Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F11G11_7
         (834 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [...   516   e-145
gi|687634|gb|AAA62504.1| collagen                                     501   e-141
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [...   126   1e-42
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha...   135   8e-31
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [...   134   3e-30
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno...   132   7e-30
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno...   113   6e-24
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ...    82   8e-19
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans]             95   2e-18
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8]                  84   3e-15
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p...    84   5e-15
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel...    80   4e-14
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi...    77   4e-13
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [...    76   1e-12
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g...    76   1e-12
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate...    74   3e-12
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8]                 74   5e-12
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ...    74   5e-12
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum]            73   9e-12
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]...    72   1e-11
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa]                    72   1e-11
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv...    72   2e-11
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e...    70   6e-11
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p...    70   6e-11
gi|39579268|emb|CAE56955.1| Hypothetical protein CBG24805 [Caeno...    69   1e-10
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ...    69   2e-10
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa]                    68   2e-10
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (...    68   2e-10
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-...    67   4e-10
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1                   67   6e-10
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno...    67   6e-10
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi...    67   6e-10
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g...    65   2e-09
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (...    64   3e-09
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD...    64   3e-09
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa]                    64   3e-09
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc...    64   4e-09
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid...    64   4e-09
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (...    64   5e-09
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para...    63   7e-09
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc...    63   9e-09
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ...    63   9e-09
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi...    62   2e-08
gi|28377133|ref|NP_784025.1| cell surface protein precursor [Lac...    62   2e-08
gi|32410635|ref|XP_325798.1| hypothetical protein [Neurospora cr...    62   2e-08
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ...    61   3e-08
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa]                    61   3e-08
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno...    61   3e-08
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna...    61   3e-08
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL...    60   4e-08
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo...    60   4e-08
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi...    60   6e-08
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel...    60   6e-08
gi|22093908|gb|AAM91821.1| choriogenin Hminor [Oryzias latipes]        60   6e-08
gi|22324231|emb|CAD44395.1| hypothetical protein [Enterococcus f...    60   6e-08
gi|34868438|ref|XP_232942.2| similar to RIKEN cDNA 2610207I16 [R...    60   8e-08
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno...    60   8e-08
gi|50421413|ref|XP_459257.1| unnamed protein product [Debaryomyc...    59   1e-07
gi|786136|gb|AAA99499.1| polymorphic immunodominant molecule           59   1e-07
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (...    59   1e-07
gi|31213353|ref|XP_315620.1| ENSANGP00000017827 [Anopheles gambi...    59   2e-07
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ...    59   2e-07
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp...    59   2e-07
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr...    59   2e-07
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa...    58   2e-07
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g...    58   2e-07
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi...    58   2e-07
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ...    58   3e-07
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec...    58   3e-07
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc...    58   3e-07
gi|39979119|emb|CAE85494.1| putative protein [Neurospora crassa]       58   3e-07
gi|4589850|dbj|BAA76901.1| choriogenin Hminor [Oryzias latipes]        58   3e-07
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha...    58   3e-07
gi|79960|pir||JH0204 hypothetical 30.5K protein precursor - Ente...    57   4e-07
gi|6322796|ref|NP_012869.1| RNAPII degradation factor, forms a c...    57   4e-07
gi|42734056|gb|AAS38928.1| similar to Dictyostelium discoideum (...    57   4e-07
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (...    57   5e-07
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can...    57   5e-07
gi|28850455|gb|AAO53219.1| similar to Plasmodium falciparum (iso...    57   5e-07
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo...    57   6e-07
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno...    57   6e-07
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul...    56   8e-07
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc...    56   8e-07
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa...    56   8e-07
gi|12083381|gb|AAG46367.1| antigen 38 [Trypanosoma cruzi]              56   8e-07
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno...    56   8e-07
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis]         56   1e-06
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc...    56   1e-06
gi|15600941|ref|NP_232571.1| conserved hypothetical protein [Vib...    56   1e-06
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,...    56   1e-06
gi|1170022|sp|P08568|GRPA_RAT Submandibular gland secretory Glx-...    56   1e-06
gi|283629|pir||S27770 hypothetical protein 1 - African malaria m...    56   1e-06
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (...    56   1e-06
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab...    56   1e-06
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ...    56   1e-06
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno...    55   1e-06
gi|50308049|ref|XP_454025.1| unnamed protein product [Kluyveromy...    55   2e-06
gi|38110797|gb|EAA56463.1| hypothetical protein MG06434.4 [Magna...    55   2e-06
gi|1841872|gb|AAB47544.1| MigA [Dictyostelium discoideum]              55   2e-06
gi|45201188|ref|NP_986758.1| AGR093Wp [Eremothecium gossypii] >g...    55   2e-06
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno...    55   2e-06
gi|34881108|ref|XP_343803.1| similar to OPA-containing protein 1...    55   2e-06
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ...    55   2e-06
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD...    55   2e-06
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens]        55   2e-06
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens]        55   2e-06
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det...    55   2e-06
gi|46561854|gb|AAT01144.1| soft fertilization envelope protein 9...    55   2e-06
gi|49070826|ref|XP_399702.1| hypothetical protein UM02087.1 [Ust...    55   2e-06
gi|28829619|gb|AAO52136.1| similar to Dictyostelium. Serine/thre...    55   2e-06
gi|42522727|ref|NP_968107.1| conserved hypothetical protein [Bde...    55   2e-06
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno...    55   2e-06
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi]             54   3e-06
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus...    54   3e-06
gi|91094|pir||A26892 Mopa box protein - mouse (fragment) >gnl|BL...    54   3e-06
gi|33468967|ref|NP_067496.1| trinucleotide repeat containing 11 ...    54   3e-06
gi|34849874|gb|AAH57119.1| Tnrc11 protein [Mus musculus]               54   3e-06
gi|9454386|gb|AAF87782.1| p76 membrane protein precursor [Mycopl...    54   3e-06
gi|1729824|sp|P54683|TAGB_DICDI Prestalk-specific protein tagB p...    54   3e-06
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand...    54   3e-06
gi|34784300|gb|AAH57085.1| Unknown (protein for MGC:67526) [Mus ...    54   3e-06
gi|15425633|dbj|BAB64304.1| beta-conglycinin alpha-subunit [Glyc...    54   3e-06
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib...    54   4e-06
gi|46438009|gb|EAK97347.1| hypothetical protein CaO19.5274 [Cand...    54   4e-06
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy...    54   4e-06
gi|28850410|gb|AAL92314.2| hypothetical protein [Dictyostelium d...    54   4e-06
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD...    54   4e-06
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi...    54   4e-06
gi|24660872|ref|NP_524849.2| CG32356-PA [Drosophila melanogaster...    54   5e-06
gi|92319|pir||A29573 Glx-rich protein - rat (fragment) >gnl|BL_O...    54   5e-06
gi|459931|gb|AAA40971.1| contiguous repeat polypeptide [Rattus n...    54   5e-06
gi|31126963|ref|NP_852105.1| glutamine/glutamic acid-rich protei...    54   5e-06
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|...    54   5e-06
gi|32420169|ref|XP_330528.1| hypothetical protein [Neurospora cr...    54   5e-06
gi|46048571|ref|NP_976077.1| hypothetical gene supported by M310...    54   5e-06
gi|38089141|ref|XP_146248.3| MYST histone acetyltransferase (mon...    54   5e-06
gi|49237347|ref|YP_031628.1| unknown [Frog virus 3] >gnl|BL_ORD_...    54   5e-06
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli...    53   7e-06
gi|32033879|ref|ZP_00134150.1| COG0810: Periplasmic protein TonB...    53   7e-06
gi|28828236|gb|AAO50913.1| similar to putative protein; protein ...    53   7e-06
gi|28569857|dbj|BAC57901.1| gag-like protein [Anopheles gambiae]       53   7e-06
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno...    53   7e-06
gi|37525548|ref|NP_928892.1| cell division protein [Photorhabdus...    53   9e-06
gi|25152272|ref|NP_509829.2| brain-specific angiogenesis inhibit...    53   9e-06
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel...    53   9e-06
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand...    53   9e-06
gi|32416182|ref|XP_328569.1| hypothetical protein [Neurospora cr...    53   9e-06
gi|7508112|pir||T25061 hypothetical protein T21B6.3 - Caenorhabd...    53   9e-06
gi|32422933|ref|XP_331910.1| predicted protein [Neurospora crass...    53   9e-06
gi|1513204|gb|AAC48703.1| involucrin                                   53   9e-06
gi|462434|sp|P34099|KAPC_DICDI cAMP-dependent protein kinase cat...    53   9e-06
gi|9454383|gb|AAF87780.1| p110 membrane protein precursor [Mycop...    53   9e-06
gi|241277|gb|AAB20716.1| serine/threonine protein kinase [Dictyo...    53   9e-06
gi|50404847|ref|YP_053939.1| DNA-binding protein, putative [Para...    53   9e-06
gi|11345236|gb|AAG34656.1| involucrin [Mus musculus]                   52   1e-05
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo...    52   1e-05
gi|23613862|ref|NP_704883.1| vesicle transport protein, putative...    52   1e-05
gi|34558672|gb|AAQ75078.1| RAD2 [Cryptosporidium parvum]               52   1e-05
gi|46226699|gb|EAK87678.1| XPG, DNA excision repair protein, fla...    52   1e-05
gi|28828976|gb|AAO51556.1| similar to Plasmodium falciparum. Pro...    52   1e-05
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ...    52   1e-05
gi|158896|gb|AAA29079.1| antigen LPCM61                                52   2e-05
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus]     52   2e-05
gi|29290086|gb|AAO67558.1| Gag protein [Drosophila virilis] >gnl...    52   2e-05
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus]                   52   2e-05
gi|32407190|ref|XP_324184.1| hypothetical protein [Neurospora cr...    52   2e-05
gi|126420|sp|P15714|LP61_EIMTE Antigen LPMC-61 >gnl|BL_ORD_ID|16...    52   2e-05
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa...    52   2e-05
gi|11345242|gb|AAG34659.1| involucrin [Mus musculus]                   52   2e-05
gi|19115358|ref|NP_594446.1| hypothetical protein; extensin-like...    52   2e-05
gi|6680506|ref|NP_032438.1| involucrin [Mus musculus] >gnl|BL_OR...    52   2e-05
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]...    52   2e-05
gi|8132107|gb|AAF73220.1| glutamine/glutamic acid-rich protein B...    52   2e-05
gi|11345238|gb|AAG34657.1| involucrin [Mus musculus]                   52   2e-05
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami...    52   2e-05
gi|30685162|ref|NP_188532.2| leucine-rich repeat family protein ...    52   2e-05
gi|47214987|emb|CAG01321.1| unnamed protein product [Tetraodon n...    52   2e-05
gi|16198327|gb|AAL14009.1| SD07158p [Drosophila melanogaster]          52   2e-05
gi|32404250|ref|XP_322738.1| predicted protein [Neurospora crass...    52   2e-05
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati...    52   2e-05
gi|20129887|ref|NP_610708.1| CG13185-PA [Drosophila melanogaster...    52   2e-05
gi|20259488|gb|AAM13864.1| unknown protein [Arabidopsis thaliana]      52   2e-05
gi|42733654|gb|AAO50823.2| similar to unknown protein; protein i...    52   2e-05
gi|11345234|gb|AAG34655.1| involucrin [Mus musculus]                   52   2e-05
gi|628967|pir||S45091 hypothetical protein iota - Streptococcus ...    52   2e-05
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [...    52   2e-05
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40                   52   2e-05
gi|27370170|ref|NP_766375.1| l(3)mbt-like 3 [Mus musculus] >gnl|...    51   3e-05
gi|38603523|dbj|BAD02898.1| bacteriolytic enzyme [Bacillus clausii]    51   3e-05
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis]            51   3e-05
gi|37360550|dbj|BAC98253.1| mKIAA1798 protein [Mus musculus]           51   3e-05
gi|49069194|ref|XP_398886.1| hypothetical protein UM01271.1 [Ust...    51   3e-05
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays]                  51   3e-05
gi|23509396|ref|NP_702063.1| hypothetical protein [Plasmodium fa...    51   3e-05
gi|11467826|ref|NP_050877.1| hypothetical chloroplast RF2 [Nephr...    51   3e-05
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib...    51   3e-05
gi|26326415|dbj|BAC26951.1| unnamed protein product [Mus musculus]     51   3e-05
gi|19921992|ref|NP_610608.1| CG12340-PA [Drosophila melanogaster...    51   3e-05
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can...    51   3e-05
gi|46442947|gb|EAL02232.1| hypothetical protein CaO19.8420 [Cand...    51   3e-05
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel...    51   3e-05
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc...    51   3e-05
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ...    51   3e-05
gi|1079271|pir||A48048 egg envelope protein wf - winter flounder...    51   4e-05
gi|27923923|ref|NP_778171.1| POU domain, class 6, transcription ...    51   4e-05
gi|27503875|gb|AAH42244.1| MGC53372 protein [Xenopus laevis]           51   4e-05
gi|34854626|ref|XP_218226.2| similar to mKIAA0287 protein [Rattu...    51   4e-05
gi|50758913|ref|XP_417476.1| PREDICTED: similar to Hypothetical ...    51   4e-05
gi|47115570|sp|O00841|CUDA_DICDI Putative transcriptional regula...    51   4e-05
gi|39579438|emb|CAE56766.1| Hypothetical protein CBG24569 [Caeno...    51   4e-05
gi|24668202|ref|NP_649329.1| CG7177-PA [Drosophila melanogaster]...    51   4e-05
gi|11346371|pir||T47235 sex determining protein [imported] - wes...    51   4e-05
gi|28374176|gb|AAH46263.1| LOC398566 protein [Xenopus laevis]          51   4e-05
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ...    51   4e-05
gi|627056|pir||A54641 interspersed repeat antigen precursor - ma...    50   5e-05
gi|50545197|ref|XP_500136.1| hypothetical protein [Yarrowia lipo...    50   5e-05
gi|467292|gb|AAA17387.1| glutamine-asparagine rich protein             50   5e-05
gi|1513206|gb|AAC48704.1| involucrin                                   50   5e-05
gi|32403194|ref|XP_322210.1| predicted protein [Neurospora crass...    50   5e-05
gi|45200797|ref|NP_986367.1| AGL300Cp [Eremothecium gossypii] >g...    50   5e-05
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ...    50   5e-05
gi|50547139|ref|XP_501039.1| hypothetical protein [Yarrowia lipo...    50   5e-05
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa...    50   5e-05
gi|39581822|emb|CAE60715.1| Hypothetical protein CBG04386 [Caeno...    50   5e-05
gi|38102578|gb|EAA49399.1| hypothetical protein MG01057.4 [Magna...    50   5e-05
gi|1223914|gb|AAB47214.1| endo16 [Strongylocentrotus purpuratus]       50   6e-05
gi|32410119|ref|XP_325540.1| predicted protein [Neurospora crass...    50   6e-05
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat...    50   6e-05
gi|37626131|gb|AAQ96507.1| hypothetical protein [Vibrio parahaem...    50   6e-05
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto...    50   6e-05
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697...    50   6e-05
gi|41191873|ref|XP_372978.1| similar to ENSANGP00000007346 [Homo...    50   6e-05
gi|48862277|ref|ZP_00316174.1| COG3979: Uncharacterized protein ...    50   6e-05
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal...    50   6e-05
gi|21282461|ref|NP_645549.1| conserved hypothetical protein [Sta...    50   6e-05
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ...    50   6e-05
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno...    50   6e-05
gi|46316651|ref|ZP_00217230.1| COG1530: Ribonucleases G and E [B...    50   6e-05
gi|32403550|ref|XP_322388.1| hypothetical protein [Neurospora cr...    50   6e-05
gi|1711421|sp|P54705|SNWA_DICDI Protein snwA >gnl|BL_ORD_ID|9602...    50   6e-05
gi|7489870|pir||T08875 histidine kinase homolog DHKB - slime mol...    50   6e-05
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate...    50   6e-05
gi|33354107|dbj|BAC81137.1| TNRC11 [Homo sapiens]                      50   8e-05
gi|33354109|dbj|BAC81138.1| TNRC11 [Pan troglodytes]                   50   8e-05
gi|49080662|ref|XP_403824.1| hypothetical protein UM06209.1 [Ust...    50   8e-05
gi|5524203|gb|AAD44162.1| OPA-containing protein [Homo sapiens]        50   8e-05
gi|30687957|ref|NP_568400.2| auxin-responsive factor (ARF7) [Ara...    50   8e-05
gi|2565059|gb|AAB91440.1| CAGH45 [Homo sapiens]                        50   8e-05
gi|34534595|dbj|BAC87055.1| unnamed protein product [Homo sapiens]     50   8e-05
gi|3426320|gb|AAC83163.1| OPA-containing protein [Homo sapiens]        50   8e-05
gi|32565935|ref|NP_500902.2| UNCoordinated locomotion UNC-44, an...    50   8e-05
gi|23820861|gb|AAA93447.2| Uncoordinated protein 44, isoform f [...    50   8e-05
gi|4249568|dbj|BAA74953.1| glycinin [Glycine max]                      50   8e-05
gi|7494885|pir||T15348 hypothetical protein B0350.1 - Caenorhabd...    50   8e-05
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ...    50   8e-05
gi|11078661|gb|AAG29138.1| Ras guanine nucleotide exchange facto...    50   8e-05
gi|24286634|gb|AAN46871.1| nucleotide exchange factor RasGEF B [...    50   8e-05
gi|30687943|ref|NP_851046.1| auxin-responsive factor (ARF7) [Ara...    50   8e-05
gi|45190780|ref|NP_985034.1| AER177Wp [Eremothecium gossypii] >g...    50   8e-05
gi|4103243|gb|AAD04807.1| BIPOSTO [Arabidopsis thaliana]               50   8e-05
gi|19310546|gb|AAL85006.1| unknown protein [Arabidopsis thaliana]      50   8e-05
gi|81779|pir||S20946 glycinin Gy4 precursor - soybean (cv. Forre...    50   8e-05
gi|20502826|gb|AAM22643.1| cGMP-dependent protein kinase [Eimeri...    50   8e-05
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot...    50   8e-05
gi|1663694|dbj|BAA12112.1| Product has a CAG repeat region simil...    50   8e-05
gi|99910|pir||S11004 glycinin G4 precursor - soybean >gnl|BL_ORD...    50   8e-05
gi|4827042|ref|NP_005111.1| trinucleotide repeat containing 11 (...    50   8e-05
gi|30022968|ref|NP_834599.1| Cell surface protein [Bacillus cere...    50   8e-05
gi|29246869|gb|EAA38450.1| GLP_191_32543_34384 [Giardia lamblia ...    50   8e-05
gi|38348250|ref|NP_940867.1| Nik related kinase [Homo sapiens] >...    50   8e-05
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis]            50   8e-05
gi|6015515|emb|CAB57802.1| glycinin [Glycine max]                      50   8e-05
gi|124730|sp|P24710|INVO_GALCR Involucrin >gnl|BL_ORD_ID|1873056...    50   8e-05
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc...    50   8e-05
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa...    50   8e-05
gi|30687949|ref|NP_851047.1| auxin-responsive factor (ARF7) [Ara...    50   8e-05
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli...    50   8e-05
gi|47223366|emb|CAG04227.1| unnamed protein product [Tetraodon n...    49   1e-04
gi|11345232|gb|AAG34654.1| involucrin [Mus musculus]                   49   1e-04
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa...    49   1e-04
gi|32421759|ref|XP_331323.1| hypothetical protein [Neurospora cr...    49   1e-04
gi|50306605|ref|XP_453276.1| unnamed protein product [Kluyveromy...    49   1e-04
gi|50545898|ref|XP_500487.1| hypothetical protein [Yarrowia lipo...    49   1e-04
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil...    49   1e-04
gi|50309619|ref|XP_454821.1| unnamed protein product [Kluyveromy...    49   1e-04
gi|26000376|gb|AAN75486.1| dentin matrix protein 1 [Kerivoula ha...    49   1e-04
gi|42734053|gb|AAS38925.1| hypothetical protein [Dictyostelium d...    49   1e-04
gi|24664026|ref|NP_729947.1| CG32133-PA [Drosophila melanogaster...    49   1e-04
gi|11071800|emb|CAC14644.1| lectin-related protein [Leishmania m...    49   1e-04
gi|4104929|gb|AAD02218.1| auxin response factor 7 [Arabidopsis t...    49   1e-04
gi|23491066|gb|EAA22695.1| hypothetical protein [Plasmodium yoel...    49   1e-04
gi|46444861|gb|EAL04133.1| hypothetical protein CaO19.12113 [Can...    49   1e-04
gi|13182946|gb|AAK14999.1| centromere binding protein 1 [Candida...    49   1e-04
gi|28571738|ref|NP_732034.2| CG5166-PC [Drosophila melanogaster]...    49   1e-04
gi|32421111|ref|XP_330999.1| hypothetical protein [Neurospora cr...    49   1e-04
gi|13242414|ref|NP_077437.1| tegument protein [Cercopithecine he...    49   1e-04
gi|514833|gb|AAA19975.1| nuclear hormone receptor superfamily pr...    49   1e-04
gi|539440|pir||A49070 ecdysone-inducible protein E78A - fruit fl...    49   1e-04
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis]            49   1e-04
gi|50550967|ref|XP_502957.1| hypothetical protein [Yarrowia lipo...    49   1e-04
gi|47077602|dbj|BAD18683.1| unnamed protein product [Homo sapiens]     49   1e-04
gi|28829875|gb|AAO52372.1| similar to Dictyostelium discoideum (...    49   1e-04
gi|32403422|ref|XP_322324.1| predicted protein [Neurospora crass...    49   1e-04
gi|47221067|emb|CAG12761.1| unnamed protein product [Tetraodon n...    49   1e-04
gi|42733801|gb|AAS38719.1| similar to Dictyostelium discoideum (...    49   1e-04
gi|24648119|ref|NP_650778.1| CG6026-PA [Drosophila melanogaster]...    49   1e-04
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno...    49   1e-04
gi|24647162|ref|NP_732033.1| CG5166-PB [Drosophila melanogaster]...    49   1e-04
gi|46441545|gb|EAL00841.1| hypothetical protein CaO19.14026 [Can...    49   1e-04
gi|46115698|ref|XP_383867.1| hypothetical protein FG03691.1 [Gib...    49   1e-04
gi|32698003|emb|CAB04326.3| Hypothetical protein F36F2.3 [Caenor...    49   1e-04
gi|7500635|pir||T21861 hypothetical protein F36F2.3 - Caenorhabd...    49   1e-04
gi|50288897|ref|XP_446878.1| unnamed protein product [Candida gl...    49   1e-04
gi|128099|sp|P17691|NEUM_CARAU Neuromodulin (Axonal membrane pro...    49   1e-04
gi|16182353|gb|AAL13482.1| GH01409p [Drosophila melanogaster]          49   1e-04
gi|49483028|ref|YP_040252.1| putative exported protein [Staphylo...    49   1e-04
gi|24647164|ref|NP_650466.2| CG5166-PA [Drosophila melanogaster]...    49   1e-04
gi|50260382|gb|EAL23041.1| hypothetical protein CNBA8080 [Crypto...    49   1e-04
gi|17533565|ref|NP_496785.1| prion-like Q/N-rich domain protein ...    49   1e-04
gi|49523567|emb|CAF18245.1| STYLOSA protein [Antirrhinum majus]        49   1e-04
gi|17507217|ref|NP_492424.1| retinoblastoma binding protein 6 li...    49   1e-04
gi|2243140|emb|CAA67384.1| nuclear hormone receptor [Drosophila ...    49   1e-04
gi|7769648|gb|AAF69494.1| nuclear receptor E78A [Drosophila mela...    49   1e-04
gi|34223729|sp|P45447|E78A_DROME Ecdysone-induced protein 78C (D...    49   1e-04
gi|25009850|gb|AAN71095.1| AT22221p [Drosophila melanogaster]          49   1e-04
gi|28850383|gb|AAO53158.1| similar to Plasmodium falciparum (iso...    49   2e-04
gi|11493665|gb|AAG35598.1| secalin precursor [Secale cereale]          49   2e-04
gi|21402779|ref|NP_658764.1| hypothetical protein predicted by G...    49   2e-04
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par...    49   2e-04
gi|2623347|gb|AAC53431.1| sex determining protein [Mus musculus ...    49   2e-04
gi|6321316|ref|NP_011393.1| nuclear polyadenylated RNA binding p...    49   2e-04
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P...    49   2e-04
gi|7486768|pir||T08588 hypothetical protein L23H3.30 - Arabidops...    49   2e-04
gi|49523317|gb|AAH75641.1| Smarca2 protein [Mus musculus]              49   2e-04
gi|49135114|ref|XP_413269.1| hypothetical protein AN9132.2 [Aspe...    49   2e-04
gi|37626197|gb|AAQ96572.1| hypothetical protein [Vibrio parahaem...    49   2e-04
gi|755081|gb|AAB00073.1| schizont/sporozoite surface protein >gn...    49   2e-04
gi|2623363|gb|AAC53439.1| sex determining protein [Mus musculus ...    49   2e-04
gi|15923760|ref|NP_371294.1| conserved hypothetical protein [Sta...    49   2e-04
gi|18418034|ref|NP_567896.1| WD-40 repeat family protein (LEUNIG...    49   2e-04
gi|49073324|ref|XP_400889.1| hypothetical protein UM03274.1 [Ust...    49   2e-04
gi|29290093|gb|AAO67564.1| Pol protein [Drosophila virilis]            49   2e-04
gi|24650937|ref|NP_651666.1| CG11873-PA [Drosophila melanogaster...    49   2e-04
gi|11141605|gb|AAG32022.1| LEUNIG [Arabidopsis thaliana]               49   2e-04
gi|28830194|gb|AAO52645.1| similar to Homo sapiens (Human). HIWI...    49   2e-04
gi|32419885|ref|XP_330386.1| predicted protein [Neurospora crass...    49   2e-04
gi|28571998|ref|NP_788769.1| CG12071-PB [Drosophila melanogaster...    48   2e-04
gi|50752502|ref|XP_422807.1| PREDICTED: similar to golgi phospho...    48   2e-04
gi|6746588|gb|AAF27637.1| ecdysone-inducible gene E1 [Drosophila...    48   2e-04
gi|112674|sp|P13813|110K_PLAKN 110 kDa antigen (PK110) >gnl|BL_O...    48   2e-04
gi|46110333|ref|XP_382224.1| hypothetical protein FG02048.1 [Gib...    48   2e-04
gi|18766204|gb|AAL78899.1| merozoite surface protein-9 precursor...    48   2e-04
gi|39583277|emb|CAE60069.1| Hypothetical protein CBG03586 [Caeno...    48   2e-04
gi|42660863|ref|XP_064152.5| sarcalumenin [Homo sapiens]               48   2e-04
gi|42733860|gb|AAS38778.1| similar to exonuclease ii [Schizosacc...    48   2e-04
gi|46124233|ref|XP_386670.1| hypothetical protein FG06494.1 [Gib...    48   2e-04
gi|24667281|ref|NP_730499.1| CG17233-PA [Drosophila melanogaster...    48   2e-04
gi|33354111|dbj|BAC81139.1| TNRC11 [Pongo pygmaeus]                    48   2e-04
gi|50303983|ref|XP_451941.1| unnamed protein product [Kluyveromy...    48   2e-04
gi|49073124|ref|XP_400794.1| hypothetical protein UM03179.1 [Ust...    48   2e-04
gi|14164561|gb|AAK55123.1| Swift [Xenopus laevis]                      48   2e-04
gi|39591554|emb|CAE71130.1| Hypothetical protein CBG17984 [Caeno...    48   2e-04
gi|7512088|pir||T30282 calcium-binding protein - sea urchin (Str...    48   2e-04
gi|50255862|gb|EAL18593.1| hypothetical protein CNBJ0190 [Crypto...    48   2e-04
gi|1222642|emb|CAA63070.1| collagen [Brugia pahangi]                   48   2e-04
gi|12053779|emb|CAC20094.1| Nahoda protein [Drosophila melanogas...    48   3e-04
gi|23480798|gb|EAA17260.1| hypothetical protein [Plasmodium yoel...    48   3e-04
gi|12860567|dbj|BAB31990.1| unnamed protein product [Mus musculus]     48   3e-04
gi|21703896|ref|NP_663424.1| ISG12 [Mus musculus] >gnl|BL_ORD_ID...    48   3e-04
gi|42627815|tpe|CAE00399.1| TPA: putative ISG12(b2) protein [Mus...    48   3e-04
gi|1076488|pir||S54802 glycinin A5A4B3 chain - soybean >gnl|BL_O...    48   3e-04
gi|24654914|ref|NP_728554.1| CG32479-PA [Drosophila melanogaster...    48   3e-04
gi|45384000|ref|NP_990596.1| nucleolin; protein C23 [Gallus gall...    48   3e-04
gi|32328882|dbj|BAC78524.1| prepro beta-conglycinin alpha prime ...    48   3e-04
gi|3024638|sp|Q62565|SRY_MUSSI Sex-determining region Y protein ...    48   3e-04
gi|28828696|gb|AAM33200.2| similar to Dictyostelium discoideum (...    48   3e-04
gi|34394194|dbj|BAC84646.1| hypothetical protein [Oryza sativa (...    48   3e-04
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno...    48   3e-04
gi|108693|pir||A40437 glutamic acid-rich protein, retinal - bovi...    48   3e-04
gi|34854792|ref|XP_218287.2| similar to putative odorant recepto...    48   3e-04
gi|124733|sp|P14590|INVO_LEMCA Involucrin >gnl|BL_ORD_ID|1468131...    48   3e-04
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl...    48   3e-04
gi|121286|sp|P11827|GLCX_SOYBN Beta-conglycinin, alpha' chain pr...    47   4e-04
gi|10636143|emb|CAC10624.1| gamma-gliadin [Aegilops speltoides]        47   4e-04
gi|46444705|gb|EAL03978.1| hypothetical protein CaO19.4643 [Cand...    47   4e-04
gi|46138029|ref|XP_390705.1| hypothetical protein FG10529.1 [Gib...    47   4e-04
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633...    47   4e-04
gi|28829810|gb|AAO52312.1| similar to Dictyostelium discoideum (...    47   4e-04
gi|22024201|ref|NP_611354.2| CG30122-PB [Drosophila melanogaster...    47   4e-04
gi|23613080|ref|NP_703402.1| hypothetical protein [Plasmodium fa...    47   4e-04
gi|20378270|gb|AAM20900.1| cGMP-dependent protein kinase [Eimeri...    47   4e-04
gi|9967361|dbj|BAA74452.2| alpha' subunit of beta-conglycinin [G...    47   4e-04
gi|45550760|ref|NP_650667.2| CG7305-PA [Drosophila melanogaster]...    47   4e-04
gi|40806973|gb|AAH65279.1| FLJ10006 protein [Homo sapiens]             47   4e-04
gi|28829482|gb|AAL92370.2| similar to Dictyostelium discoideum (...    47   4e-04
gi|17425218|dbj|BAB78764.1| low-molecular-weight glutenin subuni...    47   4e-04
gi|32411685|ref|XP_326323.1| hypothetical protein [Neurospora cr...    47   4e-04
gi|24667937|ref|NP_524195.2| CG18023-PA [Drosophila melanogaster...    47   4e-04
gi|46125747|ref|XP_387427.1| hypothetical protein FG07251.1 [Gib...    47   4e-04
gi|16762342|ref|NP_457959.1| cell division protein [Salmonella e...    47   4e-04
gi|50294998|ref|XP_449910.1| unnamed protein product [Candida gl...    47   4e-04
gi|50556372|ref|XP_505594.1| hypothetical protein [Yarrowia lipo...    47   4e-04
gi|38567183|emb|CAE76476.1| related to zinc finger protein crol ...    47   4e-04
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ...    47   4e-04
gi|21224806|ref|NP_630585.1| hypothetical protein SC1E6.12 [Stre...    47   4e-04
gi|30794328|ref|NP_851362.1| cyclic nucleotide gated channel bet...    47   4e-04
gi|32422843|ref|XP_331865.1| hypothetical protein [Neurospora cr...    47   4e-04
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab...    39   4e-04
gi|48097882|ref|XP_393913.1| similar to ENSANGP00000017516 [Apis...    47   5e-04
gi|50551733|ref|XP_503341.1| hypothetical protein [Yarrowia lipo...    47   5e-04
gi|12957024|emb|CAC29194.1| hypothetical protein [Enterococcus f...    47   5e-04
gi|34394290|dbj|BAC84772.1| putative heavy-metal-associated doma...    47   5e-04
gi|46123749|ref|XP_386428.1| hypothetical protein FG06252.1 [Gib...    47   5e-04
gi|24652500|ref|NP_523686.2| CG2368-PB [Drosophila melanogaster]...    47   5e-04
gi|50806838|ref|XP_428858.1| PREDICTED: similar to tumor-related...    47   5e-04
gi|31202189|ref|XP_310043.1| ENSANGP00000015192 [Anopheles gambi...    47   5e-04
gi|42783920|ref|NP_981167.1| spore germination protein GerHA [Ba...    47   5e-04
gi|50555313|ref|XP_505065.1| hypothetical protein [Yarrowia lipo...    47   5e-04
gi|28828426|gb|AAL96730.2| similar to Dictyostelium discoideum (...    47   5e-04
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-...    47   5e-04
gi|32398987|emb|CAD98452.1| hypothetical predicted protein, unkn...    47   5e-04
gi|15822818|dbj|BAB68768.1| CLOCK-S [Rattus norvegicus]                47   5e-04
gi|1149501|emb|CAA62475.1| pipsqueak [Drosophila melanogaster]         47   5e-04
gi|113005|sp|P22620|ABRA_PLAFC 101 kDa malaria antigen (P101) (A...    47   5e-04
gi|23508971|ref|NP_701639.1| 101 kd malaria antigen [Plasmodium ...    47   5e-04
gi|45550130|ref|NP_608921.2| CG14023-PA [Drosophila melanogaster...    47   5e-04
gi|23396860|sp|P70663|SPL1_MOUSE SPARC-like protein 1 precursor ...    47   5e-04
gi|31982800|ref|NP_034227.2| SPARC-like 1 (mast9, hevin); extrac...    47   5e-04
gi|113007|sp|P23745|ABRA_PLAFG 101 kDa malaria antigen (P101) (A...    47   5e-04
gi|46128975|ref|XP_388965.1| hypothetical protein FG08789.1 [Gib...    47   5e-04
gi|1203923|gb|AAC47154.1| PsqB                                         47   5e-04
gi|1203907|gb|AAC47153.1| PsqA                                         47   5e-04
gi|7158835|gb|AAF37556.1| p101/acidic basic repeat antigen [Plas...    47   5e-04
gi|11177898|ref|NP_068628.1| clock gene [Rattus norvegicus] >gnl...    47   5e-04
gi|310893|gb|AAA18800.1| membrane protein                              47   5e-04
gi|46229165|gb|EAK90014.1| hypothetical protein cgd6_4110 [Crypt...    47   5e-04
gi|48098463|ref|XP_392066.1| similar to mblk-1 [Apis mellifera]        47   5e-04
gi|2133667|pir||S66149 gene pipsqueak protein A long form - frui...    47   5e-04
gi|33329250|gb|AAQ10025.1| putative esophageal gland cell secret...    47   5e-04
gi|1322382|emb|CAA96573.1| ZP2 [Cyprinus carpio]                       47   5e-04
gi|23487253|gb|EAA21007.1| hypothetical protein [Plasmodium yoel...    47   5e-04
gi|37531244|ref|NP_919924.1| unknown protein [Oryza sativa (japo...    47   5e-04
gi|49074246|ref|XP_401271.1| hypothetical protein UM03656.1 [Ust...    47   5e-04
gi|46437429|gb|EAK96776.1| hypothetical protein CaO19.2859 [Cand...    47   5e-04
gi|46320109|ref|ZP_00220502.1| COG1530: Ribonucleases G and E [B...    47   5e-04
gi|24652502|ref|NP_724955.1| CG2368-PA [Drosophila melanogaster]...    47   5e-04
gi|24652508|ref|NP_724958.1| CG2368-PD [Drosophila melanogaster]...    47   5e-04
gi|21231078|ref|NP_636995.1| unknown acidic aa rich protein [Xan...    47   7e-04
gi|24649755|ref|NP_651279.1| CG13627-PA [Drosophila melanogaster...    47   7e-04
gi|37528750|gb|AAQ92320.1| elafin [Ovis aries]                         47   7e-04
gi|24660458|ref|NP_729301.1| CG17888-PD [Drosophila melanogaster...    47   7e-04
gi|23619067|ref|NP_705029.1| hypothetical protein [Plasmodium fa...    47   7e-04
gi|25012526|gb|AAN71366.1| RE32656p [Drosophila melanogaster]          47   7e-04
gi|45551964|ref|NP_733032.2| CG13627-PB [Drosophila melanogaster...    47   7e-04
gi|27368078|gb|AAN86960.1| retinitis pigmentosa 1-like 1 protein...    47   7e-04
gi|23480318|gb|EAA16908.1| Drosophila melanogaster CG8797 gene p...    47   7e-04
gi|12018306|ref|NP_072143.1| nucleolin-related protein [Rattus n...    47   7e-04
gi|27368082|gb|AAN86962.1| retinitis pigmentosa 1-like 1 protein...    47   7e-04
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand...    47   7e-04
gi|7861746|gb|AAF70384.1| GABA-A receptor epsilon-like subunit [...    47   7e-04
gi|42559826|sp|Q8IWN7|RPL1_HUMAN Retinitis pigmentosa 1-like 1 p...    47   7e-04
gi|40255278|ref|NP_849188.3| retinitis pigmentosa 1-like 1 [Homo...    47   7e-04
gi|27368080|gb|AAN86961.1| retinitis pigmentosa 1-like 1 protein...    47   7e-04
gi|27368084|gb|AAN86963.1| retinitis pigmentosa 1-like 1 protein...    47   7e-04
gi|17537743|ref|NP_497048.1| low density lipoprotein receptor (2...    47   7e-04
gi|50304411|ref|XP_452155.1| unnamed protein product [Kluyveromy...    47   7e-04
gi|27692337|ref|XP_227371.1| similar to repetin [Rattus norvegicus]    47   7e-04
gi|15644749|ref|NP_206919.1| hypothetical protein HP0119 [Helico...    47   7e-04
gi|47220829|emb|CAG00036.1| unnamed protein product [Tetraodon n...    47   7e-04
gi|29143830|ref|NP_807172.1| cell division protein [Salmonella e...    47   7e-04
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand...    47   7e-04
gi|28850391|gb|AAO53165.1| similar to midasin, a large protein w...    47   7e-04
gi|31208933|ref|XP_313433.1| ENSANGP00000019634 [Anopheles gambi...    47   7e-04
gi|8393396|ref|NP_059065.1| gamma-aminobutyric acid (GABA-A) rec...    47   7e-04
gi|33440491|gb|AAH56140.1| PNN protein [Danio rerio]                   47   7e-04
gi|27368076|gb|AAN86959.1| retinitis pigmentosa 1-like 1 protein...    47   7e-04
gi|32407697|ref|XP_324355.1| hypothetical protein [Neurospora cr...    47   7e-04
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ...    47   7e-04
gi|15924471|ref|NP_372005.1| elastin binding protein [Staphyloco...    46   9e-04
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p...    46   9e-04
gi|2623355|gb|AAC53435.1| sex determining protein [Mus musculus ...    46   9e-04
gi|38110696|gb|EAA56379.1| hypothetical protein MG06350.4 [Magna...    46   9e-04
gi|46437481|gb|EAK96827.1| hypothetical protein CaO19.10377 [Can...    46   9e-04
gi|30689268|ref|NP_173925.3| phytochrome and flowering time regu...    46   9e-04
gi|23613415|ref|NP_703259.1| asparagine-rich antigen Pfa35-2 [Pl...    46   9e-04
gi|42784532|ref|NP_981779.1| LPXTG-motif cell wall anchor domain...    46   9e-04
gi|32422107|ref|XP_331497.1| predicted protein [Neurospora crass...    46   9e-04
gi|32420087|ref|XP_330487.1| predicted protein [Neurospora crass...    46   9e-04
gi|32421133|ref|XP_331010.1| hypothetical protein [Neurospora cr...    46   9e-04
gi|47208417|emb|CAF92198.1| unnamed protein product [Tetraodon n...    46   9e-04
gi|18266690|ref|NP_543167.1| Fas death domain-associated protein...    46   9e-04
gi|29828894|ref|NP_823528.1| hypothetical protein SAV2352 [Strep...    46   9e-04
gi|47208936|emb|CAF90803.1| unnamed protein product [Tetraodon n...    46   9e-04
gi|28301672|emb|CAD36957.1| retinitis pigmentosa 1-like protein ...    46   9e-04
gi|24668030|ref|NP_649309.1| CG12971-PA [Drosophila melanogaster...    46   9e-04
gi|13472197|ref|NP_103764.1| unknown protein [Mesorhizobium loti...    46   9e-04
gi|25518714|pir||G86385 hypothetical protein F2J7.4 [imported] -...    46   9e-04
gi|34327950|dbj|BAA20761.2| KIAA0301 [Homo sapiens]                    46   9e-04
gi|47085973|ref|NP_998351.1| zgc:85667 [Danio rerio] >gnl|BL_ORD...    46   9e-04
gi|42519751|ref|NP_965681.1| hypothetical protein LJ0574 [Lactob...    46   9e-04


>gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17)
           [Caenorhabditis elegans]
 gi|22532953|gb|AAB37841.3| Collagen protein 17 [Caenorhabditis
           elegans]
          Length = 277

 Score =  516 bits (1329), Expect = e-145
 Identities = 259/277 (93%), Positives = 259/277 (93%)
 Frame = -1

Query: 834 MRSISAVLVPTLFVENTPSSINSVKLRAVRSVKPTNAALVESDQLDPLETQDKTEPQEMT 655
           MRSISAVLVPTLFVENTPSSINSVKLRAVRSVKPTNAALVESDQLDPLETQDKTEPQEMT
Sbjct: 1   MRSISAVLVPTLFVENTPSSINSVKLRAVRSVKPTNAALVESDQLDPLETQDKTEPQEMT 60

Query: 654 EDQEPQELQDQMLQMIMFNQPPPISASSAHQDQPETPETQDQRDHQDSQEHQESKDQMDA 475
           EDQEPQELQDQMLQMIMFNQPPPISASSAHQDQPETPETQDQRDHQDSQEHQESKDQMDA
Sbjct: 61  EDQEPQELQDQMLQMIMFNQPPPISASSAHQDQPETPETQDQRDHQDSQEHQESKDQMDA 120

Query: 474 QEPQEPQDHKDHQEPQDKTELQDNQEPQDKSAPSQPHQGTQDSQESQEPKDHQDQTDTQE 295
           QEPQEPQDHKDHQEPQDKTELQDNQEPQDKSAPSQPHQGTQDSQESQEPKDHQDQTDTQE
Sbjct: 121 QEPQEPQDHKDHQEPQDKTELQDNQEPQDKSAPSQPHQGTQDSQESQEPKDHQDQTDTQE 180

Query: 294 ALDHKDHQDHKEMLDKXXXXXXXXXXXXXXXXXXTDPRDLAITAHHQELLQDIKRNFSKS 115
           ALDHKDHQDHKEMLDK                  TDPRDLAITAHHQELLQDIKRNFSKS
Sbjct: 181 ALDHKDHQDHKEMLDKTELQETQEPQERPESQERTDPRDLAITAHHQELLQDIKRNFSKS 240

Query: 114 LLLILGTSINDIYHFILPLLVIRQTISDTSHNLPNLF 4
           LLLILGTSINDIYHFILPLLVIRQTISDTSHNLPNLF
Sbjct: 241 LLLILGTSINDIYHFILPLLVIRQTISDTSHNLPNLF 277




[DB home][top]