Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F11G11_12
(621 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17534685|ref|NP_494883.1| glutathione S-Transferase (23.0 kD)... 398 e-110
gi|39579272|emb|CAE56959.1| Hypothetical protein CBG24809 [Caeno... 374 e-102
gi|17534687|ref|NP_494884.1| glutathione S-Transferase (gst-8) [... 353 1e-96
gi|39596775|emb|CAE59002.1| Hypothetical protein CBG02278 [Caeno... 306 2e-82
gi|17537895|ref|NP_494902.1| glutathione S-Transferase (gst-30) ... 302 3e-81
gi|17534681|ref|NP_496357.1| glutathione S-Transferase (gst-5) [... 275 7e-73
gi|39596768|emb|CAE58995.1| Hypothetical protein CBG02268 [Caeno... 266 3e-70
gi|39591173|emb|CAE73226.1| Hypothetical protein CBG20632 [Caeno... 263 3e-69
gi|17560538|ref|NP_506983.1| glutathione S-Transferase (gst-38) ... 254 1e-66
gi|17535437|ref|NP_494887.1| glutathione S-Transferase (gst-9) [... 249 4e-65
gi|39587305|emb|CAE74959.1| Hypothetical protein CBG22850 [Caeno... 242 4e-63
gi|8917596|gb|AAF81283.1| glutathione S-transferase [Haemonchus ... 238 9e-62
gi|32564637|ref|NP_494882.2| glutathione S-Transferase (23.6 kD)... 229 2e-59
gi|7498934|pir||T29984 hypothetical protein F11G11.3 - Caenorhab... 229 2e-59
gi|39579271|emb|CAE56958.1| Hypothetical protein CBG24808 [Caeno... 223 3e-57
gi|47717441|gb|AAT37718.1| glutathione S-transferase [Ancylostom... 210 2e-53
gi|1170109|sp|P46436|GTS1_ASCSU Glutathione S-transferase 1 (GST... 205 6e-52
gi|7108568|gb|AAF36480.1| glutathione S-transferase 2 [Nematospi... 200 2e-50
gi|17535439|ref|NP_494889.1| glutathione S-Transferase (gst-9) [... 196 2e-49
gi|39589143|emb|CAE57876.1| Hypothetical protein CBG00918 [Caeno... 159 5e-38
gi|17533777|ref|NP_496862.1| glutathione S-Transferase (gst-12) ... 154 1e-36
gi|17533779|ref|NP_496861.1| glutathione S-Transferase (gst-14) ... 154 1e-36
gi|17540934|ref|NP_501846.1| glutathione S-Transferase (23.7 kD)... 154 2e-36
gi|17536525|ref|NP_495967.1| glutathione S-Transferase (gst-13) ... 151 8e-36
gi|17537261|ref|NP_496858.1| glutathione S-Transferase (gst-20) ... 151 1e-35
gi|39585761|emb|CAE59963.1| Hypothetical protein CBG03453 [Caeno... 148 9e-35
gi|17537493|ref|NP_497119.1| glutathione S-transferase family me... 147 2e-34
gi|39591202|emb|CAE73255.1| Hypothetical protein CBG20671 [Caeno... 147 2e-34
gi|17565374|ref|NP_503532.1| predicted CDS, glutathione S-Transf... 145 5e-34
gi|39591186|emb|CAE73239.1| Hypothetical protein CBG20648 [Caeno... 144 1e-33
gi|39592704|emb|CAE62318.1| Hypothetical protein CBG06384 [Caeno... 144 1e-33
gi|17537491|ref|NP_497118.1| glutathione S-Transferase (gst-29) ... 144 1e-33
gi|7505567|pir||T23485 hypothetical protein K08F4.11 - Caenorhab... 142 5e-33
gi|39585723|emb|CAE59925.1| Hypothetical protein CBG03411 [Caeno... 142 5e-33
gi|17533783|ref|NP_496863.1| glutathione S-Transferase (gst-16) ... 140 3e-32
gi|17533789|ref|NP_496864.1| glutathione S-Transferase (gst-19) ... 139 3e-32
gi|17533775|ref|NP_496859.1| glutathione S-Transferase (gst-24) ... 139 4e-32
gi|39591187|emb|CAE73240.1| Hypothetical protein CBG20649 [Caeno... 138 7e-32
gi|39591199|emb|CAE73252.1| Hypothetical protein CBG20668 [Caeno... 137 1e-31
gi|17540932|ref|NP_501847.1| glutathione S-Transferase (21.8 kD)... 137 2e-31
gi|32565684|ref|NP_497123.2| predicted CDS, glutathione S-Transf... 137 2e-31
gi|39597765|emb|CAE68457.1| Hypothetical protein CBG14247 [Caeno... 137 2e-31
gi|39591201|emb|CAE73254.1| Hypothetical protein CBG20670 [Caeno... 136 3e-31
gi|39584542|emb|CAE74620.1| Hypothetical protein CBG22411 [Caeno... 135 8e-31
gi|17537489|ref|NP_497117.1| glutathione S-Transferase (gst-28) ... 134 1e-30
gi|17541378|ref|NP_501848.1| glutathione S-Transferase (23.9 kD)... 133 3e-30
gi|39585760|emb|CAE59962.1| Hypothetical protein CBG03452 [Caeno... 132 4e-30
gi|32564842|ref|NP_741061.2| glutathione S-Transferase (gst-35) ... 132 5e-30
gi|17537497|ref|NP_497121.1| glutathione S-Transferase (gst-31) ... 131 9e-30
gi|17560032|ref|NP_507095.1| glutathione S-Transferase (gst-22) ... 130 2e-29
gi|17566902|ref|NP_503492.1| glutathione S-Transferase (gst-21) ... 129 6e-29
gi|32565758|ref|NP_741060.2| predicted CDS, glutathione S-Transf... 129 6e-29
gi|7505572|pir||T23484 hypothetical protein K08F4.6 - Caenorhabd... 129 6e-29
gi|17569381|ref|NP_508625.1| glutathione S-Transferase (gst-11) ... 128 1e-28
gi|17537487|ref|NP_497116.1| glutathione S-Transferase (gst-27) ... 127 2e-28
gi|17533781|ref|NP_496860.1| glutathione S-Transferase (gst-15) ... 125 6e-28
gi|17557472|ref|NP_503968.1| glutathione S-Transferase (gst-33) ... 125 8e-28
gi|39585759|emb|CAE59961.1| Hypothetical protein CBG03451 [Caeno... 124 1e-27
gi|17537485|ref|NP_497115.1| glutathione S-Transferase (gst-26) ... 124 2e-27
gi|2326190|gb|AAB72147.1| allergen Bla g 5 [Blattella germanica] 120 2e-26
gi|6225491|sp|O18598|GTS1_BLAGE Glutathione S-transferase (GST c... 120 2e-26
gi|12005980|gb|AAG44696.1| glutathione S-transferase Ib [Onchoce... 120 2e-26
gi|48095724|ref|XP_394518.1| similar to glutathione S-transferas... 118 8e-26
gi|481923|pir||S40165 glutathione transferase (EC 2.5.1.18) - ne... 117 2e-25
gi|1170077|sp|P46434|GT1_ONCVO GLUTATHIONE S-TRANSFERASE 1 >gnl|... 117 2e-25
gi|12005978|gb|AAG44695.1| glutathione S-transferase Ia [Onchoce... 117 2e-25
gi|45384344|ref|NP_990342.1| prostaglandin-D synthase [Gallus ga... 115 5e-25
gi|17533787|ref|NP_496866.1| glutathione S-Transferase (gst-18) ... 114 1e-24
gi|38051840|gb|AAH60462.1| MGC68589 protein [Xenopus laevis] 113 3e-24
gi|21952442|gb|AAM82563.1| glutathione s-transferase [Xenopus la... 112 4e-24
gi|32450087|gb|AAH53774.1| MGC64301 protein [Xenopus laevis] 112 4e-24
gi|39590943|emb|CAE58723.1| Hypothetical protein CBG01908 [Caeno... 112 7e-24
gi|25152187|ref|NP_509652.2| glutathione S-Transferase (23.9 kD)... 111 1e-23
gi|39591200|emb|CAE73253.1| Hypothetical protein CBG20669 [Caeno... 110 2e-23
gi|3514020|gb|AAC34097.1| glutathione transferase; PiGSTII [Plat... 110 2e-23
gi|32330663|gb|AAP79878.1| glutathione S-transferase [Solenopsis... 109 4e-23
gi|31205195|ref|XP_311546.1| ENSANGP00000023017 [Anopheles gambi... 108 8e-23
gi|1170107|sp|P46429|GTS2_MANSE GLUTATHIONE S-TRANSFERASE 2 (GST... 108 1e-22
gi|31205193|ref|XP_311545.1| ENSANGP00000010247 [Anopheles gambi... 107 2e-22
gi|1170108|sp|P46428|GTS_ANOGA GLUTATHIONE S-TRANSFERASE (GST CL... 105 7e-22
gi|24654347|ref|NP_725653.1| CG8938-PA [Drosophila melanogaster]... 105 7e-22
gi|49532926|dbj|BAD26698.1| Glutathione S transferase 2-like pro... 104 2e-21
gi|1170111|sp|P46088|GTS_OMMSL Glutathione S-transferase (GST cl... 103 3e-21
gi|49900017|gb|AAH77016.1| Unknown (protein for MGC:89746) [Xeno... 103 3e-21
gi|1065021|pdb|1GSQ| Glutathione S-Transferase (Gst) (E.C.2.5.1... 102 4e-21
gi|31559115|gb|AAP50848.1| glutathione S-transferase 2 [Bombyx m... 100 2e-20
gi|7506384|pir||T23994 hypothetical protein R07B1.4 - Caenorhabd... 100 2e-20
gi|1170110|sp|P46437|GTS_MUSDO GLUTATHIONE S-TRANSFERASE (GST CL... 100 3e-20
gi|7657457|ref|NP_055300.1| prostaglandin-D synthase; hematopoie... 100 3e-20
gi|21435011|gb|AAM53611.1| glutathione S-transferase S1-2 [Anoph... 99 8e-20
gi|20139191|sp|Q9JHF7|PGD2_MOUSE Glutathione-requiring prostagla... 99 8e-20
gi|13928888|ref|NP_113832.1| prostaglandin D2 synthase 2; prosta... 99 8e-20
gi|31980908|ref|NP_062328.2| prostaglandin D2 synthase 2, hemato... 98 1e-19
gi|30749298|pdb|1IYH|A Chain A, Crystal Structure Of Hematopoiet... 97 2e-19
gi|40362717|gb|AAR84628.1| glutathione S-transferase [Gryllotalp... 97 2e-19
gi|48106995|ref|XP_393084.1| similar to Glutathione-requiring pr... 96 4e-19
gi|7387485|gb|AAB33637.2| glutathione S-transferase; GST [Nemato... 96 7e-19
gi|134283|sp|P27012|SC4_OCTDO S-CRYSTALLIN 4 (OL4) >gnl|BL_ORD_I... 92 6e-18
gi|32965121|gb|AAP91748.1| glutathione-requiring prostaglandin D... 92 8e-18
gi|121700|sp|P09792|GT28_SCHMA Glutathione S-transferase 28 kDa ... 92 1e-17
gi|134271|sp|P27009|SC1_OCTDO S-CRYSTALLIN 1 (OL1) >gnl|BL_ORD_I... 92 1e-17
gi|134280|sp|P27014|SC2_OCTVU S-crystallin 2 >gnl|BL_ORD_ID|1015... 92 1e-17
gi|2495111|sp|Q25626|SC3_OCTVU S-CRYSTALLIN 3 >gnl|BL_ORD_ID|170... 92 1e-17
gi|625079|gb|AAA97540.1| S-crystallin 89 5e-17
gi|2058287|emb|CAA73325.1| glutathione transferase [Brugia malayi] 89 5e-17
gi|134281|sp|P27011|SC3_OCTDO S-CRYSTALLIN 3 (OL3) >gnl|BL_ORD_I... 89 5e-17
gi|134279|sp|P27010|SC2_OCTDO S-CRYSTALLIN 2 (OL2) >gnl|BL_ORD_I... 89 5e-17
gi|28630830|gb|AAO45827.1| glutathione S-transferase [Wuchereria... 88 1e-16
gi|39585029|emb|CAE62680.1| Hypothetical protein CBG06825 [Caeno... 87 3e-16
gi|232199|sp|P30114|GT28_SCHHA Glutathione S-transferase 28 kDa ... 86 4e-16
gi|1170101|sp|P46426|GTP_DIRIM Glutathione S-transferase (GST cl... 85 1e-15
gi|544443|sp|P30113|GT28_SCHBO GLUTATHIONE S-TRANSFERASE 28 KD (... 85 1e-15
gi|161013|gb|AAA29892.1| 28kDa glutathione-S transferase 85 1e-15
gi|624328|gb|AAB01055.1| S-crystallin 85 1e-15
gi|121713|sp|P04903|GTA2_RAT Glutathione S-transferase Ya-2 (Lig... 85 1e-15
gi|39592701|emb|CAE62315.1| Hypothetical protein CBG06381 [Caeno... 84 2e-15
gi|11514499|pdb|1F3A|A Chain A, Crystal Structure Of Mgsta1-1 In... 84 2e-15
gi|11514502|pdb|1F3B|A Chain A, Crystal Structure Of Mgsta1-1 In... 84 2e-15
gi|121712|sp|P13745|GTA1_MOUSE Glutathione S-transferase Ya chai... 84 2e-15
gi|13096120|pdb|1EV4|A Chain A, Rat Glutathione S-Transferase A1... 84 2e-15
gi|13096123|pdb|1EV9|A Chain A, Rat Glutathione S-Transferase A1... 84 2e-15
gi|8393499|ref|NP_058709.1| glutathione-S-transferase, alpha typ... 84 2e-15
gi|66611|pir||XURTG glutathione transferase (EC 2.5.1.18) class ... 84 3e-15
gi|134261|sp|P18426|SC11_OMMSL S-CRYSTALLIN SL11 (MAJOR LENS POL... 83 4e-15
gi|17563170|ref|NP_504894.1| glutathione S-Transferase (25.0 kD)... 83 4e-15
gi|624318|gb|AAA97549.1| S-crystallin 83 4e-15
gi|159838|gb|AAA29403.1| S-crystallin 83 5e-15
gi|7110611|ref|NP_032207.1| glutathione S-transferase, alpha 1 (... 83 5e-15
gi|1170102|sp|P46427|GTP_ONCVO Glutathione S-transferase 2 (GST ... 82 6e-15
gi|38173961|gb|AAH61134.1| Unknown (protein for MGC:74264) [Mus ... 82 6e-15
gi|30749486|pdb|1ML6|A Chain A, Crystal Structure Of Mgsta2-2 In... 82 8e-15
gi|121710|sp|P10648|GTA2_MOUSE Glutathione S-transferase GT41A (... 82 8e-15
gi|49532912|dbj|BAD26691.1| Glutathione S-transferase [Plutella ... 82 8e-15
gi|1389744|gb|AAB03573.1| glutathione-S-transferase 82 1e-14
gi|6137390|pdb|1B48|A Chain A, Crystal Structure Of Mgsta4-4 In ... 81 1e-14
gi|50263046|ref|NP_032208.2| glutathione S-transferase, alpha 2 ... 81 1e-14
gi|12859396|dbj|BAB31640.1| unnamed protein product [Mus musculus] 81 1e-14
gi|20141353|sp|P24472|GTA4_MOUSE Glutathione S-transferase 5.7 (... 81 1e-14
gi|12848219|dbj|BAB27873.1| unnamed protein product [Mus musculus] 81 1e-14
gi|6754082|ref|NP_034487.1| glutathione S-transferase, alpha 4 [... 81 1e-14
gi|17533785|ref|NP_496865.1| glutathione S-Transferase (gst-17) ... 81 1e-14
gi|17564840|ref|NP_503889.1| glutathione S-Transferase (gst-23) ... 81 2e-14
gi|975211|emb|CAA58767.1| glutathione transferase [Onchocerca vo... 81 2e-14
gi|41387382|gb|AAS01601.1| Pi-class glutathione S-trasferase [An... 81 2e-14
gi|1943418|pdb|2GSR|A Chain A, Structure Of Porcine Class Pi Glu... 80 2e-14
gi|544445|sp|P80031|GTP_PIG Glutathione S-transferase P (GST P1-... 80 2e-14
gi|108301|pir||S13780 glutathione transferase (EC 2.5.1.18) clas... 80 2e-14
gi|21450105|ref|NP_659118.1| cDNA sequence BC021614 [Mus musculu... 80 3e-14
gi|20988789|gb|AAH30173.1| Gsta2 protein [Mus musculus] 80 4e-14
gi|6671050|gb|AAF23078.1| glutathione S-transferase [Choristoneu... 79 5e-14
gi|39588669|emb|CAE58193.1| Hypothetical protein CBG01287 [Caeno... 79 5e-14
gi|2829287|gb|AAC00518.1| glutathione S-transferase [Schistosoma... 79 5e-14
gi|17565768|ref|NP_503701.1| glutathione S-Transferase (24.8 kD)... 79 7e-14
gi|16518972|gb|AAL25087.1| glutathione s-transferase [Plasmodium... 79 9e-14
gi|2624495|pdb|1BAY|A Chain A, Glutathione S-Transferase Yfyf Cy... 79 9e-14
gi|23509408|ref|NP_702075.1| glutathione s-transferase, putative... 79 9e-14
gi|13928688|ref|NP_113697.1| glutathione S-transferase, alpha 1;... 78 1e-13
gi|134275|sp|P18425|SC20_OMMSL S-CRYSTALLIN SL20-1 (MAJOR LENS P... 78 1e-13
gi|7188365|gb|AAF37739.1| glutathione S-transferase alpha [Rattu... 78 1e-13
gi|10092608|ref|NP_038569.1| glutathione S-transferase, pi 1; Gs... 78 2e-13
gi|624322|gb|AAA97551.1| S-crystallin 78 2e-13
gi|17553834|ref|NP_499006.1| glutathione S-Transferase, P subuni... 78 2e-13
gi|4557944|pdb|1GTI|A Chain A, Modified Glutathione S-Transferas... 78 2e-13
gi|27720723|ref|XP_217195.1| similar to GLUTATHIONE S-TRANSFERAS... 78 2e-13
gi|1170100|sp|P46424|GTP_CRILO Glutathione S-transferase P (GST ... 77 2e-13
gi|121699|sp|P26624|GT28_SCHJA Glutathione S-transferase 28 kDa ... 77 2e-13
gi|576133|pdb|1GLP|A Chain A, Glutathione S-Transferase Yfyf (Cl... 77 2e-13
gi|159831|gb|AAA29402.1| S-crystallin 77 2e-13
gi|8928140|sp|P81706|GTA1_CAVPO Glutathione S-transferase A (GST... 77 3e-13
gi|5360517|dbj|BAA82038.1| glutathione s-transferase [Cavia porc... 77 3e-13
gi|477414|pir||A48982 glutathione transferase (EC 2.5.1.18) 2 - ... 77 3e-13
gi|18858197|ref|NP_571809.1| glutathione S-transferase pi [Danio... 77 3e-13
gi|84595|pir||S06442 crystallin (clone pSl20) - Sloane's squid >... 77 3e-13
gi|624316|gb|AAA97548.1| S-crystallin 77 3e-13
gi|913849|gb|AAA73508.1| lens-specific S-crystallin {SL20-1} [oc... 76 5e-13
gi|1346208|sp|P47954|GTP_CRIMI Glutathione S-transferase P (GST ... 76 5e-13
gi|624302|gb|AAA97541.1| S-crystallin 76 6e-13
gi|2495106|sp|Q28035|GTA1_BOVIN Glutathione S-transferase alpha ... 76 6e-13
gi|1170085|sp|P46418|GTC2_RAT Glutathione S-transferase Yc-2 (Ch... 75 8e-13
gi|32401425|ref|NP_861461.1| glutathione S-transferase, pi 2; Gs... 75 8e-13
gi|23480514|gb|EAA17054.1| glutathione s-transferase [Plasmodium... 75 8e-13
gi|3023905|sp|Q60550|GTP_MESAU Glutathione S-transferase P (GST ... 75 1e-12
gi|1083336|pir||A55140 glutathione transferase (EC 2.5.1.18) piA... 75 1e-12
gi|624326|gb|AAB01054.1| S-crystallin 75 1e-12
gi|1170086|sp|Q08862|GTC_RABIT GLUTATHIONE S-TRANSFERASE YC (ALP... 74 2e-12
gi|39588670|emb|CAE58194.1| Hypothetical protein CBG01288 [Caeno... 74 2e-12
gi|28828694|gb|AAO51292.1| similar to Xenopus laevis (African cl... 74 2e-12
gi|2495107|sp|P80894|GTA1_ANTST Glutathione S-transferase (GST c... 74 2e-12
gi|134268|sp|P27016|SC18_OMMSL S-CRYSTALLIN SL18 >gnl|BL_ORD_ID|... 74 2e-12
gi|34536838|gb|AAQ73932.1| GST-like hemolymph protein [Corcyra c... 74 2e-12
gi|624330|gb|AAB01056.1| S-crystallin 74 2e-12
gi|4630882|dbj|BAA76974.1| glutathione S-transferase [Oncorhynch... 74 3e-12
gi|29135329|ref|NP_803482.1| glutathione S-transferase pi [Bos t... 74 3e-12
gi|50400547|sp|Q8JFZ2|GTP1_XENLA Glutathione S-transferase P 1 (... 74 3e-12
gi|39588668|emb|CAE58192.1| Hypothetical protein CBG01286 [Caeno... 73 4e-12
gi|624332|gb|AAB01057.1| S-crystallin 73 5e-12
gi|624336|gb|AAB01059.1| S-crystallin 72 7e-12
gi|624308|gb|AAA97544.1| S-crystallin 72 7e-12
gi|624306|gb|AAA97543.1| S-crystallin 72 7e-12
gi|1654009|emb|CAA70303.1| glutathione S-transferase [Mesocricet... 72 9e-12
gi|39583549|emb|CAE65653.1| Hypothetical protein CBG10717 [Caeno... 72 9e-12
gi|47523832|ref|NP_999554.1| glutathione S-transferase [Sus scro... 72 9e-12
gi|26347823|dbj|BAC37560.1| unnamed protein product [Mus musculus] 72 9e-12
gi|34859224|ref|XP_234810.2| similar to GLUTATHIONE S-TRANSFERAS... 72 1e-11
gi|25453412|ref|NP_620430.1| glutathione S-transferase, pi 2 [Ra... 72 1e-11
gi|50513281|pdb|1PKW|A Chain A, Crystal Structure Of Human Gluta... 72 1e-11
gi|23428564|gb|AAL23713.1| glutathione S-transferase [Opisthorch... 71 1e-11
gi|11258625|pir||A49365 glutathione transferase (EC 2.5.1.18) al... 71 1e-11
gi|50513287|pdb|1PL2|A Chain A, Crystal Structure Of Human Gluta... 71 1e-11
gi|951352|gb|AAA74634.1| glutathione S-transferase A3 71 1e-11
gi|47523158|ref|NP_999015.1| glutathione S-transferase [Sus scro... 71 1e-11
gi|442977|pdb|1GUH|A Chain A, Glutathione S-Transferase A1-1 (E.... 71 2e-11
gi|1127144|pdb|1GSE|A Chain A, Glutathione Transferase A1-1 Comp... 71 2e-11
gi|22091454|ref|NP_665683.1| glutathione S-transferase A1; GST, ... 71 2e-11
gi|624310|gb|AAA97545.1| S-crystallin 71 2e-11
gi|38636658|dbj|BAD02978.1| glutathione S-transferase [Blepharis... 70 2e-11
gi|17507251|ref|NP_490857.1| glutathione S-Transferase (gst-25) ... 70 2e-11
gi|6013379|gb|AAF01323.1| glutathione S-transferase Pi [Capra hi... 70 3e-11
gi|8218078|emb|CAB92770.1| dJ152L7.3 (glutathione S-transferase ... 70 3e-11
gi|257476|gb|AAB23672.1| glutathione S-transferase A2 subunit [H... 70 3e-11
gi|24430144|ref|NP_000838.3| glutathione S-transferase A3; gluta... 70 3e-11
gi|624312|gb|AAA97546.1| S-crystallin 70 3e-11
gi|20149504|ref|NP_000837.2| glutathione S-transferase A2; gluta... 70 4e-11
gi|624320|gb|AAA97550.1| S-crystallin 70 4e-11
gi|4699783|pdb|22GS|A Chain A, Human Glutathione S-Transferase P... 69 6e-11
gi|187132|gb|AAA36174.1| gluthione S-transferase subunit 1 (GST,... 69 6e-11
gi|7687909|gb|AAD42800.2| microsomal glutathione-S-transferase [... 69 6e-11
gi|18089048|gb|AAH20619.1| Glutathione S-transferase A3 [Homo sa... 69 6e-11
gi|45382235|ref|NP_990149.1| glutathione S-transferase class-alp... 69 6e-11
gi|1170081|sp|Q08863|GTA1_RABIT Glutathione S-transferase alpha ... 69 6e-11
gi|624334|gb|AAB01058.1| S-crystallin 69 7e-11
gi|4139536|pdb|17GS|A Chain A, Glutathione S-Transferase P1-1 >g... 69 9e-11
gi|1065322|pdb|1AGS|A Chain A, Alpha Glutathione S-Transferase (... 68 1e-10
gi|50744870|ref|XP_419913.1| PREDICTED: glutathione S-transferas... 68 1e-10
gi|2264324|gb|AAB63382.1| 28 kDa glutathione-S transferase 68 1e-10
gi|2554831|pdb|2PGT|A Chain A, Crystal Structure Of Human Glutat... 68 1e-10
gi|4504183|ref|NP_000843.1| glutathione transferase; deafness, X... 68 1e-10
gi|5822569|pdb|4PGT|A Chain A, Crystal Structure Of Hgstp1-1[v10... 68 1e-10
gi|624324|gb|AAB01053.1| S-crystallin 68 1e-10
gi|38511981|gb|AAH60914.1| Zgc:73173 protein [Danio rerio] 68 1e-10
gi|12832492|dbj|BAB22131.1| unnamed protein product [Mus musculus] 68 2e-10
gi|31981724|ref|NP_034486.2| glutathione S-transferase, alpha 3 ... 68 2e-10
gi|726098|gb|AAC13869.1| glutathione S-transferase-P1c [Homo sap... 68 2e-10
gi|20664358|pdb|1LBK|A Chain A, Crystal Structure Of A Recombina... 68 2e-10
gi|494066|pdb|1GSS|A Chain A, Glutathione S-Transferase (E.C.2.5... 68 2e-10
gi|2780951|pdb|1AQV|A Chain A, Glutathione S-Transferase In Comp... 68 2e-10
gi|7434039|pir||S24330 glutathione transferase (EC 2.5.1.18) alp... 68 2e-10
gi|49169816|ref|NP_001001777.1| glutathione S-transferase [Gallu... 67 2e-10
gi|193703|gb|AAA37751.1| glutathione transferase 67 2e-10
gi|2204207|emb|CAA30894.1| glutathione S-transferase [Homo sapiens] 67 2e-10
gi|11514448|pdb|1EOG|A Chain A, Crystal Structure Of Pi Class Gl... 67 2e-10
gi|47604962|ref|NP_990743.1| glutathione transferase [Gallus gal... 67 2e-10
gi|50744868|ref|XP_444657.1| PREDICTED: glutathione transferase ... 67 2e-10
gi|2914230|pdb|4GSS|A Chain A, Human Glutathione S-Transferase P... 67 2e-10
gi|624304|gb|AAA97542.1| S-crystallin 67 2e-10
gi|24308514|ref|NP_714543.1| glutathione transferase A5 [Homo sa... 67 2e-10
gi|4335859|gb|AAD17488.1| 28 kDa glutathione S-transferase; 28GS... 67 2e-10
gi|2495108|sp|Q28514|GTP_MACMU Glutathione S-transferase P (GST ... 67 3e-10
gi|39654103|pdb|1KBN|A Chain A, Glutathione Transferase Mutant >... 67 4e-10
gi|22094809|gb|AAM91994.1| glutathione S-transferase GSTpi1 [Myt... 67 4e-10
gi|49169814|ref|NP_001001776.1| glutathione S-transferase class-... 67 4e-10
gi|5524944|emb|CAB50870.1| glutathione S-transferase [Ovis aries] 67 4e-10
gi|34811305|pdb|1PX7|A Chain A, A Folding Mutant Of Human Class ... 66 5e-10
gi|45387463|gb|AAS60226.1| glutathione S-transferase pi [Mytilus... 66 5e-10
gi|34861384|ref|XP_215189.2| similar to hypothetical protein MGC... 66 6e-10
gi|34811303|pdb|1PX6|A Chain A, A Folding Mutant Of Human Class ... 66 6e-10
gi|23200508|pdb|1MD3|A Chain A, A Folding Mutant Of Human Class ... 65 8e-10
gi|21263652|sp|P83325|GTP2_BUFBU Glutathione S-transferase P 2 (... 65 1e-09
gi|624314|gb|AAA97547.1| S-crystallin 65 1e-09
gi|11514451|pdb|1EOH|A Chain A, Glutathione Transferase P1-1 >gn... 65 1e-09
gi|23200510|pdb|1MD4|A Chain A, A Folding Mutant Of Human Class ... 64 2e-09
gi|17540724|ref|NP_499981.1| glutathione S-Transferase (24.9 kD)... 64 2e-09
gi|21263651|sp|P81942|GTP1_BUFBU Glutathione S-transferase P 1 (... 63 4e-09
gi|34539115|gb|AAQ74441.1| glutathione S-transferase [Haemaphysa... 63 4e-09
gi|4504173|ref|NP_001503.1| glutathione S-transferase A4; glutat... 63 5e-09
gi|2147980|pir||S61363 prostaglandin-H E-isomerase chain H - Asc... 62 7e-09
gi|47228894|emb|CAG09409.1| unnamed protein product [Tetraodon n... 62 9e-09
gi|345859|pir||S29658 glutathione transferase (EC 2.5.1.18) omeg... 61 2e-08
gi|345858|pir||S29657 glutathione transferase (EC 2.5.1.18) omeg... 61 2e-08
gi|265545|gb|AAB25369.1| alpha-class glutathione S-transferase o... 61 2e-08
gi|265539|gb|AAB25364.1| alpha-class glutathione S-transferase o... 61 2e-08
gi|7434040|pir||S77958 glutathione transferase (EC 2.5.1.18) alp... 61 2e-08
gi|87564|pir||A41177 glutathione transferase (EC 2.5.1.18) / fat... 60 3e-08
gi|32346216|gb|AAN85429.1| glutathione-S-transferase [Pyrocystis... 60 4e-08
gi|4322274|gb|AAD15991.1| glutathione S-transferase [Boophilus m... 59 6e-08
gi|22671705|gb|AAN04481.1| glutathione S-transferase GSTP2-2 [Bu... 59 1e-07
gi|3402001|pdb|1FHE| Glutathione Transferase (Fh47) From Fascio... 58 1e-07
gi|17561414|ref|NP_505972.1| glutathione S-transferase, C-termin... 58 1e-07
gi|3915723|sp|P31670|GT27_FASHE Glutathione S-transferase 26 kDa... 58 1e-07
gi|34865663|ref|XP_345686.1| similar to GLUTATHIONE S-TRANSFERAS... 58 2e-07
gi|46329897|gb|AAH68854.1| Unknown (protein for IMAGE:3399306) [... 57 2e-07
gi|47086689|ref|NP_997841.1| Unknown (protein for MGC:66370); gl... 57 2e-07
gi|2738935|gb|AAD04712.1| glutathione transferase [Homo sapiens] 57 2e-07
gi|32567128|ref|NP_503698.2| glutathione S-transferase, N-termin... 57 2e-07
gi|4959550|gb|AAD34393.1| glutathione S-transferase class-alpha ... 57 2e-07
gi|232197|sp|P30112|GT26_FASHE GLUTATHIONE S-TRANSFERASE 26 KD 5... 57 3e-07
gi|47228778|emb|CAG07510.1| unnamed protein product [Tetraodon n... 56 5e-07
gi|3915724|sp|P31671|GT28_FASHE GLUTATHIONE S-TRANSFERASE 26 KD ... 56 5e-07
gi|49097402|ref|XP_410161.1| hypothetical protein AN6024.2 [Aspe... 56 6e-07
gi|27462836|gb|AAO15607.1| glutathione S-transferase [Sarcoptes ... 55 1e-06
gi|30145756|emb|CAA96662.2| Hypothetical protein F55A11.6 [Caeno... 55 1e-06
gi|38049405|ref|XP_136557.2| similar to class-alpha glutathione ... 55 1e-06
gi|631017|pir||S43432 glutathione transferase (EC 2.5.1.18) alph... 55 1e-06
gi|25153666|ref|NP_503673.2| glutathione S-transferase, N-termin... 54 2e-06
gi|10443248|emb|CAC10391.1| dJ214M20.3 (glutathione S-transferas... 54 2e-06
gi|384152|prf||1905266C glutathione S transferase:ISOTYPE=GST47 54 2e-06
gi|39592078|emb|CAE75298.1| Hypothetical protein CBG23268 [Caeno... 54 2e-06
gi|56330|emb|CAA25203.1| unnamed protein product [Rattus norvegi... 54 2e-06
gi|1254920|gb|AAB35901.1| prostaglandin-H E-isome=sigma-class gl... 54 3e-06
gi|22671702|gb|AAN04480.1| glutathione S-transferase GSTP1-1 [Bu... 54 3e-06
gi|28076911|ref|NP_081040.1| glutathione S-transferase, mu 4; gl... 54 3e-06
gi|159060|gb|AAA29140.1| mu-glutathione transferase [Fasciola he... 53 4e-06
gi|46115920|ref|XP_383978.1| hypothetical protein FG03802.1 [Gib... 53 4e-06
gi|47076115|emb|CAD90167.1| mu class glutathione S-transferase [... 53 5e-06
gi|2465439|gb|AAB72099.1| glutathione-dependent prostaglandin D ... 53 5e-06
gi|29135319|ref|NP_803481.1| glutathione S-transferase A2 [Bos t... 53 5e-06
gi|21618868|gb|AAH31818.1| Gstm6 protein [Mus musculus] 52 7e-06
gi|384151|prf||1905266B glutathione S transferase:ISOTYPE=GST7 52 9e-06
gi|1170098|sp|P46409|GTMU_RABIT Glutathione S-transferase Mu 1 (... 52 9e-06
gi|4115418|dbj|BAA36350.1| 24 kDa female-specific fat body prote... 52 1e-05
gi|50400685|sp|Q9TSM5|GTM1_MACFA Glutathione S-transferase Mu 1 ... 52 1e-05
gi|159058|gb|AAA29139.1| mu-glutathione transferase [Fasciola he... 51 2e-05
gi|1170095|sp|P46419|GTM1_DERPT Glutathione S-transferase (GST c... 51 2e-05
gi|6625558|gb|AAF19264.1| glutathione S-transferase [Psoroptes o... 51 2e-05
gi|477190|pir||A48388 glutathione S-transferase - liver fluke (f... 51 2e-05
gi|20138154|sp|O35660|GTM6_MOUSE Glutathione S-transferase Mu 6 ... 51 2e-05
gi|7110613|ref|NP_032210.1| glutathione S-transferase, mu 6; glu... 51 2e-05
gi|49522440|gb|AAH75475.1| Unknown (protein for MGC:89299) [Xeno... 50 3e-05
gi|2981970|pdb|1GSU|A Chain A, An Avian Class-Mu Glutathione S-T... 50 3e-05
gi|46048786|ref|NP_990421.1| glutathione S-transferases CL2 [Gal... 50 3e-05
gi|12853535|dbj|BAB29771.1| unnamed protein product [Mus musculus] 50 3e-05
gi|4115420|dbj|BAA36351.1| 24 kDa female-specific fat body prote... 50 3e-05
gi|20982640|ref|XP_159712.1| similar to glutathione transferase ... 50 5e-05
gi|10120620|pdb|1C72|A Chain A, Tyr115, Gln165 And Trp209 Contri... 50 5e-05
gi|104677|pir||S18464 glutathione transferase (EC 2.5.1.18) mu2 ... 50 5e-05
gi|17561486|ref|NP_503671.1| glutathione S-transferase, N-termin... 49 6e-05
gi|3891572|pdb|2FHE|A Chain A, Fasciola Hepatica Glutathione S-T... 49 1e-04
gi|13516447|dbj|BAB40442.1| glutathione transferase M2 [Macaca f... 49 1e-04
gi|32484222|gb|AAH54171.1| Gstm2-prov protein [Xenopus laevis] 48 1e-04
gi|16332351|emb|CAD01094.1| glutathione S-transferase [Xenopus l... 48 1e-04
gi|50400684|sp|Q9TSM4|GTM2_MACFA Glutathione S-transferase Mu 2 ... 48 2e-04
gi|134272|sp|P27013|SC1_OCTVU S-CRYSTALLIN 1 >gnl|BL_ORD_ID|3860... 48 2e-04
gi|23065557|ref|NP_671489.1| glutathione S-transferase M4 isofor... 47 2e-04
gi|6980588|pdb|4GTU|A Chain A, Ligand-Free Homodimeric Human Glu... 47 2e-04
gi|48849945|ref|ZP_00304188.1| COG0625: Glutathione S-transferas... 47 2e-04
gi|15888177|ref|NP_353858.1| AGR_C_1530p [Agrobacterium tumefaci... 47 2e-04
gi|4504179|ref|NP_000841.1| glutathione S-transferase M4 isoform... 47 2e-04
gi|306817|gb|AAA57346.1| glutathione transferase M4 47 2e-04
gi|422842|pir||S32425 glutathione transferase (EC 2.5.1.18) clas... 47 2e-04
gi|28461273|ref|NP_787019.1| glutathione S-transferase M1 [Bos t... 47 2e-04
gi|232206|sp|P30116|GTMU_MESAU GLUTATHIONE S-TRANSFERASE (GST CL... 47 2e-04
gi|544442|sp|P35661|GT27_SCHMA GLUTATHIONE S-TRANSFERASE 26 KD (... 47 3e-04
gi|5880849|gb|AAD54937.1| glutathione S-transferase 6A [Musca do... 47 3e-04
gi|6680121|ref|NP_032209.1| glutathione S-transferase, mu 2; glu... 47 3e-04
gi|34859803|ref|XP_215682.2| similar to glutathione transferase ... 47 4e-04
gi|4557966|pdb|2GTU|A Chain A, Ligand-Free Human Glutathione S-T... 46 5e-04
gi|494185|pdb|1HNA| Glutathione S-Transferase (Human, Class Mu)... 46 5e-04
gi|34874562|ref|XP_343546.1| similar to class-alpha glutathione ... 46 5e-04
gi|4504175|ref|NP_000839.1| glutathione S-transferase M2; glutat... 46 5e-04
gi|18391048|ref|NP_563848.1| elongation factor 1B-gamma, putativ... 46 7e-04
gi|5880851|gb|AAD54938.1| glutathione s-transferase 6B [Musca do... 46 7e-04
gi|46315840|ref|ZP_00216421.1| COG0625: Glutathione S-transferas... 46 7e-04
gi|33086608|gb|AAP92616.1| Ab2-088 [Rattus norvegicus] 45 0.001
gi|34862828|ref|XP_345026.1| similar to Ab2-088 [Rattus norvegicus] 45 0.001
gi|28933457|ref|NP_803175.1| glutathione S-transferase, mu 2; gl... 45 0.001
gi|23065563|ref|NP_000842.2| glutathione S-transferase M5; gluta... 45 0.001
gi|1170097|sp|P46439|GTM5_HUMAN Glutathione S-transferase Mu 5 (... 45 0.001
gi|50120012|ref|YP_049179.1| glutathione S-transferase [Erwinia ... 44 0.002
gi|37748321|gb|AAH58881.1| Glutathione S-transferase M5 [Homo sa... 44 0.002
gi|46322289|ref|ZP_00222660.1| COG0625: Glutathione S-transferas... 44 0.002
gi|46139095|ref|XP_391238.1| hypothetical protein FG11062.1 [Gib... 44 0.002
gi|2117744|pir||I52082 glutathione S-transferase Ya subunit - ra... 44 0.002
gi|3002500|gb|AAC08718.1| GSTmFra2/79-242 [Expression vector pGH... 44 0.002
gi|3184404|dbj|BAA28713.1| GST-stuffer fusion protein [Cloning v... 44 0.002
gi|595706|gb|AAA57086.1| glutathione S-transferase 44 0.002
gi|38155842|gb|AAR12690.1| glutathione S-transferase [Expression... 44 0.002
gi|84408|pir||S02458 glutathione transferase (EC 2.5.1.18) s.m.1... 44 0.002
gi|208305|gb|AAA72682.1| glutathione transferase 44 0.002
gi|15099965|gb|AAK84182.1| glutathione-S-transferase-nitroreduct... 44 0.002
gi|15099967|gb|AAK84183.1| glutathione-S-transferase-nitroreduct... 44 0.002
gi|208443|gb|AAB59734.1| glutathione transferase 44 0.002
gi|21666485|gb|AAM73721.1| glutathione-S-transferase/nitroreduct... 44 0.002
gi|4389298|pdb|1BG5| Crystal Structure Of The Ankyrin Binding D... 44 0.002
gi|84402|pir||A26484 glutathione transferase (EC 2.5.1.18) - flu... 44 0.002
gi|1814368|gb|AAB41883.1| GST-6his [Expression vector pGEX-2T-6H... 44 0.002
gi|595742|gb|AAA57113.1| glutathione S-transferase 44 0.002
gi|595738|gb|AAA57110.1| glutathione S-transferase 44 0.002
gi|595714|gb|AAA57092.1| glutathione S-transferase 44 0.002
gi|1699069|gb|AAB37352.1| glutathione S-transferase [Cloning vec... 44 0.002
gi|6980848|pdb|1DUG|A Chain A, Structure Of The Fibrinogen G Cha... 44 0.002
gi|595722|gb|AAA57098.1| glutathione S-transferase 44 0.002
gi|595726|gb|AAA57101.1| glutathione S-transferase 44 0.002
gi|1814366|gb|AAB41882.1| GST-6his [Expression vector pGEX-2T-6H] 44 0.002
gi|1527195|gb|AAB88910.1| glutathione S-transferase [Expression ... 44 0.002
gi|4929901|pdb|1B8X|A Chain A, Glutathione S-Transferase Fused W... 44 0.002
gi|3983117|gb|AAC83809.1| glutathione S-transferase [Expression ... 44 0.002
gi|1850359|gb|AAB48035.1| GST-fusion protein [Expression vector ... 44 0.002
gi|467623|emb|CAA55122.1| fusion peptide [synthetic construct] 44 0.002
gi|3002504|gb|AAC08721.1| GSTmFra2/159-327 [Expression vector pG... 44 0.002
gi|3002508|gb|AAC08724.1| GSTmFra2/2-242 [Expression vector pGH/... 44 0.002
gi|20385949|gb|AAM21516.1| GST-M.SPRX methyltransferase fusion p... 44 0.002
gi|3002496|gb|AAC08715.1| GSTmFra2/2-163 [Expression vector pGH/... 44 0.002
gi|23821204|emb|CAD53317.1| glutathione-S-transferase [Cloning v... 44 0.002
gi|1699065|gb|AAB37349.1| glutathione S-transferase [Cloning vec... 44 0.002
gi|121697|sp|P08515|GT26_SCHJA Glutathione S-transferase 26 kDa ... 44 0.002
gi|1526622|emb|CAA68944.1| 26kD glutathione S-transferase [Schis... 44 0.002
gi|3242311|emb|CAA11559.1| glutathione-S-transferase [synthetic ... 44 0.002
gi|809436|pdb|1GNE| Glutathione S-Transferase (E.C.2.5.1.18) Fu... 44 0.002
gi|595710|gb|AAA57089.1| glutathione S-transferase 44 0.002
gi|3002512|gb|AAC08727.1| GSTmFra2/79-327 [Expression vector pGH... 44 0.002
gi|595718|gb|AAA57095.1| glutathione S-transferase 44 0.002
gi|15216974|gb|AAK92454.1| GST-loxP-cre recombinase fusion prote... 44 0.002
gi|595730|gb|AAA57104.1| glutathione S-transferase 44 0.002
gi|595734|gb|AAA57107.1| glutathione S-transferase 44 0.002
gi|3002516|gb|AAC08730.1| GSTmFra2/2-327 [Expression vector pGH/... 44 0.002
gi|1850357|gb|AAB48034.1| GST-fusion protein [Expression vector ... 44 0.002
gi|1699061|gb|AAB37346.1| glutathione S-transferase [Cloning vec... 44 0.002
gi|1850361|gb|AAB48036.1| GST-fusion protein [Expression vector ... 44 0.002
gi|42521914|ref|NP_967294.1| maleylacetoacetate isomerase / glut... 44 0.003
gi|23504743|emb|CAD29477.1| glutathione transferase F4 [Triticum... 44 0.003
gi|19848969|gb|AAL99403.1| glutathione S-transferase [Boophilus ... 44 0.003
gi|21591409|gb|AAM64045.1| glutathione S-transferase [Taenia sol... 43 0.004
gi|27714143|ref|XP_232844.1| similar to GST pi enzyme [Rattus no... 43 0.004
gi|14334818|gb|AAK59587.1| putative elongation factor 1B gamma [... 43 0.004
gi|15223649|ref|NP_176084.1| elongation factor 1B-gamma, putativ... 43 0.004
gi|18280276|gb|AAL02368.1| class gamma glutathione S-transferase... 43 0.006
gi|3023918|sp|Q52828|GSTA_RHILE GSTA PROTEIN >gnl|BL_ORD_ID|1716... 43 0.006
gi|11177841|gb|AAG32475.1| putative glutathione S-transferase Os... 43 0.006
gi|34914740|ref|NP_918717.1| putative glutathione S-transferase ... 43 0.006
gi|36959131|gb|AAQ87556.1| Glutathione S-transferase [Rhizobium ... 42 0.007
gi|31239101|ref|XP_319964.1| ENSANGP00000024662 [Anopheles gambi... 42 0.009
gi|24654983|ref|NP_611327.1| CG17527-PA [Drosophila melanogaster... 42 0.009
gi|23504745|emb|CAD29478.1| glutathione transferase F5 [Triticum... 42 0.012
gi|15601256|ref|NP_232887.1| glutathione S-transferase, putative... 42 0.012
gi|21956654|gb|AAL02369.3| class gamma glutathione S-transferase... 42 0.012
gi|24215323|ref|NP_712804.1| glutathione transferase [Leptospira... 42 0.012
gi|38174001|gb|AAH61226.1| Unknown (protein for MGC:74375) [Mus ... 41 0.016
gi|13626515|sp|Q9ZRI7|EF1G_ORYSA Elongation factor 1-gamma (EF-1... 41 0.016
gi|4581947|gb|AAB46369.3| putative glutathione transferase [Clon... 41 0.016
gi|19922528|ref|NP_611324.1| CG17523-PA [Drosophila melanogaster... 41 0.021
gi|31194853|ref|XP_306374.1| ENSANGP00000014687 [Anopheles gambi... 40 0.027
gi|3582502|gb|AAC35245.1| glutathione S-transferase isozyme 3 [P... 40 0.036
gi|46806490|dbj|BAD17614.1| putative elongation factor 1-gamma [... 40 0.036
gi|18158604|gb|AAL59655.1| glutathione S-transferase E6 [Anophel... 40 0.036
gi|29367403|gb|AAO72574.1| elongation factor 1 gamma-like protei... 40 0.036
gi|27380911|ref|NP_772440.1| bll5800 [Bradyrhizobium japonicum U... 40 0.036
gi|37361852|gb|AAQ91039.1| LRRGT00083 [Rattus norvegicus] 40 0.047
gi|34914804|ref|NP_918749.1| putative glutathione S-transferase ... 40 0.047
gi|34534082|dbj|BAC86900.1| unnamed protein product [Homo sapiens] 40 0.047
gi|11177843|gb|AAG32476.1| putative glutathione S-transferase Os... 40 0.047
gi|29367381|gb|AAO72563.1| elongation factor 1 gamma-like protei... 40 0.047
gi|232191|sp|P30104|GTT1_DROER Glutathione S-transferase 1-1 (GS... 39 0.061
gi|46518245|emb|CAD89617.1| glutathione S-transferase [Crassostr... 39 0.061
gi|232192|sp|P30105|GTT1_DROMA Glutathione S-transferase 1-1 (GS... 39 0.080
gi|232195|sp|P30108|GTT1_DROYA Glutathione S-transferase 1-1 (GS... 39 0.080
gi|232193|sp|P30106|GTT1_DROSE Glutathione S-transferase 1-1 (GS... 39 0.080
gi|21243929|ref|NP_643511.1| glutathione transferase [Xanthomona... 39 0.080
gi|46204955|ref|ZP_00049243.2| COG0625: Glutathione S-transferas... 39 0.080
gi|14538008|gb|AAK66764.1| glutathione S-transferase D1 [Drosoph... 39 0.080
gi|25144449|ref|NP_741069.1| glutathione S-transferase omega 1 f... 39 0.080
gi|32188132|gb|AAP75790.1| glutathione S-transferase [Helicoverp... 39 0.080
gi|121698|sp|P15964|GT26_SCHMA Glutathione S-transferase 26 kDa ... 39 0.080
gi|232194|sp|P30107|GTT1_DROTE Glutathione S-transferase 1-1 (GS... 39 0.10
gi|385883|gb|AAB26519.1| glutathione S-transferase D1, DmGST1 {E... 39 0.10
gi|38049401|ref|XP_357096.1| similar to Glutathione S-transferas... 39 0.10
gi|17737923|ref|NP_524326.1| CG10045-PA [Drosophila melanogaster... 39 0.10
gi|24654975|ref|NP_611325.2| CG17524-PA [Drosophila melanogaster... 39 0.10
gi|49137574|ref|XP_413436.1| hypothetical protein AN9299.2 [Aspe... 39 0.10
gi|21464458|gb|AAM52032.1| RH47312p [Drosophila melanogaster] 39 0.10
gi|26989197|ref|NP_744622.1| glutathione S-transferase family pr... 38 0.14
gi|27366941|ref|NP_762468.1| Glutathione S-transferase [Vibrio v... 38 0.14
gi|34497230|ref|NP_901445.1| glutathione S-transferase family pr... 38 0.18
gi|8118486|gb|AAF72998.1| glutathione-S-transferase [Vibrio chol... 38 0.18
gi|46116630|ref|XP_384333.1| hypothetical protein FG04157.1 [Gib... 38 0.18
gi|39933897|ref|NP_946173.1| putative glutathionine S-transferas... 38 0.18
gi|37676718|ref|NP_937114.1| glutathione S-transferase [Vibrio v... 38 0.18
gi|15237931|ref|NP_197224.1| glutathione S-transferase, putative... 38 0.18
gi|34907162|ref|NP_914928.1| putative glutathione S-transferase ... 38 0.18
gi|39937374|ref|NP_949650.1| possible glutathione S-transferase ... 37 0.23
gi|48784200|ref|ZP_00280566.1| COG0625: Glutathione S-transferas... 37 0.23
gi|23619320|ref|NP_705282.1| elongation factor 1-gamma, putative... 37 0.23
gi|34496360|ref|NP_900575.1| probable glutathione S-transferase... 37 0.23
gi|34865655|ref|XP_345685.1| similar to GLUTATHIONE S-TRANSFERAS... 37 0.30
gi|16263606|ref|NP_436399.1| Gst13 glutathione S-transferase [Si... 37 0.30
gi|38047983|gb|AAR09894.1| similar to Drosophila melanogaster CG... 37 0.30
gi|31208165|ref|XP_313049.1| ENSANGP00000011661 [Anopheles gambi... 37 0.30
gi|31208161|ref|XP_313047.1| ENSANGP00000023440 [Anopheles gambi... 37 0.30
gi|46316963|ref|ZP_00217541.1| COG0625: Glutathione S-transferas... 37 0.40
gi|48862303|ref|ZP_00316200.1| COG0625: Glutathione S-transferas... 36 0.52
gi|22218855|pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutat... 36 0.52
gi|18158596|gb|AAL59658.1| glutathione S-transferase E1 [Anophel... 36 0.52
gi|31239111|ref|XP_319969.1| ENSANGP00000025069 [Anopheles gambi... 36 0.52
gi|38047681|gb|AAR09743.1| similar to Drosophila melanogaster CG... 36 0.52
gi|38100531|gb|EAA47645.1| hypothetical protein MG02888.4 [Magna... 36 0.52
gi|20806135|ref|NP_620796.1| peptidylprolyl isomerase C-associat... 36 0.52
gi|50260616|gb|EAL23269.1| hypothetical protein CNBA3850 [Crypto... 36 0.68
gi|16126882|ref|NP_421446.1| glutathione S-transferase family pr... 36 0.68
gi|26987897|ref|NP_743322.1| glutathione S-transferase family pr... 36 0.68
gi|32188134|gb|AAP75791.1| glutathione S-transferase [Helicoverp... 36 0.68
gi|15598017|ref|NP_251511.1| probable glutathione S-transferase ... 36 0.68
>gi|17534685|ref|NP_494883.1| glutathione S-Transferase (23.0 kD)
(gst-7) [Caenorhabditis elegans]
gi|29427661|sp|P91253|GTS7_CAEEL Probable glutathione S-transferase
7 (GST class-sigma)
gi|7498933|pir||T29985 hypothetical protein F11G11.2 -
Caenorhabditis elegans
gi|1707090|gb|AAB37846.1| Glutathione s-transferase protein 7
[Caenorhabditis elegans]
Length = 206
Score = 398 bits (1022), Expect = e-110
Identities = 194/206 (94%), Positives = 194/206 (94%)
Frame = +1
Query: 1 MVHYKVSYFPIRGAGEIARQILAYAGQDFEDNRIPKEEWPAVKPSTPFGQLPLLEVDGKV 180
MVHYKVSYFPIRGAGEIARQILAYAGQDFEDNRIPKEEWPAVKPSTPFGQLPLLEVDGKV
Sbjct: 1 MVHYKVSYFPIRGAGEIARQILAYAGQDFEDNRIPKEEWPAVKPSTPFGQLPLLEVDGKV 60
Query: 181 LAQSHAIARYLARQFGINGKCAWEEAQVNSVADQFKDYLNEVRPYFMVKMGFAEGDLDAL 360
LAQSHAIARYLARQFGINGKCAWEEAQVNSVADQFKDYLNEVRPYFMVKMGFAEGDLDAL
Sbjct: 61 LAQSHAIARYLARQFGINGKCAWEEAQVNSVADQFKDYLNEVRPYFMVKMGFAEGDLDAL 120
Query: 361 AKDVFLPGFKKHYGFFANFLKSAGSGYLVGDSLTFVDLLVAQHTXXXXXXXXXXXXEFPQ 540
AKDVFLPGFKKHYGFFANFLKSAGSGYLVGDSLTFVDLLVAQHT EFPQ
Sbjct: 121 AKDVFLPGFKKHYGFFANFLKSAGSGYLVGDSLTFVDLLVAQHTADLLAANAALLDEFPQ 180
Query: 541 FKAHQEKVHSNANIKKWLETRPVTPF 618
FKAHQEKVHSNANIKKWLETRPVTPF
Sbjct: 181 FKAHQEKVHSNANIKKWLETRPVTPF 206