Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F11G11_9
(858 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 366 e-100
gi|687634|gb|AAA62504.1| collagen 361 1e-98
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 145 5e-67
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 254 1e-66
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno... 249 5e-65
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 240 3e-62
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [... 150 3e-35
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e... 145 8e-34
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 143 4e-33
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 137 2e-31
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 135 1e-30
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 131 2e-29
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ... 126 7e-28
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab... 126 7e-28
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno... 126 7e-28
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno... 123 4e-27
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 123 6e-27
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ... 123 6e-27
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 118 1e-25
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ... 114 2e-24
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 114 4e-24
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [... 112 1e-23
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 111 2e-23
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno... 111 2e-23
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 110 3e-23
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 110 3e-23
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 110 4e-23
gi|1813688|gb|AAC47626.1| unknown [Brugia malayi] >gnl|BL_ORD_ID... 108 1e-22
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 108 1e-22
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 108 2e-22
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 107 3e-22
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 107 3e-22
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 106 6e-22
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 106 6e-22
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 104 3e-21
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 102 1e-20
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 101 2e-20
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 101 2e-20
gi|39579268|emb|CAE56955.1| Hypothetical protein CBG24805 [Caeno... 100 5e-20
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 100 7e-20
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 96 1e-18
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 96 1e-18
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 92 1e-17
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40 92 1e-17
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 89 1e-16
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 87 5e-16
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 87 5e-16
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 79 6e-16
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 87 6e-16
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 87 6e-16
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 87 6e-16
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 84 3e-15
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 84 5e-15
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 82 1e-14
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 82 1e-14
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 82 1e-14
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 82 2e-14
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 82 2e-14
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 80 4e-14
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 80 6e-14
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 80 7e-14
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 80 7e-14
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 80 7e-14
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (... 79 1e-13
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 79 1e-13
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 79 1e-13
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 79 1e-13
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 79 1e-13
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 79 1e-13
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 79 2e-13
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 79 2e-13
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 78 2e-13
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 77 4e-13
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 77 4e-13
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 77 4e-13
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 77 5e-13
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl... 77 6e-13
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 76 8e-13
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 76 8e-13
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 76 1e-12
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 74 3e-12
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 74 5e-12
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 73 9e-12
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 72 1e-11
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 72 1e-11
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 72 2e-11
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 72 2e-11
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 70 6e-11
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 70 8e-11
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 69 1e-10
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 69 1e-10
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|... 69 2e-10
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 68 2e-10
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 68 3e-10
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 68 3e-10
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 67 4e-10
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 67 5e-10
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (... 67 5e-10
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr... 67 6e-10
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna... 66 8e-10
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (... 65 2e-09
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g... 65 2e-09
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 65 2e-09
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 64 3e-09
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 64 4e-09
gi|1841872|gb|AAB47544.1| MigA [Dictyostelium discoideum] 64 4e-09
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det... 63 7e-09
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi... 63 7e-09
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 63 9e-09
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 63 9e-09
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD... 63 9e-09
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens] 63 9e-09
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens] 63 9e-09
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 63 9e-09
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 63 9e-09
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 62 1e-08
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec... 62 2e-08
gi|283629|pir||S27770 hypothetical protein 1 - African malaria m... 62 2e-08
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 62 2e-08
gi|47208936|emb|CAF90803.1| unnamed protein product [Tetraodon n... 62 2e-08
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 62 2e-08
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 61 4e-08
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 61 4e-08
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus... 61 4e-08
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ... 60 5e-08
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo... 60 5e-08
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 60 5e-08
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 60 5e-08
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 60 5e-08
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 60 6e-08
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ... 60 8e-08
gi|16198327|gb|AAL14009.1| SD07158p [Drosophila melanogaster] 60 8e-08
gi|17537743|ref|NP_497048.1| low density lipoprotein receptor (2... 60 8e-08
gi|20129887|ref|NP_610708.1| CG13185-PA [Drosophila melanogaster... 60 8e-08
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 60 8e-08
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 60 8e-08
gi|42733841|gb|AAS38759.1| similar to Dictyostelium discoideum (... 59 1e-07
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ... 59 1e-07
gi|46316651|ref|ZP_00217230.1| COG1530: Ribonucleases G and E [B... 59 1e-07
gi|34881108|ref|XP_343803.1| similar to OPA-containing protein 1... 59 1e-07
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 59 1e-07
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 59 1e-07
gi|38110797|gb|EAA56463.1| hypothetical protein MG06434.4 [Magna... 59 1e-07
gi|21711749|gb|AAM75065.1| RE28238p [Drosophila melanogaster] 59 2e-07
gi|24584075|ref|NP_723804.1| CG6043-PC [Drosophila melanogaster]... 59 2e-07
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli... 59 2e-07
gi|27819785|gb|AAO24941.1| RE65015p [Drosophila melanogaster] 59 2e-07
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ... 59 2e-07
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ... 59 2e-07
gi|39979119|emb|CAE85494.1| putative protein [Neurospora crassa] 59 2e-07
gi|24584069|ref|NP_723801.1| CG6043-PA [Drosophila melanogaster]... 59 2e-07
gi|45190780|ref|NP_985034.1| AER177Wp [Eremothecium gossypii] >g... 59 2e-07
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 59 2e-07
gi|24584067|ref|NP_609629.1| CG6043-PD [Drosophila melanogaster]... 59 2e-07
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 59 2e-07
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 58 2e-07
gi|28901310|ref|NP_800965.1| hypothetical protein VPA1455 [Vibri... 58 2e-07
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno... 58 2e-07
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 58 2e-07
gi|8132107|gb|AAF73220.1| glutamine/glutamic acid-rich protein B... 58 2e-07
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays] 58 3e-07
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy... 58 3e-07
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 58 3e-07
gi|46320109|ref|ZP_00220502.1| COG1530: Ribonucleases G and E [B... 58 3e-07
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa... 57 4e-07
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc... 57 4e-07
gi|22093908|gb|AAM91821.1| choriogenin Hminor [Oryzias latipes] 57 4e-07
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 57 4e-07
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 57 4e-07
gi|49117079|gb|AAH73018.1| Unknown (protein for IMAGE:5048167) [... 57 4e-07
gi|28569857|dbj|BAC57901.1| gag-like protein [Anopheles gambiae] 57 4e-07
gi|46048571|ref|NP_976077.1| hypothetical gene supported by M310... 57 4e-07
gi|32416182|ref|XP_328569.1| hypothetical protein [Neurospora cr... 57 4e-07
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697... 57 4e-07
gi|49080662|ref|XP_403824.1| hypothetical protein UM06209.1 [Ust... 57 4e-07
gi|32328882|dbj|BAC78524.1| prepro beta-conglycinin alpha prime ... 57 5e-07
gi|112674|sp|P13813|110K_PLAKN 110 kDa antigen (PK110) >gnl|BL_O... 57 5e-07
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 57 5e-07
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p... 57 5e-07
gi|28374176|gb|AAH46263.1| LOC398566 protein [Xenopus laevis] 57 5e-07
gi|31213353|ref|XP_315620.1| ENSANGP00000017827 [Anopheles gambi... 57 5e-07
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 57 5e-07
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 57 7e-07
gi|11346371|pir||T47235 sex determining protein [imported] - wes... 57 7e-07
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ... 57 7e-07
gi|121286|sp|P11827|GLCX_SOYBN Beta-conglycinin, alpha' chain pr... 57 7e-07
gi|27802723|emb|CAD60828.1| SI:bZ1D10.2 (novel protein similar t... 57 7e-07
gi|28377133|ref|NP_784025.1| cell surface protein precursor [Lac... 57 7e-07
gi|28871907|ref|NP_794526.1| conserved hypothetical protein [Pse... 57 7e-07
gi|50404847|ref|YP_053939.1| DNA-binding protein, putative [Para... 57 7e-07
gi|42660863|ref|XP_064152.5| sarcalumenin [Homo sapiens] 57 7e-07
gi|9967361|dbj|BAA74452.2| alpha' subunit of beta-conglycinin [G... 57 7e-07
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 56 9e-07
gi|7508112|pir||T25061 hypothetical protein T21B6.3 - Caenorhabd... 56 9e-07
gi|25152272|ref|NP_509829.2| brain-specific angiogenesis inhibit... 56 9e-07
gi|459931|gb|AAA40971.1| contiguous repeat polypeptide [Rattus n... 56 9e-07
gi|1513204|gb|AAC48703.1| involucrin 56 9e-07
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628... 56 9e-07
gi|4589850|dbj|BAA76901.1| choriogenin Hminor [Oryzias latipes] 56 9e-07
gi|26000366|gb|AAN75481.1| dentin matrix protein 1 [Desmodus rot... 56 9e-07
gi|18766204|gb|AAL78899.1| merozoite surface protein-9 precursor... 56 1e-06
gi|15425631|dbj|BAB64303.1| beta-conglycinin alpha prime subunit... 56 1e-06
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 56 1e-06
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 56 1e-06
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 56 1e-06
gi|6322796|ref|NP_012869.1| RNAPII degradation factor, forms a c... 56 1e-06
gi|50421413|ref|XP_459257.1| unnamed protein product [Debaryomyc... 56 1e-06
gi|29290086|gb|AAO67558.1| Gag protein [Drosophila virilis] >gnl... 55 1e-06
gi|1170022|sp|P08568|GRPA_RAT Submandibular gland secretory Glx-... 55 1e-06
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc... 55 1e-06
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat... 55 1e-06
gi|31126963|ref|NP_852105.1| glutamine/glutamic acid-rich protei... 55 1e-06
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 55 1e-06
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot... 55 1e-06
gi|32404122|ref|XP_322674.1| hypothetical protein [Neurospora cr... 55 1e-06
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 55 1e-06
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis] 55 1e-06
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc... 55 1e-06
gi|38603523|dbj|BAD02898.1| bacteriolytic enzyme [Bacillus clausii] 55 1e-06
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster... 55 2e-06
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster... 55 2e-06
gi|15292565|gb|AAK93551.1| SD07741p [Drosophila melanogaster] 55 2e-06
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me... 55 2e-06
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis] 55 2e-06
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D... 55 2e-06
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster... 55 2e-06
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 55 2e-06
gi|1223914|gb|AAB47214.1| endo16 [Strongylocentrotus purpuratus] 55 2e-06
gi|32413407|ref|XP_327183.1| predicted protein [Neurospora crass... 55 2e-06
gi|92319|pir||A29573 Glx-rich protein - rat (fragment) >gnl|BL_O... 55 2e-06
gi|15600941|ref|NP_232571.1| conserved hypothetical protein [Vib... 55 2e-06
gi|28828976|gb|AAO51556.1| similar to Plasmodium falciparum. Pro... 55 2e-06
gi|47225554|emb|CAG12037.1| unnamed protein product [Tetraodon n... 55 3e-06
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P... 55 3e-06
gi|30689268|ref|NP_173925.3| phytochrome and flowering time regu... 54 3e-06
gi|25518714|pir||G86385 hypothetical protein F2J7.4 [imported] -... 54 3e-06
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 54 3e-06
gi|47228710|emb|CAG07442.1| unnamed protein product [Tetraodon n... 54 3e-06
gi|50551733|ref|XP_503341.1| hypothetical protein [Yarrowia lipo... 54 3e-06
gi|50260382|gb|EAL23041.1| hypothetical protein CNBA8080 [Crypto... 54 3e-06
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,... 54 4e-06
gi|1513206|gb|AAC48704.1| involucrin 54 4e-06
gi|50758913|ref|XP_417476.1| PREDICTED: similar to Hypothetical ... 54 4e-06
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno... 54 4e-06
gi|45200797|ref|NP_986367.1| AGL300Cp [Eremothecium gossypii] >g... 54 4e-06
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot... 54 4e-06
gi|786136|gb|AAA99499.1| polymorphic immunodominant molecule 54 4e-06
gi|3024638|sp|Q62565|SRY_MUSSI Sex-determining region Y protein ... 54 4e-06
gi|21357267|ref|NP_649312.1| CG6014-PA [Drosophila melanogaster]... 54 4e-06
gi|46437481|gb|EAK96827.1| hypothetical protein CaO19.10377 [Can... 54 4e-06
gi|19921992|ref|NP_610608.1| CG12340-PA [Drosophila melanogaster... 54 4e-06
gi|32033879|ref|ZP_00134150.1| COG0810: Periplasmic protein TonB... 54 4e-06
gi|32410635|ref|XP_325798.1| hypothetical protein [Neurospora cr... 54 6e-06
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 54 6e-06
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 54 6e-06
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g... 54 6e-06
gi|23510054|ref|NP_702720.1| hypothetical protein [Plasmodium fa... 54 6e-06
gi|28850410|gb|AAL92314.2| hypothetical protein [Dictyostelium d... 54 6e-06
gi|50405879|ref|XP_456580.1| unnamed protein product [Debaryomyc... 54 6e-06
gi|34854792|ref|XP_218287.2| similar to putative odorant recepto... 54 6e-06
gi|26000360|gb|AAN75476.1| dentin matrix protein 1 [Natalus micr... 54 6e-06
gi|38107659|gb|EAA53803.1| hypothetical protein MG09553.4 [Magna... 54 6e-06
gi|24655488|ref|NP_647642.2| CG7971-PA [Drosophila melanogaster]... 53 7e-06
gi|2623347|gb|AAC53431.1| sex determining protein [Mus musculus ... 53 7e-06
gi|48862277|ref|ZP_00316174.1| COG3979: Uncharacterized protein ... 53 7e-06
gi|26000368|gb|AAN75480.1| dentin matrix protein 1 [Centurio senex] 53 7e-06
gi|50806838|ref|XP_428858.1| PREDICTED: similar to tumor-related... 53 7e-06
gi|24655493|ref|NP_728653.1| CG7971-PB [Drosophila melanogaster]... 53 7e-06
gi|16198129|gb|AAL13867.1| LD33732p [Drosophila melanogaster] 53 7e-06
gi|7512088|pir||T30282 calcium-binding protein - sea urchin (Str... 53 7e-06
gi|24655483|ref|NP_728652.1| CG7971-PC [Drosophila melanogaster]... 53 7e-06
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo... 53 7e-06
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand... 53 1e-05
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis] 53 1e-05
gi|24639970|ref|NP_572262.1| CG3108-PA [Drosophila melanogaster]... 53 1e-05
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 53 1e-05
gi|39579838|emb|CAE56847.1| Hypothetical protein CBG24674 [Caeno... 53 1e-05
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno... 52 1e-05
gi|31198993|ref|XP_308444.1| ENSANGP00000017898 [Anopheles gambi... 52 1e-05
gi|5803098|ref|NP_006757.1| MYST histone acetyltransferase (mono... 52 1e-05
gi|26000382|gb|AAN75473.1| dentin matrix protein 1 [Mormoops meg... 52 1e-05
gi|39597865|emb|CAE68557.1| Hypothetical protein CBG14390 [Caeno... 52 1e-05
gi|15425633|dbj|BAB64304.1| beta-conglycinin alpha-subunit [Glyc... 52 1e-05
gi|50309619|ref|XP_454821.1| unnamed protein product [Kluyveromy... 52 1e-05
gi|6492409|gb|AAD09744.2| multiple banded antigen [Ureaplasma pa... 52 1e-05
gi|32413483|ref|XP_327221.1| predicted protein [Neurospora crass... 52 1e-05
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 52 2e-05
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno... 52 2e-05
gi|9910376|ref|NP_064623.1| inner centromere protein antigens 13... 52 2e-05
gi|26000356|gb|AAN75470.1| dentin matrix protein 1 [Pteropus hyp... 52 2e-05
gi|41191873|ref|XP_372978.1| similar to ENSANGP00000007346 [Homo... 52 2e-05
gi|50302725|ref|XP_451299.1| unnamed protein product [Kluyveromy... 52 2e-05
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ... 52 2e-05
gi|32422933|ref|XP_331910.1| predicted protein [Neurospora crass... 52 2e-05
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis] 52 2e-05
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand... 52 2e-05
gi|12083381|gb|AAG46367.1| antigen 38 [Trypanosoma cruzi] 52 2e-05
gi|45201188|ref|NP_986758.1| AGR093Wp [Eremothecium gossypii] >g... 52 2e-05
gi|34865500|ref|XP_345960.1| similar to hypothetical protein [Ra... 52 2e-05
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 52 2e-05
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 52 2e-05
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ... 52 2e-05
gi|33438255|dbj|BAC65520.2| mKIAA0287 protein [Mus musculus] 52 2e-05
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 52 2e-05
gi|7484702|pir||T10738 hypothetical protein FbLate-2 - sea-islan... 52 2e-05
gi|46442788|gb|EAL02075.1| hypothetical protein CaO19.13926 [Can... 52 2e-05
gi|1079271|pir||A48048 egg envelope protein wf - winter flounder... 52 2e-05
gi|50554357|ref|XP_504587.1| hypothetical protein [Yarrowia lipo... 52 2e-05
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 52 2e-05
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 52 2e-05
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 52 2e-05
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 52 2e-05
gi|50306605|ref|XP_453276.1| unnamed protein product [Kluyveromy... 52 2e-05
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 52 2e-05
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 52 2e-05
gi|46195852|ref|NP_996876.1| dentin matrix protein 1 [Gallus gal... 52 2e-05
gi|7595898|gb|AAF64489.1| prespore protein MF12 [Dictyostelium d... 52 2e-05
gi|24654027|ref|NP_725526.1| CG8421-PD [Drosophila melanogaster]... 52 2e-05
gi|24654914|ref|NP_728554.1| CG32479-PA [Drosophila melanogaster... 52 2e-05
gi|18958239|dbj|BAB85589.1| zinc finger protein [Mus musculus] 52 2e-05
gi|11467826|ref|NP_050877.1| hypothetical chloroplast RF2 [Nephr... 52 2e-05
gi|15235717|ref|NP_195495.1| expressed protein [Arabidopsis thal... 51 3e-05
gi|24415404|ref|NP_055426.1| MDN1, midasin homolog [Homo sapiens... 51 3e-05
gi|26000384|gb|AAN75474.1| dentin matrix protein 1 [Pteronotus p... 51 3e-05
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 51 3e-05
gi|46437429|gb|EAK96776.1| hypothetical protein CaO19.2859 [Cand... 51 3e-05
gi|17541282|ref|NP_501391.1| squamous cell carcinoma antigen rec... 51 3e-05
gi|24648119|ref|NP_650778.1| CG6026-PA [Drosophila melanogaster]... 51 3e-05
gi|49070826|ref|XP_399702.1| hypothetical protein UM02087.1 [Ust... 51 3e-05
gi|50287799|ref|XP_446329.1| unnamed protein product [Candida gl... 51 3e-05
gi|23508231|ref|NP_700900.1| hypothetical protein [Plasmodium fa... 51 3e-05
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 51 3e-05
gi|34327950|dbj|BAA20761.2| KIAA0301 [Homo sapiens] 51 3e-05
gi|50311997|ref|XP_456030.1| unnamed protein product [Kluyveromy... 51 3e-05
gi|49073324|ref|XP_400889.1| hypothetical protein UM03274.1 [Ust... 51 3e-05
gi|6680506|ref|NP_032438.1| involucrin [Mus musculus] >gnl|BL_OR... 51 3e-05
gi|27806661|ref|NP_776463.1| dentin matrix acidic phosphoprotein... 51 4e-05
gi|32416166|ref|XP_328561.1| hypothetical protein [Neurospora cr... 51 4e-05
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass... 51 4e-05
gi|17566482|ref|NP_507901.1| plasmodium falciparum trophozoite a... 51 4e-05
gi|24664026|ref|NP_729947.1| CG32133-PA [Drosophila melanogaster... 51 4e-05
gi|8096269|dbj|BAA95789.1| KED [Nicotiana tabacum] 51 4e-05
gi|32567349|ref|NP_872207.1| COLlagen structural gene (col-42) [... 51 4e-05
gi|126420|sp|P15714|LP61_EIMTE Antigen LPMC-61 >gnl|BL_ORD_ID|16... 51 4e-05
gi|41054992|ref|NP_955762.1| hypothetical protein D430021I08 [Mu... 51 4e-05
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n... 51 4e-05
gi|46442947|gb|EAL02232.1| hypothetical protein CaO19.8420 [Cand... 51 4e-05
gi|29828894|ref|NP_823528.1| hypothetical protein SAV2352 [Strep... 51 4e-05
gi|158896|gb|AAA29079.1| antigen LPCM61 51 4e-05
gi|49069208|ref|XP_398893.1| hypothetical protein UM01278.1 [Ust... 51 4e-05
gi|32422107|ref|XP_331497.1| predicted protein [Neurospora crass... 51 4e-05
gi|18858189|ref|NP_572495.1| CG12109-PB [Drosophila melanogaster... 51 4e-05
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ... 51 4e-05
gi|29346315|ref|NP_809818.1| BatC, conserved hypothetical protei... 51 4e-05
gi|15425663|dbj|BAB64310.1| mblk-1 [Apis mellifera] 51 4e-05
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 51 4e-05
gi|41054766|ref|NP_956894.1| hypothetical protein MGC63522 [Dani... 51 4e-05
gi|32407190|ref|XP_324184.1| hypothetical protein [Neurospora cr... 50 5e-05
gi|23480318|gb|EAA16908.1| Drosophila melanogaster CG8797 gene p... 50 5e-05
gi|39594923|emb|CAE70791.1| Hypothetical protein CBG17547 [Caeno... 50 5e-05
gi|46561854|gb|AAT01144.1| soft fertilization envelope protein 9... 50 5e-05
gi|47213005|emb|CAF95397.1| unnamed protein product [Tetraodon n... 50 5e-05
gi|46444158|gb|EAL03435.1| hypothetical protein CaO19.4998 [Cand... 50 5e-05
gi|24659567|ref|NP_648056.1| CG10107-PA [Drosophila melanogaster... 50 5e-05
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 50 5e-05
gi|4336734|gb|AAD17923.1| Pax transcription activation domain in... 50 5e-05
gi|42734451|ref|NP_061366.2| Pax transcription activation domain... 50 5e-05
gi|26000364|gb|AAN75477.1| dentin matrix protein 1 [Natalus stra... 50 5e-05
gi|34558672|gb|AAQ75078.1| RAD2 [Cryptosporidium parvum] 50 5e-05
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati... 50 5e-05
gi|46226699|gb|EAK87678.1| XPG, DNA excision repair protein, fla... 50 5e-05
gi|42627815|tpe|CAE00399.1| TPA: putative ISG12(b2) protein [Mus... 50 5e-05
gi|462434|sp|P34099|KAPC_DICDI cAMP-dependent protein kinase cat... 50 5e-05
gi|241277|gb|AAB20716.1| serine/threonine protein kinase [Dictyo... 50 5e-05
gi|25480805|pir||T52485 neurofilament protein NF-M(2), middle mo... 50 5e-05
gi|50415606|gb|AAH78128.1| LOC397995 protein [Xenopus laevis] 50 5e-05
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 50 5e-05
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha... 50 6e-05
gi|17552718|ref|NP_498862.1| C.Elegans Chromodomain protein (33.... 50 6e-05
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 50 6e-05
gi|50545898|ref|XP_500487.1| hypothetical protein [Yarrowia lipo... 50 6e-05
gi|16182353|gb|AAL13482.1| GH01409p [Drosophila melanogaster] 50 6e-05
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 50 6e-05
gi|755081|gb|AAB00073.1| schizont/sporozoite surface protein >gn... 50 6e-05
gi|24647164|ref|NP_650466.2| CG5166-PA [Drosophila melanogaster]... 50 6e-05
gi|11071800|emb|CAC14644.1| lectin-related protein [Leishmania m... 50 6e-05
gi|2623363|gb|AAC53439.1| sex determining protein [Mus musculus ... 50 6e-05
gi|50260271|gb|EAL22930.1| hypothetical protein CNBA6990 [Crypto... 50 6e-05
gi|26000388|gb|AAN75484.1| dentin matrix protein 1 [Plecotus tow... 50 6e-05
gi|42782061|ref|NP_979308.1| conserved domain protein [Bacillus ... 50 6e-05
gi|17864460|ref|NP_524825.1| CG9930-PA [Drosophila melanogaster]... 50 6e-05
gi|24647162|ref|NP_732033.1| CG5166-PB [Drosophila melanogaster]... 50 6e-05
gi|37626197|gb|AAQ96572.1| hypothetical protein [Vibrio parahaem... 50 6e-05
gi|28571738|ref|NP_732034.2| CG5166-PC [Drosophila melanogaster]... 50 6e-05
gi|14164561|gb|AAK55123.1| Swift [Xenopus laevis] 50 6e-05
gi|47228176|emb|CAG07571.1| unnamed protein product [Tetraodon n... 50 6e-05
gi|25009850|gb|AAN71095.1| AT22221p [Drosophila melanogaster] 50 6e-05
gi|37626131|gb|AAQ96507.1| hypothetical protein [Vibrio parahaem... 50 6e-05
gi|34394194|dbj|BAC84646.1| hypothetical protein [Oryza sativa (... 50 6e-05
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 50 8e-05
gi|28829619|gb|AAO52136.1| similar to Dictyostelium. Serine/thre... 50 8e-05
gi|975213|emb|CAA60252.1| unknown [Plasmodium berghei] 50 8e-05
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 50 8e-05
gi|27526238|emb|CAC82378.1| Lasp protein [Drosophila melanogaster] 50 8e-05
gi|32419593|ref|XP_330240.1| predicted protein [Neurospora crass... 50 8e-05
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 50 8e-05
gi|46109630|ref|XP_381873.1| hypothetical protein FG01697.1 [Gib... 50 8e-05
gi|48862101|ref|ZP_00315999.1| COG2304: Uncharacterized protein ... 50 8e-05
gi|32409515|ref|XP_325238.1| hypothetical protein ( (AL451019) c... 50 8e-05
gi|39581822|emb|CAE60715.1| Hypothetical protein CBG04386 [Caeno... 50 8e-05
gi|48763005|ref|ZP_00267562.1| hypothetical protein Rrub02003719... 50 8e-05
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot... 50 8e-05
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno... 50 8e-05
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno... 50 8e-05
gi|2623357|gb|AAC53436.1| sex determining protein [Mus musculus ... 50 8e-05
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 50 8e-05
gi|32404250|ref|XP_322738.1| predicted protein [Neurospora crass... 50 8e-05
gi|47214987|emb|CAG01321.1| unnamed protein product [Tetraodon n... 50 8e-05
gi|21703896|ref|NP_663424.1| ISG12 [Mus musculus] >gnl|BL_ORD_ID... 50 8e-05
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r... 50 8e-05
gi|26326415|dbj|BAC26951.1| unnamed protein product [Mus musculus] 49 1e-04
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 49 1e-04
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 49 1e-04
gi|37360550|dbj|BAC98253.1| mKIAA1798 protein [Mus musculus] 49 1e-04
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 49 1e-04
gi|32419885|ref|XP_330386.1| predicted protein [Neurospora crass... 49 1e-04
gi|50420597|ref|XP_458835.1| unnamed protein product [Debaryomyc... 49 1e-04
gi|29290093|gb|AAO67564.1| Pol protein [Drosophila virilis] 49 1e-04
gi|42524454|ref|NP_969834.1| hypothetical protein predicted by G... 49 1e-04
gi|50547139|ref|XP_501039.1| hypothetical protein [Yarrowia lipo... 49 1e-04
gi|2565048|gb|AAB91435.1| CAGF9 [Homo sapiens] 49 1e-04
gi|50294998|ref|XP_449910.1| unnamed protein product [Candida gl... 49 1e-04
gi|460123|gb|AAB60446.1| Sry >gnl|BL_ORD_ID|1784943 gi|2623359|g... 49 1e-04
gi|27370170|ref|NP_766375.1| l(3)mbt-like 3 [Mus musculus] >gnl|... 49 1e-04
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 49 1e-04
gi|29747039|ref|XP_049037.7| trinucleotide repeat containing 9 [... 49 1e-04
gi|32407697|ref|XP_324355.1| hypothetical protein [Neurospora cr... 49 1e-04
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 49 1e-04
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 49 1e-04
gi|17738251|ref|NP_524534.1| CG12878-PA [Drosophila melanogaster... 49 1e-04
gi|45551990|ref|NP_733229.2| CG12878-PB [Drosophila melanogaster... 49 1e-04
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 49 1e-04
gi|2271479|gb|AAC53450.1| sex determining protein [Mus musculus ... 49 1e-04
gi|48098463|ref|XP_392066.1| similar to mblk-1 [Apis mellifera] 49 1e-04
gi|46438009|gb|EAK97347.1| hypothetical protein CaO19.5274 [Cand... 49 1e-04
gi|15232767|ref|NP_190311.1| hypothetical protein [Arabidopsis t... 49 1e-04
gi|15292093|gb|AAK93315.1| LD37788p [Drosophila melanogaster] 49 1e-04
gi|39584611|emb|CAE72364.1| Hypothetical protein CBG19514 [Caeno... 49 1e-04
gi|42656368|ref|XP_039762.5| myelin transcription factor 1-like ... 49 1e-04
gi|23613415|ref|NP_703259.1| asparagine-rich antigen Pfa35-2 [Pl... 49 1e-04
gi|14149807|ref|NP_115517.1| hypothetical protein DKFZp434K1421 ... 49 1e-04
gi|49065536|emb|CAG38586.1| DKFZP434K1421 [Homo sapiens] 49 1e-04
gi|6491868|gb|AAF14051.1| myelin transcription factor 1-like [Ho... 49 1e-04
gi|27692337|ref|XP_227371.1| similar to repetin [Rattus norvegicus] 49 1e-04
gi|39580381|emb|CAE71741.1| Hypothetical protein CBG18725 [Caeno... 49 1e-04
gi|6677817|ref|NP_033126.1| repetin [Mus musculus] >gnl|BL_ORD_I... 49 1e-04
gi|34854626|ref|XP_218226.2| similar to mKIAA0287 protein [Rattu... 49 1e-04
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate... 49 1e-04
gi|32421133|ref|XP_331010.1| hypothetical protein [Neurospora cr... 49 1e-04
gi|31208933|ref|XP_313433.1| ENSANGP00000019634 [Anopheles gambi... 49 1e-04
gi|33303426|gb|AAQ02289.1| dentin matrix protein 1 [Xenomys nels... 49 1e-04
gi|23509396|ref|NP_702063.1| hypothetical protein [Plasmodium fa... 49 1e-04
gi|28379477|ref|NP_786369.1| cell surface protein precursor [Lac... 49 2e-04
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 49 2e-04
gi|11345238|gb|AAG34657.1| involucrin [Mus musculus] 49 2e-04
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can... 49 2e-04
gi|46227016|gb|EAK87966.1| hypothetical protein cgd5_2420 [Crypt... 49 2e-04
gi|31198199|ref|XP_308047.1| ENSANGP00000023387 [Anopheles gambi... 49 2e-04
gi|1729824|sp|P54683|TAGB_DICDI Prestalk-specific protein tagB p... 49 2e-04
gi|25410974|pir||B84434 hypothetical protein At2g02200 [imported... 49 2e-04
gi|18447198|gb|AAL68190.1| GH09355p [Drosophila melanogaster] 49 2e-04
gi|34853688|ref|XP_231271.2| similar to Pax transcription activa... 49 2e-04
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil... 49 2e-04
gi|32403550|ref|XP_322388.1| hypothetical protein [Neurospora cr... 49 2e-04
gi|23379705|gb|AAM76595.1| dental matrix acidic phophoprotein 1 ... 49 2e-04
gi|42733645|gb|AAS38609.1| hypothetical protein [Dictyostelium d... 49 2e-04
gi|2306985|gb|AAB65794.1| calcium binding EF-hand protein [Droso... 49 2e-04
gi|47220829|emb|CAG00036.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 49 2e-04
gi|9454383|gb|AAF87780.1| p110 membrane protein precursor [Mycop... 49 2e-04
gi|34871766|ref|XP_216340.2| similar to Osa1 nuclear protein [Ra... 49 2e-04
gi|32418656|ref|XP_329806.1| hypothetical protein [Neurospora cr... 49 2e-04
gi|24662885|ref|NP_648504.1| CG6004-PB [Drosophila melanogaster]... 49 2e-04
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus] 49 2e-04
gi|50419727|ref|XP_458392.1| unnamed protein product [Debaryomyc... 49 2e-04
gi|24650937|ref|NP_651666.1| CG11873-PA [Drosophila melanogaster... 49 2e-04
gi|2852361|gb|AAC02081.1| calcium binding EF-hand protein precur... 49 2e-04
gi|47221067|emb|CAG12761.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 48 2e-04
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 48 2e-04
gi|29827234|ref|NP_821868.1| hypothetical protein SAV693 [Strept... 48 2e-04
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 48 2e-04
gi|30173132|sp|Q9WU62|INCE_MOUSE Inner centromere protein >gnl|B... 48 2e-04
gi|2654425|gb|AAB87728.1| dentin matrix protein 1 48 2e-04
gi|4758172|ref|NP_004398.1| dentin matrix acidic phosphoprotein ... 48 2e-04
gi|38102578|gb|EAA49399.1| hypothetical protein MG01057.4 [Magna... 48 2e-04
gi|30851505|gb|AAH52414.1| Inner centromere protein [Mus musculus] 48 2e-04
gi|26349413|dbj|BAC38346.1| unnamed protein product [Mus musculu... 48 2e-04
gi|7710040|ref|NP_057901.1| inner centromere protein [Mus muscul... 48 2e-04
gi|25411550|pir||F84514 hypothetical protein At2g14140 [imported... 48 2e-04
>gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17)
[Caenorhabditis elegans]
gi|22532953|gb|AAB37841.3| Collagen protein 17 [Caenorhabditis
elegans]
Length = 277
Score = 366 bits (939), Expect = e-100
Identities = 189/233 (81%), Positives = 194/233 (83%)
Frame = -2
Query: 701 MRSISAVLVPTLFVENTPSSINSVKLRAVRSVKPTNAALAELDQLDPLETQDKXXXXXXX 522
MRSISAVLVPTLFVENTPSSINSVKLRAVRSVKPTNAAL E DQLDPLETQDK
Sbjct: 1 MRSISAVLVPTLFVENTPSSINSVKLRAVRSVKPTNAALVESDQLDPLETQDKTEPQEMT 60
Query: 521 XXXXXXXXXXXMLQMSTFNQLQPISASSAHQDQPETPETQDQRDHQDSQEHQESKDQMDA 342
MLQM FNQ PISASSAHQDQPETPETQDQRDHQDSQEHQESKDQMDA
Sbjct: 61 EDQEPQELQDQMLQMIMFNQPPPISASSAHQDQPETPETQDQRDHQDSQEHQESKDQMDA 120
Query: 341 QEPQEPQDHKDHQEPQEMTELQDNQEPPDKSAPSQPHQVTQDSQESQEPKDHQERMDAQE 162
QEPQEPQDHKDHQEPQ+ TELQDNQEP DKSAPSQPHQ TQDSQESQEPKDHQ++ D QE
Sbjct: 121 QEPQEPQDHKDHQEPQDKTELQDNQEPQDKSAPSQPHQGTQDSQESQEPKDHQDQTDTQE 180
Query: 161 TQDHKDHQDHKESQDKMELQETQEHQERLESQERTEPREDAITAQSQELLQDI 3
DHKDHQDHKE DK ELQETQE QER ESQERT+PR+ AITA QELLQDI
Sbjct: 181 ALDHKDHQDHKEMLDKTELQETQEPQERPESQERTDPRDLAITAHHQELLQDI 233