +     I  +  +  + ++
Sbjct: 432  KGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQ 491

Query: 565  --KYAQKP--IDAVIEMVRDGSTVRAFLLPNFEYITLQLSGVRAP-STRNPNAADXXXXX 729
               + Q+    +AV+E V  GS ++ +L      IT  L+G+  P   RN
Sbjct: 492  FLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEP 551

Query: 730  XXXXXXXXXXXXLLQRDVQIILESTSNQ-NFVGSIVHPKGNIAESLLREGYAKCVDWSIG 906
                        +LQR+V++ +ES     NF+G +     N++  L+    +K V ++
Sbjct: 552  FSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSK-VHFTAE 610

Query: 907  LCTGGAQKLRDAERQAKEKRLRLWKSYQ 990
              +   + L  AE  AK+K+ ++W  Y+
Sbjct: 611  R-SSYYKSLLSAEEAAKQKKEKVWAHYE 637


>gi|37514837|gb|AAH07126.2| Snd1-pending protein [Mus musculus]
          Length = 885

 Score =  684 bits (1766), Expect = 0.0
 Identities = 377/898 (41%), Positives = 538/898 (58%), Gaps = 15/898 (1%)
 Frame = +1

Query: 91   VLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYAWDSREYL 261
            VLSG A+I++GQP  GPPPE  + LSN+ A  L RR   +      TPDEP+A+ +RE+L
Sbjct: 2    VLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWAFPAREFL 61

Query: 262  RQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGKVADE- 438
            R+KL+G+ V F  +     GR++G IYLG     + EN+AE  V+ GL   R+G  A+
Sbjct: 62   RKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLATRREGMRANNP 119

Query: 439  YSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRD 612
               +L E +EQAK++ +G W+   G  TIRD+++ I+NPR  VD + QKP++A+IE VRD
Sbjct: 120  EQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRD 179

Query: 613  GSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQII 792
            GS VRA LLP    +T+ LSG++ P+ R                       LLQRDVQII
Sbjct: 180  GSVVRALLLPGHHLVTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQII 239

Query: 793  LESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLR 972
            LES  NQN +G+I+HP GNI E LL+EG+A+CVDWSI + T GA+KLR AER AKE+RLR
Sbjct: 240  LESCHNQNLLGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLR 299

Query: 973  LWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKA 1152
            +W+ Y P ++      K F  KV++++ +DA+VV+ + G    +HLSSIR PR  GD+
Sbjct: 300  IWRDYVPPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGDN-- 357

Query: 1153 TGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENFPEKTCAT 1314
                 ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++P S        F E+TCAT
Sbjct: 358  IQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCAT 417

Query: 1315 IKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKTAEKK 1494
            + IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 + K   +
Sbjct: 418  VTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKK---EV 474

Query: 1495 DTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGIN 1674
              HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LITFLL GI
Sbjct: 475  PIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIE 534

Query: 1675 CPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDG 1854
            CP+GAR  PG V  G            T++LVLQ EV++EVES DK GNF+G+L++  DG
Sbjct: 535  CPRGARNLPGLVQEG--EPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHM--DG 590

Query: 1855 NTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXXXXX 2034
                  NLS  LVE  L+ +HFTAERS +Y                    +
Sbjct: 591  -----ANLSVLLVEQALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWAHY--EERPVEE 643

Query: 2035 XXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGS 2214
                 +  ER  +++ V VT+I    L F  Q++E G ++EK+   MR  ++ HPP+ GS
Sbjct: 644  VMPVLEEKERSASYKPVFVTEITDD-LHFYVQDVETGTQLEKLMENMRNDISSHPPVEGS 702

Query: 2215 YTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQIPAGFAN 2391
            Y  +RG+ C+AKF  DG+WYR +VE V +  +  + YIDYGNRE + + +L  +P  F+
Sbjct: 703  YAPRRGEFCIAKF-VDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGTLPPAFST 761

Query: 2392 --FPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTVYYDS 2565
               PA   EY  A  ++P ++  +  +         ++   +N E+   +  +VT+ +
Sbjct: 762  RVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSASCPHVTLQF-- 819

Query: 2566 GNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTGND 2739
             + K D+G  L+ EGL + + R+E + Q ++ +Y   +E A+ +R N+W YGDF  +D
Sbjct: 820  ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADD 877


>gi|47939011|gb|AAH72471.1| Unknown (protein for MGC:91679) [Rattus
            norvegicus]
          Length = 885

 Score =  684 bits (1764), Expect = 0.0
 Identities = 376/898 (41%), Positives = 540/898 (59%), Gaps = 15/898 (1%)
 Frame = +1

Query: 91   VLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYAWDSREYL 261
            VLSG A+I++GQP  GPPPE  + LSN+ A  L RR   +      TPDEP+A+ +RE+L
Sbjct: 2    VLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWAFPAREFL 61

Query: 262  RQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGKVADE- 438
            R+KL+G+ V F  +     GR++G IYLG     + EN+AE  V+ GL   R+G  A+
Sbjct: 62   RKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLASRREGMRANNP 119

Query: 439  YSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRD 612
               +L E +EQAK++ +G W+   G  TIRD+++ I+NPR  VD + QKP++A+IE VRD
Sbjct: 120  EQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRD 179

Query: 613  GSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQII 792
            GS VRA LLP+   +T+ LSG++ P+ R                       LLQRDVQII
Sbjct: 180  GSVVRALLLPDHYLVTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQII 239

Query: 793  LESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLR 972
            LES  NQN +G+I+HP GNI E LL+EG+A+CVDWSI + T GA+KLR AER AKE+RLR
Sbjct: 240  LESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLR 299

Query: 973  LWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKA 1152
            +W+ Y P ++      K F  KV++++ +DA+VV+ + G    +HLSSIR PR  GD+
Sbjct: 300  IWRDYVPPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGDN-- 357

Query: 1153 TGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENFPEKTCAT 1314
                 ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++P S        F E+TCAT
Sbjct: 358  IQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVSVTVDYIRPASPATETVPAFSERTCAT 417

Query: 1315 IKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKTAEKK 1494
            + IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 + K   +
Sbjct: 418  VTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKK---EV 474

Query: 1495 DTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGIN 1674
              HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LITFLL GI
Sbjct: 475  PIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIE 534

Query: 1675 CPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDG 1854
            CP+GAR  PG V  G            T++LVLQ EV++EVES DK GNF+G+L++  DG
Sbjct: 535  CPRGARNLPGLVQEG--EPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHM--DG 590

Query: 1855 NTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXXXXX 2034
                  NLS  LVE+ L+ +HFTAERS +Y                    +
Sbjct: 591  -----ANLSVLLVEHALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWAHY--EEQPVEE 643

Query: 2035 XXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGS 2214
                 +  ER  +++ V VT+I    L F  Q++E G ++EK+   MR  ++ HPP+ G+
Sbjct: 644  VMPVLEEKERSASYKPVFVTEITDD-LHFYVQDVETGTQLEKLMENMRSDISSHPPVEGA 702

Query: 2215 YTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQIPAGFAN 2391
            Y  +RG+ C+AKF  DG+WYR +VE V +  +  + YIDYGNRE + + +L  +P  F+
Sbjct: 703  YAPRRGEFCIAKF-VDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGALPPAFST 761

Query: 2392 --FPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTVYYDS 2565
               PA   EY  A  ++P ++  +  +         ++   +N E+   +  +VT+ +
Sbjct: 762  RVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSASCPHVTLQF-- 819

Query: 2566 GNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTGND 2739
             + K D+G  L+ EGL + + R+E + Q ++ +Y   +E A+ +R N+W YGDF  +D
Sbjct: 820  ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADD 877


>gi|9790067|ref|NP_062750.1| staphylococcal nuclease domain containing
            1; p100 co-activator [Mus musculus]
 gi|6009521|dbj|BAA84944.1| p100 co-activator [Mus musculus]
          Length = 882

 Score =  683 bits (1762), Expect = 0.0
 Identities = 376/898 (41%), Positives = 537/898 (58%), Gaps = 15/898 (1%)
 Frame = +1

Query: 91   VLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYAWDSREYL 261
            VLSG A+I++GQP  GPPPE  + LSN+ A  L RR   +      TPDEP+A+ +RE+L
Sbjct: 2    VLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWAFPAREFL 61

Query: 262  RQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGKVADE- 438
            R+KL+G+ V F  +     GR++G IYLG     + EN+AE  V+ GL   R+G  A+
Sbjct: 62   RKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLATRREGMRANNP 119

Query: 439  YSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRD 612
               +L E +EQAK++ +G W+   G  TIRD+++ I+NPR  VD + QKP++A+IE VRD
Sbjct: 120  EQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRD 179

Query: 613  GSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQII 792
            GS  RA LLP    +T+ LSG++ P+ R                       LLQRDVQII
Sbjct: 180  GSVARALLLPGHHLVTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQII 239

Query: 793  LESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLR 972
            LES  NQN +G+I+HP GNI E LL+EG+A+CVDWSI + T GA+KLR AER AKE+RLR
Sbjct: 240  LESCHNQNLLGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLR 299

Query: 973  LWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKA 1152
            +W+ Y P ++      K F  KV++++ +DA+VV+ + G    +HLSSIR PR  GD+
Sbjct: 300  IWRDYVPPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGDN-- 357

Query: 1153 TGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENFPEKTCAT 1314
                 ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++P S        F E+TCAT
Sbjct: 358  IQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCAT 417

Query: 1315 IKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKTAEKK 1494
            + IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 + K   +
Sbjct: 418  VTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKK---EV 474

Query: 1495 DTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGIN 1674
              HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LITFLL GI
Sbjct: 475  PIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIE 534

Query: 1675 CPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDG 1854
            CP+GAR  PG V  G            T++LVLQ EV++EVES DK GNF+G+L++  DG
Sbjct: 535  CPRGARNLPGLVQEG--EPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHM--DG 590

Query: 1855 NTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXXXXX 2034
                  NLS  LVE  L+ +HFTAERS +Y                    +
Sbjct: 591  -----ANLSVLLVEQALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWAHY--EERPVEE 643

Query: 2035 XXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGS 2214
                 +  ER  +++ V VT+I    L F  Q++E G ++EK+   MR  ++ HPP+ GS
Sbjct: 644  VMPVLEEKERSASYKPVFVTEITDD-LHFYVQDVETGTQLEKLMENMRNDISSHPPVEGS 702

Query: 2215 YTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQIPAGFAN 2391
            Y  +RG+ C+AKF  DG+WYR +VE V +  +  + YIDYGNRE + + +L  +P  F+
Sbjct: 703  YAPRRGEFCIAKF-VDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGTLPPAFST 761

Query: 2392 --FPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTVYYDS 2565
               PA   EY  A  ++P ++  +  +         ++   +N E+   +  +VT+ +
Sbjct: 762  RVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSASCPHVTLQF-- 819

Query: 2566 GNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTGND 2739
             + K D+G  L+ EGL + + R+E + Q ++ +Y   +E A+ +R N+W YGDF  +D
Sbjct: 820  ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADD 877


>gi|33504513|ref|NP_878285.1| staphylococcal nuclease domain
            containing 1 [Danio rerio]
 gi|30351169|gb|AAP23062.1| p100 co-activator variant 1 [Danio rerio]
          Length = 888

 Score =  681 bits (1757), Expect = 0.0
 Identities = 373/901 (41%), Positives = 539/901 (59%), Gaps = 18/901 (1%)
 Frame = +1

Query: 91   VLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYAWDSREYL 261
            VLSG A+I++GQP  GPPPE  + LSN+ A  L RR          TPDEP+A+ +RE++
Sbjct: 2    VLSGCAIIVRGQPRGGPPPERQINLSNIRAGALARRAIQGQPDTKDTPDEPWAFQAREFM 61

Query: 262  RQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGKVA--D 435
            R+K++G+ V F  +     GR++G +YLG       EN+AE  V+ GL  VR+  +   +
Sbjct: 62   RKKVIGKEVCFTVENKTPQGREYGMVYLG--KDTSGENIAESLVAEGLAMVRREGIRGNN 119

Query: 436  EYSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDAVIEMVR 609
                +L +L++QAKS+ +G W+   G  TIRD+++ I+NPR  VD   QKP++A+IE VR
Sbjct: 120  PEQVRLCDLEDQAKSSKKGLWSEGGGSHTIRDLKYTIENPRNFVDSLHQKPVNAIIEHVR 179

Query: 610  DGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQI 789
            DG  VRA LLP++  +T+ LSG+++P+ +                       LLQRDVQI
Sbjct: 180  DGCMVRALLLPDYYLVTVMLSGIKSPTFKREADGSETPEPFAAEAKFFTESRLLQRDVQI 239

Query: 790  ILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRL 969
            ILES  NQ  +G+I+HP GNI E LL+EG+A+CVDWS+ + T GA+KLR AER AKE+++
Sbjct: 240  ILESCPNQVILGTILHPNGNITELLLKEGFARCVDWSMAVYTQGAEKLRAAERSAKERKV 299

Query: 970  RLWKSY-QPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDD 1146
            R+WK Y  PT++    DR+ F  KV+++V +DA+VV+ + G    +HLSSIR PR  G++
Sbjct: 300  RIWKDYVAPTANLDQKDRQ-FVAKVMQVVNADAIVVKLNSGEYKTIHLSSIRPPRLEGEE 358

Query: 1147 KATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKSE-------NFPEKT 1305
            K      ++FRPLYDIP+MF+AREFLRK+L+GKKV + +DY++  +         FPE+T
Sbjct: 359  K-NKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATNAMEMGVPAFPERT 417

Query: 1306 CATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKTA 1485
            CAT+ IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 + K
Sbjct: 418  CATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKK-- 475

Query: 1486 EKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLG 1665
             +   HR+ +I+G+  KAKQF P+LQR GR+E VVE++  GSRL++Y+PKET LITFLL
Sbjct: 476  -EVPIHRVADISGETQKAKQFFPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLA 534

Query: 1666 GINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVS 1845
            GI CP+G+R  PGG+               T++LVLQ EV++EVES DK GNF+G+L++
Sbjct: 535  GIECPRGSRNMPGGMQV--AEPYSEEAMLFTKELVLQREVEVEVESMDKAGNFIGWLHI- 591

Query: 1846 PDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXX 2025
                    +NLS ALVEN L+ +HFTAERS +Y                    +
Sbjct: 592  ------EGVNLSVALVENALSKVHFTAERSSYYKTLVSAEESARQRKEKLWANYEEKPKE 645

Query: 2026 XXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPL 2205
                   A   ER   +R V VT+I  G L F AQ++E G K+E +   MR  +A  PP+
Sbjct: 646  EVAQVTEA--KERVAKYRSVYVTEITDG-LHFYAQDVETGTKLENLMESMRGEIAAQPPV 702

Query: 2206 AGSYTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQIPAG 2382
             GS+  +RG+ C+AKF+ DG+WYR + E V +  +  + YIDYGNRE + + +LA +P
Sbjct: 703  EGSFAPRRGEFCIAKFA-DGEWYRARFEKVESPAKVHVFYIDYGNREVLSSTRLAALPPA 761

Query: 2383 FA--NFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTVY 2556
            F+    P    EY  A  ++P ++  +  +         ++   +N EY       VT+
Sbjct: 762  FSTRTLPPQATEYAFAYIQVPQDEDARADAVDSVVRDIHNTQCLLNVEYSGSVCPQVTLQ 821

Query: 2557 YDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTGN 2736
            +   + K D+G  L+ EG+ + D R+E  LQ +V +Y   +E A+ +R NIW YGDF  +
Sbjct: 822  F--ADTKEDVGLGLVKEGMVMVDIRKEKYLQKMVTEYLNAQESAKSARLNIWRYGDFRDD 879

Query: 2737 D 2739
            D
Sbjct: 880  D 880


>gi|45361211|ref|NP_989183.1| hypothetical protein MGC76153 [Xenopus
            tropicalis]
 gi|38649109|gb|AAH63211.1| Hypothetical protein MGC76153 [Xenopus
            tropicalis]
          Length = 885

 Score =  681 bits (1757), Expect = 0.0
 Identities = 375/898 (41%), Positives = 540/898 (59%), Gaps = 15/898 (1%)
 Frame = +1

Query: 91   VLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYAWDSREYL 261
            VLSG A+I++GQP  GPPPE  + LSN+    L RR   S   A  TPDEP+A+ +RE+L
Sbjct: 2    VLSGCAIIVRGQPRGGPPPERQINLSNIRTGALARRAAASQQDAKDTPDEPWAFPAREFL 61

Query: 262  RQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGKVADE- 438
            R+KL+G+ V F  DF ++ GR++G +YLG       EN+AE  V+ GL   R+G  A+
Sbjct: 62   RKKLIGKEVCFTVDFKSSQGREYGMVYLG--KDTSGENIAESLVAEGLASRREGVRANTP 119

Query: 439  YSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRD 612
              ++L E++EQA+SA +G W+   G  T+RD+++ I+NPR  VD   QKP++A+IE VRD
Sbjct: 120  EQSRLAEVEEQARSAKKGVWSEGTGSQTVRDLKYTIENPRHFVDSMHQKPVNAIIEHVRD 179

Query: 613  GSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQII 792
            GS VRA LLP+   +T+ LSG++ P+ +                       LLQRDVQII
Sbjct: 180  GSVVRALLLPDCYLVTVMLSGIKCPTFKREADGTETPEPFAAEAKFFTESRLLQRDVQII 239

Query: 793  LESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLR 972
            LES  NQN +G+I+HP GNI E LL+EG+A+CVDW I + T G++KLR AER AKE + R
Sbjct: 240  LESCHNQNILGTILHPNGNITELLLKEGFARCVDWCIAVYTQGSEKLRAAERFAKEHKTR 299

Query: 973  LWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKA 1152
            +W+ Y   ++      K F  KVV+I+ +DA+VV+ + G    +HLSSIR PR  G+
Sbjct: 300  IWRDYVAPTANLDQKDKQFVAKVVQILNADAMVVKLNSGDYKTIHLSSIRPPRLEGE--G 357

Query: 1153 TGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENFPEKTCAT 1314
                 ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++  S        FPE+TCAT
Sbjct: 358  AQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVNVDYIRSASAATETVPAFPERTCAT 417

Query: 1315 IKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKTAEKK 1494
            + IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 + K   +
Sbjct: 418  VTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNAKGLHSKK---EV 474

Query: 1495 DTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGIN 1674
              HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LITFLL GI
Sbjct: 475  PIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLAGIE 534

Query: 1675 CPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDG 1854
            CP+G+R  P GV  G            T++LVLQ EV++EVE+ DK GNF+G+L+V  DG
Sbjct: 535  CPRGSRNMPSGVQEG--EPFSEEATLFTKELVLQREVEVEVEAMDKAGNFIGWLHV--DG 590

Query: 1855 NTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXXXXX 2034
                 +N+S ALVE+ L+ +HFTAERS +Y                    F
Sbjct: 591  -----VNISVALVEHALSKVHFTAERSNYYKTLLAAEEGPKQRKEKVWSKF--EEQPVEE 643

Query: 2035 XXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGS 2214
                 +  ER  N++ V VT+I    L F  Q++E G ++EK+   MR  +A +PPL GS
Sbjct: 644  VVTVVEEKERNANYKPVLVTEIT-DELHFYIQDVETGTQLEKLMESMRSEIASNPPLEGS 702

Query: 2215 YTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQIPAGFA- 2388
            ++ +RGD C+AK+  DG+WYR +VE V +  +  + YIDYGNRE + + +L  +P  F+
Sbjct: 703  FSPRRGDYCIAKY-MDGEWYRARVEKVESVAKVHVFYIDYGNREVLPSTRLGPLPQSFST 761

Query: 2389 -NFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTVYYDS 2565
               PA   EY  A  ++P ++  +            ++   +N E+      +VT+ +
Sbjct: 762  RTLPAQAIEYCFAFIQVPADEDARADVVDNVVRDIQNTQCLLNVEHSGAGCPHVTLQF-- 819

Query: 2566 GNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTGND 2739
             + K D+G  L+ EGL + + R+E + Q ++ +Y + +E A+ +R N+W YGDF  +D
Sbjct: 820  ADSKEDVGLGLVKEGLVMVEVRKEKQFQKVIAEYVSAQESAKAARLNLWRYGDFRADD 877


>gi|20130403|ref|NP_612021.1| CG7008-PA [Drosophila melanogaster]
 gi|7291949|gb|AAF47366.1| CG7008-PA [Drosophila melanogaster]
 gi|27819982|gb|AAO25027.1| LD20211p [Drosophila melanogaster]
          Length = 926

 Score =  681 bits (1756), Expect = 0.0
 Identities = 393/913 (43%), Positives = 536/913 (58%), Gaps = 25/913 (2%)
 Frame = +1

Query: 76   GLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDSASATPDEPYAWDSRE 255
            G+VK VLSGD V+++      PPPE  +  S+V AP+L RRP      T DEP+AW+SRE
Sbjct: 27   GIVKQVLSGDTVVIRATK-GAPPPEKQITFSHVLAPKLARRPGAGGDETKDEPWAWESRE 85

Query: 256  YLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVR-QGKVA 432
            +LR+KL+G  VTF  D  A S R++G +++G       ENV E  V  GL+ VR +G+
Sbjct: 86   FLRKKLIGVEVTFTFDKPANSNREYGFVWIGKDKET-GENVVESIVREGLVSVRREGRPT 144

Query: 433  DEYSTKLLELQEQAKSAGRGKWN---SNAGTIRDIRWVIDNPRELVDKYAQKPIDAVIEM 603
             E  T L+EL++QA++AGRGKW+   S A  +R+I+W  +NP  LVD Y   P+ A+IE
Sbjct: 145  AEQQT-LIELEDQARAAGRGKWSPTASAADKVRNIKWSHENPAHLVDIYGGNPVKAIIEH 203

Query: 604  VRDGSTVRAFLLPNFEYITLQLSGVRAPSTR-----NPNAADXXXXXXXXXXXXXXXXXL 768
            VRDGSTVRAFLLP+F YITL +SG+R P  +      P+ +                  L
Sbjct: 204  VRDGSTVRAFLLPDFHYITLMISGIRCPGVKLDADGKPDLS--VKVPFADEARYYVETRL 261

Query: 769  LQRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAER 948
            LQRDV+I LES +N NF+G+I++PKGNIAESLLREG AKCVDWS+ +   G  KLR AER
Sbjct: 262  LQRDVEIRLESVNNSNFIGTILYPKGNIAESLLREGLAKCVDWSMAVMKTGTDKLRAAER 321

Query: 949  QAKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLP 1128
             AKEKRLR W+ YQ  + A++   K F+G VVE+   DA+ V+  +G   K+  SSIR P
Sbjct: 322  FAKEKRLRQWQDYQAKTPAFNSKEKDFSGTVVEVFNGDAINVRLSNGQVKKVFFSSIRPP 381

Query: 1129 RESGDDKATGGP--------GRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS 1284
            R+      T G         G+ +RPLY+IP MF AREFLRK+L+ KKVQ  +DY+ P
Sbjct: 382  RDQRAVVGTDGEEIVKAPPRGKNYRPLYEIPHMFDAREFLRKKLINKKVQCNLDYISPPR 441

Query: 1285 ENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXX 1464
            ENFPEK C T+ IG QN+AE ++++GL+  VR+R DD+ RSS YD
Sbjct: 442  ENFPEKYCYTVSIGGQNVAEAMVAKGLATCVRYRQDDDQRSSAYDQLIAAEQQAIKGLKG 501

Query: 1465 XFADKTAEKKDTHRIQEITGDLAKAK-QFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKET 1641
              A K      T R+ ++T D ++ K Q+LP  QR  R E +VEF++ GSRLRI++PK++
Sbjct: 502  LHAKK---DNATLRVNDLTVDHSRIKVQYLPSWQRALRTEAIVEFVASGSRLRIFVPKDS 558

Query: 1642 VLITFLLGGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNG- 1818
             L+TFLL GI+CP+ +R    GV               TR+ VLQ +V + +++TDK G
Sbjct: 559  CLVTFLLAGISCPRSSRPALNGVPAQEGEPFGDEALTFTRERVLQRDVSVHIDTTDKAGS 618

Query: 1819 NFVGYLYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXX 1998
            + +G+L+      T    NLS ALVE GLA +HF+AE+S +Y
Sbjct: 619  SVIGWLW------TDSGANLSVALVEEGLAEVHFSAEKSEYYRQLKIAEDRAKAAKKNIW 672

Query: 1999 XXFTXXXXXXXXXXXXAD----TSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMT 2166
              +                    +ERK N+  V VT+I    L F AQ++E G K+E +
Sbjct: 673  TNYVEEVPKEKTVTEEEKEDKVVAERKVNYENVIVTEITE-TLTFFAQSVESGSKLESLM 731

Query: 2167 TEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQAEIVYIDYGNRET 2346
            +++      +PP+AGSYT KRGDL  A+F+ D QWYR KVE V+   A ++YIDYGN+ET
Sbjct: 732  SKLHADFQSNPPIAGSYTPKRGDLVAAQFTLDNQWYRAKVERVQGSNATVLYIDYGNKET 791

Query: 2347 IEAVKLAQIPAGFANFPAGVREYNLALAKLP--NEDYVQLTSDAFAQYLFGHSSVFINSE 2520
            +   +LA +P  F++      EY LAL  LP  NED  +    AF++ +  H  V +N E
Sbjct: 792  LPTNRLAALPPAFSSEKPYATEYALALVALPTDNEDKEEALR-AFSEDVLNH-KVQLNVE 849

Query: 2521 YKVGTSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSR 2700
             KV  S  +    D    KVD GK L+AEGL LA+ R E +L+ LV+ Y   +E AR +
Sbjct: 850  LKVTGSPNLATLRDP-TTKVDFGKQLVAEGLVLAEQRGERKLKELVDQYKAAQEAARVAH 908

Query: 2701 KNIWEYGDFTGND 2739
              IW+YGD T +D
Sbjct: 909  LAIWKYGDITQDD 921


>gi|50417388|gb|AAH77133.1| Staphylococcal nuclease domain containing
            1 [Danio rerio]
          Length = 888

 Score =  679 bits (1753), Expect = 0.0
 Identities = 373/901 (41%), Positives = 539/901 (59%), Gaps = 18/901 (1%)
 Frame = +1

Query: 91   VLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYAWDSREYL 261
            VLSG A+I++GQP  GPPPE  + LSN+ A  L RR          TPDEP+A+ +RE++
Sbjct: 2    VLSGCAIIVRGQPRGGPPPERQINLSNIRAGALARRAIQGQPDTKDTPDEPWAFQAREFM 61

Query: 262  RQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGKVA--D 435
            R+K++G+ V F  +     GR++G +YLG       EN+AE  V+ GL  VR+  +   +
Sbjct: 62   RKKVIGKEVCFTVENKTPQGREYGMVYLG--KDTSGENIAESLVAEGLAMVRREGIRGNN 119

Query: 436  EYSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDAVIEMVR 609
                +L +L++QAKS+ +G W+   G  TIRD+++ I+NPR  VD   QKP++A+IE VR
Sbjct: 120  PEQVRLCDLEDQAKSSKKGLWSEGGGSHTIRDLKYTIENPRNFVDSLHQKPVNAIIEHVR 179

Query: 610  DGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQI 789
            DG  VRA LLP++  +T+ LSG+++P+ +                       LLQRDVQI
Sbjct: 180  DGCMVRALLLPDYYLVTVMLSGIKSPTFKREADGSETPEPFAAEAKFFTESRLLQRDVQI 239

Query: 790  ILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRL 969
            ILES  NQ  +G+I+HP GNI E LL+EG+A+CVDWS+ + T GA+KLR AER AKE+++
Sbjct: 240  ILESCPNQVILGTILHPNGNITELLLKEGFARCVDWSMAVYTQGAEKLRAAERSAKERKV 299

Query: 970  RLWKSY-QPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDD 1146
            R+WK Y  PT++    DR+ F  KV+++V +DA+VV+ + G    +HLSSIR PR  G++
Sbjct: 300  RIWKDYVAPTANLDQKDRQ-FVAKVMQVVNADAIVVKLNSGEYKTIHLSSIRPPRLEGEE 358

Query: 1147 KATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKSE-------NFPEKT 1305
            K      ++FRPLYDIP+MF+AREFLRK+L+GKKV + +DY++  +         FPE+T
Sbjct: 359  K-NKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATNAMEMGVPAFPERT 417

Query: 1306 CATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKTA 1485
            CAT+ IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 + K
Sbjct: 418  CATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKK-- 475

Query: 1486 EKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLG 1665
             +   HR+ +I+G+  KAKQF P+LQR GR+E VVE++  GSRL++Y+PKET LITFLL
Sbjct: 476  -EVPIHRVADISGETQKAKQFFPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLA 534

Query: 1666 GINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVS 1845
            GI CP+G+R  PGG+               T++LVLQ EV++EVES DK GNF+G+L++
Sbjct: 535  GIECPRGSRNMPGGMQV--AEPYSEEAMLFTKELVLQREVEVEVESMDKAGNFIGWLHI- 591

Query: 1846 PDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXX 2025
                    +NLS ALVEN L+ +HFTAERS +                     +
Sbjct: 592  ------EGVNLSVALVENALSKVHFTAERSSYCKTLVSAEESARQRKEKLWANYEEKPKE 645

Query: 2026 XXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPL 2205
                   A   ER   +R V VT+I  G L F AQ++E G K+E +   MR  +A  PP+
Sbjct: 646  EVAQVTEA--KERVAKYRSVYVTEITDG-LHFYAQDVETGTKLENLMESMRGEIAAQPPV 702

Query: 2206 AGSYTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQIPAG 2382
             GS+  +RG+ C+AKF+ DG+WYR +VE V +  +  + YIDYGNRE + + +LA +P
Sbjct: 703  EGSFAPRRGEFCIAKFA-DGEWYRARVEKVESPAKVHVFYIDYGNREVLSSTRLAALPPA 761

Query: 2383 FA--NFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTVY 2556
            F+    P    EY  A  ++P ++  +  +         ++   +N EY       VT+
Sbjct: 762  FSTRTLPPQATEYAFAYIQVPQDEDARADAVDSVVRDIHNTQCLLNVEYSGSVCPQVTLQ 821

Query: 2557 YDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTGN 2736
            +   + K D+G  L+ EG+ + D R+E  LQ +V +Y   +E A+ +R NIW YGDF  +
Sbjct: 822  F--ADTKEDVGLGLVKEGMVMVDIRKEKYLQKMVTEYLNAQESAKSARLNIWRYGDFRDD 879

Query: 2737 D 2739
            D
Sbjct: 880  D 880


>gi|28849222|dbj|BAC65164.1| 4SNc-Tudor domain protein [Seriola
            quinqueradiata]
          Length = 912

 Score =  672 bits (1733), Expect = 0.0
 Identities = 377/907 (41%), Positives = 539/907 (58%), Gaps = 17/907 (1%)
 Frame = +1

Query: 70   RRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYA 240
            +RG+VK VLSG A+I++GQP  GPPPE  + LSN+ A  + RR          TPDEP+A
Sbjct: 19   QRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGAMARRAAQGQPDTKDTPDEPWA 78

Query: 241  WDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ 420
            + +RE+LR+KL+G+ V F  +     GR++G +YLG       EN+AE  V+ GL  VR+
Sbjct: 79   FQAREFLRKKLIGKEVCFTVEIKTALGREYGMVYLG--KDTTGENIAESLVNEGLATVRR 136

Query: 421  GKVA--DEYSTKLLELQEQAKSAGRGKWNSNAGT--IRDIRWVIDNPRELVDKYAQKPID 588
              +   +    +L EL++Q+KS+ +G W+   GT  IRD+++ I+NPR  VD   QKPI+
Sbjct: 137  EGIRGNNPEQARLCELEDQSKSSKKGMWSEGGGTHTIRDMKYTIENPRNSVDSLHQKPIN 196

Query: 589  AVIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXL 768
            A+IE VRDGS VRA LLP++  +T+ LSGV+ P+ +                       L
Sbjct: 197  AIIEHVRDGSVVRALLLPDYYLVTVMLSGVKCPTFKREADGTETPEAFAAEAKFFTESRL 256

Query: 769  LQRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAER 948
            LQRDVQIILES  NQ  +G+I+HP GNI E LL+EG+A+CVDWS+ + T GA+KLR AER
Sbjct: 257  LQRDVQIILESCPNQIILGTILHPNGNITELLLKEGFARCVDWSMAVYTQGAEKLRAAER 316

Query: 949  QAKEKRLRLWKSY-QPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRL 1125
             AKE+++R+WK Y  PT++    DR+ F  KV+++V +DA+VV+ + G    +HLSSIR
Sbjct: 317  SAKERKVRIWKDYVAPTANLDQKDRQ-FVAKVMQVVNADAMVVKLNSGEYKTIHLSSIRP 375

Query: 1126 PRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPK------SE 1287
            PR  G++K      ++FRPLYDIP+MF+AREFLRK+L+GKKV + +DY++        +
Sbjct: 376  PRIEGEEK-NKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATGPGEGTP 434

Query: 1288 NFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXX 1467
             FPE+TCAT+ IG  NIAE L+S+GL  V+R+R DD+ RSS YD
Sbjct: 435  AFPERTCATVTIGGINIAEALVSKGLVTVIRYRQDDDQRSSHYDELLAAEARAIKNGKGL 494

Query: 1468 FADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVL 1647
             + K   +   HR+ +I+G+  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET L
Sbjct: 495  HSKK---EVPIHRVADISGETQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCL 551

Query: 1648 ITFLLGGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFV 1827
            ITFLL GI CP+ +R  PGG+               T++LVLQ EV++EVES DK GNF+
Sbjct: 552  ITFLLAGIECPRSSRNLPGGMQV--AEPFSDEAMLFTKELVLQREVEVEVESMDKAGNFI 609

Query: 1828 GYLYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXF 2007
            G+L++         +NLS ALVEN L+ +HFTAER
Sbjct: 610  GWLHI-------EGVNLSVALVENALSKVHFTAERK-CLLQNAWSQLRRHAGRGKKRSGA 661

Query: 2008 TXXXXXXXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQAL 2187
                               + ++R V VT+I    L F +Q++E G ++E +   MR  +
Sbjct: 662  NYEEKPVEGGCPSIRGERTRGHYRPVYVTEIT-DTLHFYSQDVETGGQLESLMETMRAEI 720

Query: 2188 AEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKL 2364
            A  PP+ GSY+ +R D C+AKF+ DG+WYR +VE V +  +  + YIDYGNRE + + +L
Sbjct: 721  AAQPPVEGSYSARRWDYCIAKFA-DGEWYRARVERVESPAKVHVFYIDYGNREVVTSTRL 779

Query: 2365 AQIPAGFA--NFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTS 2538
            A IP  F+    PA   EY  A   +P ++  +            +S   +N   +V  +
Sbjct: 780  ATIPPAFSTRTLPAQATEYAFAFILIPQDEDARADVVDCVVRDIQNSQCLLNGSTRVPPA 839

Query: 2539 EYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEY 2718
                + +  G+ K D+G  L+ EGL + D R+E  LQ +V +Y  ++E A+ +R NIW Y
Sbjct: 840  HTSRIQF--GDTKDDVGLGLVKEGLVMVDVRKEKYLQKMVTEYLNSQESAKSARLNIWRY 897

Query: 2719 GDFTGND 2739
            GDF  +D
Sbjct: 898  GDFRADD 904


>gi|28372320|dbj|BAC56985.1| 4SNc-Tudor domain protein [Danio rerio]
 gi|30844236|dbj|BAC76712.1| 4SNc-Tudor domain protein long form
            [Danio rerio]
          Length = 897

 Score =  665 bits (1716), Expect = 0.0
 Identities = 370/899 (41%), Positives = 537/899 (59%), Gaps = 18/899 (2%)
 Frame = +1

Query: 70   RRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYA 240
            +RG+VK VLSG A+I++GQP  GPPPE  + LSN+ A  L RR          TPDEP+A
Sbjct: 20   QRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGALARRAIQGQPDTKDTPDEPWA 79

Query: 241  WDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ 420
            + +RE++R+K++G+ V F  +     GR++G +YLG       EN+AE  V+ GL  VR+
Sbjct: 80   FQAREFMRKKVIGKEVCFTVENKTPQGREYGMVYLG--KDTSGENIAESLVAEGLAMVRR 137

Query: 421  GKVA--DEYSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPID 588
              +   +    +L +L++QAKS+ +G W+   G  TIRD+++ I+NPR  VD   QKP++
Sbjct: 138  EGIRGNNPEQVRLCDLEDQAKSSKKGLWSEGGGSHTIRDLKYTIENPRNFVDSLHQKPVN 197

Query: 589  AVIEMVRDGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXL 768
            A+IE VRDG  VRA LLP++  +T+ LSG+++P+ +                       L
Sbjct: 198  AIIEHVRDGCMVRALLLPDYYLVTVMLSGIKSPTFKREADGSETPEPFAAEAKFFTESRL 257

Query: 769  LQRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAER 948
            LQRDVQIILES  NQ  +G+I+HP GNI E LL+EG+A+CVDWS+ + T GA+KLR AER
Sbjct: 258  LQRDVQIILESCPNQVILGTILHPNGNITELLLKEGFARCVDWSMAVYTQGAEKLRAAER 317

Query: 949  QAKEKRLRLWKSY-QPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRL 1125
             AKE+++R+WK Y  PT++    DR+ F  KV+++V +DA+VV+ + G    +HLSSIR
Sbjct: 318  SAKERKVRIWKDYVAPTANLDQKDRQ-FVAKVMQVVNADAIVVKLNSGEYKTIHLSSIRP 376

Query: 1126 PRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKSE------ 1287
            PR  G++K      ++FRPLYDIP+MF+AREFLRK+L+GKKV + +DY++  +
Sbjct: 377  PRLEGEEK-NKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATNAMEMGV 435

Query: 1288 -NFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXX 1464
              FPE+TCAT+ IG  NIAE L+S+GL+ V+R+R DD+ RSS YD
Sbjct: 436  PAFPERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKG 495

Query: 1465 XFADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETV 1644
              + K   +   HR+ +I+G+  KAKQF P+LQR GR+E VVE++  GSRL++Y+PKET
Sbjct: 496  LHSKK---EVPIHRVADISGETQKAKQFFPFLQRAGRSEAVVEYVFSGSRLKLYMPKETC 552

Query: 1645 LITFLLGGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNF 1824
            LITFLL GI CP+G+R  PGG+               T++LVLQ EV++EVES D  GNF
Sbjct: 553  LITFLLAGIECPRGSRNMPGGMQV--AEPYSEEAMLFTKELVLQREVEVEVESMDIAGNF 610

Query: 1825 VGYLYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXX 2004
            + +L++  DG     +NLS ALVEN L+ +HFTAERS +Y
Sbjct: 611  IDWLHI--DG-----VNLSVALVENALSKVHFTAERSSYYKTLVSAEESARQRKEKLWAN 663

Query: 2005 FTXXXXXXXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQA 2184
            +             A   ER +N       +I  G L F AQ++E G K+E +   MR
Sbjct: 664  YEEKPNEEVAQVTEA--KERGRNTDPSTSLEITDG-LHFYAQDVETGTKLENLMESMRGE 720

Query: 2185 LAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVK 2361
            +A  PP+ GS+  +RG+ C+AKF+ DG+WYR +VE V +  +  + YIDYGNRE + + +
Sbjct: 721  IAAQPPVEGSFAPRRGEFCIAKFA-DGEWYRARVEKVESPAKVHVFYIDYGNREVLSSTR 779

Query: 2362 LAQIPAGFA--NFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGT 2535
            LA +P  F+    P    EY  A  ++P ++  +  +         ++   +N EY
Sbjct: 780  LAALPPAFSTRTLPPQATEYAFAYIQVPQDEDARADAVDSVVRDIHNTQCLLNVEYSGMV 839

Query: 2536 SEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIW 2712
               VT+ +   + K D+G  L+ EG+ + D R+E  LQ +V +Y   +E A+ +R NIW
Sbjct: 840  CPQVTLQF--ADTKEDVGLGLVKEGMVMVDIRKEKYLQKMVTEYLNAQESAKSARLNIW 896


>gi|30844237|dbj|BAC76713.1| 4SNc-Tudor domain protein short form
            [Danio rerio]
 gi|31044093|dbj|BAC76779.1| 4SNc-Tudor domain protein short form
            [Danio rerio]
          Length = 872

 Score =  657 bits (1694), Expect = 0.0
 Identities = 366/892 (41%), Positives = 531/892 (59%), Gaps = 18/892 (2%)
 Frame = +1

Query: 91   VLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS---ASATPDEPYAWDSREYL 261
            VLSG A+I++GQP  GPPPE  + LSN+ A  L RR          TPDEP+A+ +RE++
Sbjct: 2    VLSGCAIIVRGQPRGGPPPERQINLSNIRAGALARRAIQGQPDTKDTPDEPWAFQAREFM 61

Query: 262  RQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGKVA--D 435
            R+K++G+ V F  +     GR++G +YLG       EN+AE  V+ GL  VR+  +   +
Sbjct: 62   RKKVIGKEVCFTVENKTPQGREYGMVYLG--KDTSGENIAESLVAEGLAMVRREGIRGNN 119

Query: 436  EYSTKLLELQEQAKSAGRGKWNSNAG--TIRDIRWVIDNPRELVDKYAQKPIDAVIEMVR 609
                +L +L++QAKS+ +G W+   G  TIRD+++ I+NPR  VD   QKP++A+IE VR
Sbjct: 120  PEQVRLCDLEDQAKSSKKGLWSEGGGSHTIRDLKYTIENPRNFVDSLHQKPVNAIIEHVR 179

Query: 610  DGSTVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQI 789
            DG  VRA LLP++  +T+ LSG+++P+ +                       LLQRDVQI
Sbjct: 180  DGCMVRALLLPDYYLVTVMLSGIKSPTFKREADGSETPEPFAAEAKFFTESRLLQRDVQI 239

Query: 790  ILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRL 969
            ILES  NQ  +G+I+HP GNI E LL+EG+A+CVDWS+ + T GA+KLR AER AKE+++
Sbjct: 240  ILESCPNQVILGTILHPNGNITELLLKEGFARCVDWSMAVYTQGAEKLRAAERSAKERKV 299

Query: 970  RLWKSY-QPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDD 1146
            R+WK Y  PT++    DR+ F  KV+++V +DA+VV+ + G    +HLSSIR PR  G++
Sbjct: 300  RIWKDYVAPTANLDQKDRQ-FVAKVMQVVNADAIVVKLNSGEYKTIHLSSIRPPRLEGEE 358

Query: 1147 KATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKSE-------NFPEKT 1305
            K      ++FRPLYDIP+MF+AREFLRK+L+GKKV + +DY++  +         FPE+T
Sbjct: 359  K-NKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATNAMEMGVPAFPERT 417

Query: 1306 CATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKTA 1485
            CAT+ IG  NIAE L+S+GL+ V+R+R DD+ RSS YD                 + K
Sbjct: 418  CATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKK-- 475

Query: 1486 EKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLG 1665
             +   HR+ +I+G+  KAKQF P+LQR GR+E VVE++  GSRL++Y+PKET LITFLL
Sbjct: 476  -EVPIHRVADISGETQKAKQFFPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLA 534

Query: 1666 GINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVS 1845
            GI CP+G+R  PGG+               T++LVLQ EV++EVES D  GNF+ +L++
Sbjct: 535  GIECPRGSRNMPGGMQV--AEPYSEEAMLFTKELVLQREVEVEVESMDIAGNFIDWLHI- 591

Query: 1846 PDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXX 2025
             DG     +NLS ALVEN L+ +HFTAERS +Y                    +
Sbjct: 592  -DG-----VNLSVALVENALSKVHFTAERSSYYKTLVSAEESARQRKEKLWANYEEKPNE 645

Query: 2026 XXXXXXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPL 2205
                   A   ER +N       +I  G L F AQ++E G K+E +   MR  +A  PP+
Sbjct: 646  EVAQVTEA--KERGRNTDPSTSLEITDG-LHFYAQDVETGTKLENLMESMRGEIAAQPPV 702

Query: 2206 AGSYTTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQIPAG 2382
             GS+  +RG+ C+AKF+ DG+WYR +VE V +  +  + YIDYGNRE + + +LA +P
Sbjct: 703  EGSFAPRRGEFCIAKFA-DGEWYRARVEKVESPAKVHVFYIDYGNREVLSSTRLAALPPA 761

Query: 2383 FA--NFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTVY 2556
            F+    P    EY  A  ++P ++  +  +         ++   +N EY       VT+
Sbjct: 762  FSTRTLPPQATEYAFAYIQVPQDEDARADAVDSVVRDIHNTQCLLNVEYSGMVCPQVTLQ 821

Query: 2557 YDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIW 2712
            +   + K D+G  L+ EG+ + D R+E  LQ +V +Y   +E A+ +R NIW
Sbjct: 822  F--ADTKEDVGLGLVKEGMVMVDIRKEKYLQKMVTEYLNAQESAKSARLNIW 871


>gi|31213491|ref|XP_315689.1| ENSANGP00000021797 [Anopheles gambiae]
 gi|21299665|gb|EAA11810.1| ENSANGP00000021797 [Anopheles gambiae str.
            PEST]
          Length = 935

 Score =  653 bits (1684), Expect = 0.0
 Identities = 376/908 (41%), Positives = 538/908 (58%), Gaps = 21/908 (2%)
 Frame = +1

Query: 70   RRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDSAS-ATPDEPYAWD 246
            ++G+VK +LSGD++IL+ +P NGPP E  +  + + AP+L RRPT+ +S  + D+PYAW+
Sbjct: 36   KKGIVKQILSGDSLILRDKPVNGPPREKQLNFAGIVAPKLARRPTNGSSDGSRDQPYAWE 95

Query: 247  SREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGK 426
            SREYLRQ+L+GQ V F  +    + R++G + LG     +AEN+ E  VS GL+ VR+
Sbjct: 96   SREYLRQRLIGQEVWFYSEKPPNANREYGYVKLG--KEPNAENIVESIVSEGLVTVRRDN 153

Query: 427  VADEYS-TKLLELQEQAKSAGRGKWNS--NAGTIRDIRWVIDNPRELVDKYAQKPIDAVI 597
            V       +L+EL++ A+ A +G W+       +R+I W IDNP++ VD++A + I A+I
Sbjct: 154  VRQTPEHARLIELEDAARRARKGLWSDAPEGEHVRNIVWNIDNPKQFVDQHAGQLIKAII 213

Query: 598  EMVRDGSTVRAFLLPN---FEYITLQLSGVRAPSTR---NPNAADXXXXXXXXXXXXXXX 759
            E VRDGSTVRAFL+PN   F+++TL +SG+R P  +        +
Sbjct: 214  EHVRDGSTVRAFLMPNPRVFQHVTLMMSGIRCPGFKLDAEGRPDNTTEVPYADEARFHVE 273

Query: 760  XXLLQRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRD 939
              LLQR+V++ LES SN NF+G+I+ P+GNIAESLLR G+AKCV+WSI     G  +LR
Sbjct: 274  CRLLQREVKVRLESNSNTNFLGTILCPEGNIAESLLRNGFAKCVEWSIPYVKEGIDRLRA 333

Query: 940  AERQAKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSI 1119
             ER+AK  RLRLWK Y+P ++  +   K   G V+E+   DAV+V+    S+ K+  SSI
Sbjct: 334  CEREAKAARLRLWKDYKPPAALANTKDKELVGTVMEVYNGDAVLVKVGTVSK-KVFFSSI 392

Query: 1120 RLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKSENFPE 1299
            R PR   DD   G   +  RPLYDIP+MF+AREFLRK+L+GK+V   +DYV P  +N+PE
Sbjct: 393  RPPRPKEDD---GPRAKNSRPLYDIPYMFEAREFLRKKLIGKRVTCTLDYVAPARDNYPE 449

Query: 1300 KTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADK 1479
            K C T+++ DQNIAE ++ RGL+ V+ +R DDE RS EYD                 A K
Sbjct: 450  KYCYTVRLDDQNIAEAMLERGLATVINYRQDDEQRSPEYDKLRAAQEQAIKGQKGMHAKK 509

Query: 1480 TAEKKDTHRIQEITGDLAKAK-QFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITF 1656
               +  +HRI ++T D ++ K  +LP  QR  R E +VEF++ GSRLR+Y PKE+ L+TF
Sbjct: 510  ---QTPSHRINDLTTDHSRIKHHYLPSWQRALRTEALVEFVASGSRLRLYCPKESCLVTF 566

Query: 1657 LLGGINCPKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNG-NFVGY 1833
            LL GI+C + +R   GG                TR+ VLQ +V +++E+TDK   + +G+
Sbjct: 567  LLAGISCRRSSRPAIGGAPAQEAEPYGDEALQFTREKVLQRDVSVKIETTDKQATSVIGW 626

Query: 1834 LYVSPDGNTSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTX 2013
            L+      T   +NLS ALVE GLA +HFTAE+S +Y                    +
Sbjct: 627  LF------TDHNVNLSVALVEEGLAEVHFTAEKSDYYRVLRDAEARAKAQRKNIWKDYVE 680

Query: 2014 XXXXXXXXXXXADTS------ERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEM 2175
                        DT       ERK  +  V VT++ P  L+F AQ+ + G K+E++ T++
Sbjct: 681  KAAAEEEKDEIEDTPDVNTPVERKVKYESVVVTEVTP-ELQFYAQHTDQGAKLEELMTKL 739

Query: 2176 RQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESV-RAGQAEIVYIDYGNRETIE 2352
            RQ     PP+ GSY  KRGD+C AKFS+D +WYR KVE V + G   I+YIDYGNRET+
Sbjct: 740  RQDFKAMPPVTGSYAPKRGDMCAAKFSEDNEWYRAKVEKVEKGGNVTILYIDYGNRETVP 799

Query: 2353 AVKLAQIPAGFANFPAGVREYNLALAKLPNE-DYVQLTSDAFAQYLFGHSSVFINSEYKV 2529
            + +LA IP  F +       Y  AL  LP + D       AF+Q +  + ++ +N EY++
Sbjct: 800  STRLAMIPPTFISEKPFAHLYVPALLLLPTDADDRAEAVKAFSQDVL-NRTLNMNVEYRI 858

Query: 2530 GTSEYVTVYYDSGNKKVDIGKSLIAEGLALAD-HRREPRLQTLVNDYNTTEEVARKSRKN 2706
              +EYVT+       K DI + LIA+G  +AD ++++ RL  L+ DY   E+ ARK  K
Sbjct: 859  SGTEYVTL--TDPATKADIAEDLIADGYLIADKNKKDRRLTKLIADYKDAEQKARKQHKG 916

Query: 2707 IWEYGDFT 2730
            IW+YGD T
Sbjct: 917  IWQYGDST 924


>gi|12083649|ref|NP_073185.1| p105 coactivator [Rattus norvegicus]
 gi|1800307|gb|AAB41439.1| p105 coactivator [Rattus norvegicus]
          Length = 880

 Score =  644 bits (1661), Expect = 0.0
 Identities = 369/902 (40%), Positives = 529/902 (57%), Gaps = 19/902 (2%)
 Frame = +1

Query: 91   VLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDSASA----TPDEPYAWDSREY 258
            VLSG A+I++G P  G  PE  + LSN+ A  L  R   +       TPDEP+A+ +RE+
Sbjct: 2    VLSGCAMIVRGLPR-GTAPERQINLSNIRAGNLDTRRRAATQPDGKDTPDEPWAFPAREF 60

Query: 259  LRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQGKVADE 438
            LR+KL+G+ V F  +     GR++G IYLG     + EN+AE  V+ GL      +  +
Sbjct: 61   LRKKLIGKEVCFTIENKTPQGREYGMIYLG--KDTNGENIAESLVAEGLAPGESMRANNP 118

Query: 439  YSTKLLELQEQAKSAGRGKWNSNAG-TIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRDG 615
               +L E +EQAK++ +G W+   G T  D+++ I+NPR  VD + QKP++A+IE VRDG
Sbjct: 119  EQNRLSECEEQAKASKKGMWSEGTGHTHPDLKYTIENPRHFVDSHHQKPVNAIIEHVRDG 178

Query: 616  STVRAFLLPNFEYITLQLSGVRAPSTRNPNAADXXXXXXXXXXXXXXXXXLLQRDVQIIL 795
            S VRA LLP+   +T+ LSG++ P+ R                       LLQRDVQIIL
Sbjct: 179  SVVRALLLPDHYLVTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQIIL 238

Query: 796  ESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLRL 975
            ES  NQN +G+I+HP GNI E LL+EG+A+CVDWSI + T GA+KLR AER AKE+RLR+
Sbjct: 239  ESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRI 298

Query: 976  WKSYQPTSSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKAT 1155
            W+ Y P ++      K F  KV++++ +DA+VV+   G    +HLSSIR PR  GD+
Sbjct: 299  WRDYVPPTANLDQKDKQFVAKVMQVLNADAIVVKLSSGDYKTIHLSSIRPPRLEGDN--I 356

Query: 1156 GGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKS------ENFPEKTCATI 1317
                ++ RPLYDIP+MF+AREFLRK+L+GKKV + +DY++P S        F E+TCAT+
Sbjct: 357  QDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVSVTVDYIRPASPATETVPAFSERTCATV 416

Query: 1318 KIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTXXXXXXXXXXXXXXXFADKTAEKKD 1497
             IG  NI E L+S+GL+ V+R+R DD+ RSS YD                 + K   +
Sbjct: 417  TIGGINITEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKK---EVP 473

Query: 1498 THRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGINC 1677
             HR+ +I+GD  KAKQFLP+LQR GR+E VVE++  GSRL++Y+PKET LITFLL GI C
Sbjct: 474  IHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIEC 533

Query: 1678 PKGARVGPGGVSTGXXXXXXXXXXXXTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDGN 1857
            P+GAR  PG V  G            T++LVLQ EV++EVES DK GNF+G+L++  DG
Sbjct: 534  PRGARNLPGLVQEG--EPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHM--DG- 588

Query: 1858 TSRAINLSEALVENGLASLHFTAERSGHYXXXXXXXXXXXXXXXXXXXXFTXXXXXXXXX 2037
                 NLS  LVE+ L+ +HFTAERSG+Y                    +
Sbjct: 589  ----ANLSVLLVEHALSKVHFTAERSGYYKPLLSAEEAAKQRKEKVWAHY--EEQPVEEV 642

Query: 2038 XXXADTSERKQNFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGSY 2217
                +  ER  +++ V VT+I    L F  Q++E G ++EK+   MR  ++ HPP+ G
Sbjct: 643  MPVLEEKERSASYKPVFVTEITDD-LHFYVQDVETGTQLEKLMENMRSDISSHPPVEG-L 700

Query: 2218 TTKRGDLCVAKFSQDGQWYRCKVESVRA-GQAEIVYIDYGNRETIEAVKLAQIPAGFAN- 2391
              +RG+ C+AKF  DG+WYR +VE   +  +  + YIDYGNRE + + +LA +P  F+
Sbjct: 701  RPRRGEFCIAKF-VDGEWYRARVEKEESPAKVHVFYIDYGNREILPSTRLA-LPPAFSTR 758

Query: 2392 -FPAGVREYNLALAKLPNE-----DYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEYVTV 2553
              PA   EY  A  + P +     D V + +D        ++   +N E+   +  +VT+
Sbjct: 759  VLPAQATEYAFAFIQWPQDEDARTDAVTVCAD------IQNTQCLLNVEHLSASCPHVTL 812

Query: 2554 YYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTG 2733
             +   + K D+G  L+ EGL + + R+E + Q ++ +Y   +E A+ +R N+W YGDF
Sbjct: 813  QF--ADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRA 870

Query: 2734 ND 2739
            +D
Sbjct: 871  DD 872




[DB home][top]