Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F15D4_1
(1219 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17533247|ref|NP_496802.1| TBP-associated factor BTAF homolog ... 760 0.0
gi|39597216|emb|CAE59443.1| Hypothetical protein CBG02816 [Caeno... 677 0.0
gi|50289211|ref|XP_447036.1| unnamed protein product [Candida gl... 317 4e-85
gi|50310019|ref|XP_455023.1| unnamed protein product [Kluyveromy... 315 1e-84
gi|48138739|ref|XP_393420.1| similar to ENSANGP00000008413 [Apis... 314 2e-84
gi|34865564|ref|XP_347207.1| similar to TBP-associated factor 17... 311 2e-83
gi|50749615|ref|XP_421689.1| PREDICTED: similar to TBP-associate... 311 2e-83
gi|34862672|ref|XP_220044.2| similar to TBP-associated factor 17... 311 2e-83
gi|45190351|ref|NP_984605.1| AEL256Cp [Eremothecium gossypii] >g... 311 2e-83
gi|50557340|ref|XP_506078.1| hypothetical protein [Yarrowia lipo... 310 3e-83
gi|26353950|dbj|BAC40605.1| unnamed protein product [Mus musculus] 310 3e-83
gi|50424285|ref|XP_460729.1| unnamed protein product [Debaryomyc... 310 3e-83
gi|20988306|gb|AAH29930.1| Similar to BTAF1 RNA polymerase II, B... 310 4e-83
gi|27477070|ref|NP_003963.1| BTAF1 RNA polymerase II, B-TFIID tr... 310 4e-83
gi|38085063|ref|XP_129248.4| RIKEN cDNA E430027O22 [Mus musculus] 310 6e-83
gi|47210118|emb|CAF91684.1| unnamed protein product [Tetraodon n... 309 8e-83
gi|46434315|gb|EAK93728.1| hypothetical protein CaO19.11978 [Can... 306 5e-82
gi|6325175|ref|NP_015243.1| Essential abundant protein involved ... 306 8e-82
gi|37699520|gb|AAB95091.3| 89B helicase [Drosophila melanogaster] 299 8e-80
gi|25013136|gb|AAN71681.1| SD16865p [Drosophila melanogaster] 299 8e-80
gi|24647318|ref|NP_732097.1| CG4261-PA [Drosophila melanogaster]... 299 8e-80
gi|28317220|gb|AAO39617.1| GH12153p [Drosophila melanogaster] 299 8e-80
gi|31241609|ref|XP_321235.1| ENSANGP00000008413 [Anopheles gambi... 296 5e-79
gi|32414725|ref|XP_327842.1| hypothetical protein [Neurospora cr... 292 1e-77
gi|38105927|gb|EAA52297.1| hypothetical protein MG04989.4 [Magna... 291 2e-77
gi|49093726|ref|XP_408324.1| hypothetical protein AN4187.2 [Aspe... 289 8e-77
gi|11359241|pir||T40642 probable helicase - fission yeast (Schiz... 288 2e-76
gi|19112872|ref|NP_596080.1| putative helicase [Schizosaccharomy... 288 2e-76
gi|50257851|gb|EAL20552.1| hypothetical protein CNBE4720 [Crypto... 286 5e-76
gi|49389246|dbj|BAD25208.1| putative SNF2 domain-containing prot... 286 9e-76
gi|49075576|ref|XP_401845.1| hypothetical protein UM04230.1 [Ust... 281 2e-74
gi|15232471|ref|NP_190996.1| SNF2 domain-containing protein / he... 273 5e-72
gi|19072776|gb|AAL84633.1| putative transcription regulator WdMO... 233 9e-60
gi|19173110|ref|NP_597661.1| similarity to HELICASE MOT1 [Enceph... 214 4e-54
gi|50548883|ref|XP_501912.1| hypothetical protein [Yarrowia lipo... 193 6e-48
gi|47156981|gb|AAT12357.1| helicase MOT1-like protein [Antonospo... 192 1e-47
gi|46435782|gb|EAK95157.1| hypothetical protein CaO19.607 [Candi... 192 1e-47
gi|46435735|gb|EAK95111.1| hypothetical protein CaO19.8240 [Cand... 192 1e-47
gi|50422435|ref|XP_459783.1| unnamed protein product [Debaryomyc... 190 7e-47
gi|50289791|ref|XP_447327.1| unnamed protein product [Candida gl... 187 6e-46
gi|46111317|ref|XP_382716.1| hypothetical protein FG02540.1 [Gib... 186 1e-45
gi|50309923|ref|XP_454975.1| unnamed protein product [Kluyveromy... 184 4e-45
gi|48858203|ref|ZP_00312165.1| COG0553: Superfamily II DNA/RNA h... 184 5e-45
gi|18310607|ref|NP_562541.1| SWI/SNF family helicase [Clostridiu... 182 1e-44
gi|49104376|ref|XP_411240.1| hypothetical protein AN7103.2 [Aspe... 182 1e-44
gi|34894036|ref|NP_908343.1| putative DNA repair and recombinati... 181 3e-44
gi|6322495|ref|NP_012569.1| Protein involved in transcription-co... 180 5e-44
gi|550429|emb|CAA57290.1| RAD26 [Saccharomyces cerevisiae] 180 5e-44
gi|32416130|ref|XP_328543.1| hypothetical protein [Neurospora cr... 180 7e-44
gi|50749484|ref|XP_421656.1| PREDICTED: similar to DNA excision ... 179 2e-43
gi|7497824|pir||T28937 hypothetical protein C52B9.8 - Caenorhabd... 178 2e-43
gi|17551114|ref|NP_508736.1| brahma (XE918) [Caenorhabditis eleg... 178 2e-43
gi|23111644|ref|ZP_00097250.1| COG0553: Superfamily II DNA/RNA h... 178 3e-43
gi|39593716|emb|CAE62008.1| Hypothetical protein CBG06016 [Caeno... 178 3e-43
gi|15618758|ref|NP_225044.1| SWI/SNF family helicase_2 [Chlamydo... 177 6e-43
gi|15836382|ref|NP_300906.1| SWI/SNF family helicase_2 [Chlamydo... 177 6e-43
gi|46580490|ref|YP_011298.1| Snf2 family protein [Desulfovibrio ... 177 6e-43
gi|45509693|ref|ZP_00162026.1| COG0553: Superfamily II DNA/RNA h... 176 8e-43
gi|15834706|ref|NP_296465.1| helicase, Snf2 family [Chlamydia mu... 176 1e-42
gi|47226612|emb|CAG07771.1| unnamed protein product [Tetraodon n... 175 2e-42
gi|48855575|ref|ZP_00309734.1| COG0553: Superfamily II DNA/RNA h... 175 2e-42
gi|47086607|ref|NP_997881.1| phasmid Socket Absent PSA-4, homolo... 175 2e-42
gi|23474884|ref|ZP_00130175.1| COG0553: Superfamily II DNA/RNA h... 174 4e-42
gi|39583648|emb|CAE63752.1| Hypothetical protein CBG08287 [Caeno... 174 5e-42
gi|19115773|ref|NP_594861.1| putative transcriptional regulator ... 174 5e-42
gi|19075591|ref|NP_588091.1| DNA repair and recombination protei... 174 5e-42
gi|46125857|ref|XP_387482.1| hypothetical protein FG07306.1 [Gib... 172 1e-41
gi|24664907|ref|NP_730088.1| CG5942-PD [Drosophila melanogaster]... 172 2e-41
gi|46397098|sp|O94421|YQGE_SCHPO Hypothetical helicase C1620.14c... 172 2e-41
gi|283699|pir||A42091 transcription activator SNF2/SWI2 homolog ... 172 2e-41
gi|17985967|ref|NP_536746.1| CG5942-PA [Drosophila melanogaster]... 172 2e-41
gi|17231890|ref|NP_488438.1| SNF2 helicase homolog [Nostoc sp. P... 172 2e-41
gi|32411725|ref|XP_326343.1| hypothetical protein [Neurospora cr... 172 2e-41
gi|15605441|ref|NP_220227.1| SWF/SNF family helicase [Chlamydia ... 171 2e-41
gi|50310529|ref|XP_455284.1| unnamed protein product [Kluyveromy... 171 2e-41
gi|45384078|ref|NP_990470.1| BRM protein [Gallus gallus] >gnl|BL... 171 2e-41
gi|4557565|ref|NP_000115.1| excision repair cross-complementing ... 171 2e-41
gi|48255898|ref|NP_620614.2| SWI/SNF-related matrix-associated a... 171 3e-41
gi|29840673|ref|NP_829779.1| helicase, Snf2 family [Chlamydophil... 171 3e-41
gi|34862108|ref|XP_342040.1| similar to SWI/SNF-related matrix-a... 171 3e-41
gi|49616741|gb|AAT67217.1| SWI/SNF-related matrix-associated act... 171 3e-41
gi|48255900|ref|NP_003061.3| SWI/SNF-related matrix-associated a... 171 3e-41
gi|45190542|ref|NP_984796.1| AEL065Cp [Eremothecium gossypii] >g... 171 3e-41
gi|49523317|gb|AAH75641.1| Smarca2 protein [Mus musculus] 171 3e-41
gi|19173162|ref|NP_596965.1| RAD26-LIKE DNA REPAIR AND RECOMBINA... 171 3e-41
gi|1711406|sp|P51531|SN22_HUMAN Possible global transcription ac... 171 3e-41
gi|33440456|gb|AAH56199.1| Smarca2 protein [Mus musculus] 171 3e-41
gi|17539642|ref|NP_502082.1| phasmid Socket Absent PSA-4, homolo... 171 4e-41
gi|31205071|ref|XP_311484.1| ENSANGP00000013716 [Anopheles gambi... 171 4e-41
gi|22328039|ref|NP_201200.2| SNF2 domain-containing protein / he... 170 5e-41
gi|34877154|ref|XP_224627.2| similar to Excision repair protein ... 170 7e-41
gi|38110738|gb|EAA56417.1| hypothetical protein MG06388.4 [Magna... 169 1e-40
gi|50288627|ref|XP_446743.1| unnamed protein product [Candida gl... 169 1e-40
gi|28211487|ref|NP_782431.1| SWF/SNF family helicase [Clostridiu... 169 1e-40
gi|15224228|ref|NP_179466.1| SNF2 domain-containing protein / he... 169 2e-40
gi|2136177|pir||S45251 SNF2alpha protein - human >gnl|BL_ORD_ID|... 168 2e-40
gi|15674499|ref|NP_268673.1| putative SNF helicase [Streptococcu... 167 4e-40
gi|29828520|ref|NP_823154.1| putative SNF2/RAD54 family helicase... 167 5e-40
gi|19745454|ref|NP_606590.1| putative SNF helicase [Streptococcu... 167 5e-40
gi|172764|gb|AAA35120.1| STH1 protein 167 6e-40
gi|31745178|ref|NP_853634.1| SWI/SNF related, matrix associated,... 167 6e-40
gi|21909786|ref|NP_664054.1| putative SNF helicase [Streptococcu... 167 6e-40
gi|6322065|ref|NP_012140.1| helicase related protein, snf2 homol... 167 6e-40
gi|31322808|gb|AAP31846.1| Brg1p [Tetrahymena thermophila] 166 8e-40
gi|50399992|gb|AAT76380.1| putative DNA-dependent ATPase [Oryza ... 166 1e-39
gi|46447008|ref|YP_008373.1| conserved hypothetical protein [Par... 166 1e-39
gi|22537758|ref|NP_688609.1| Snf2 family protein [Streptococcus ... 166 1e-39
gi|39597865|emb|CAE68557.1| Hypothetical protein CBG14390 [Caeno... 166 1e-39
gi|20089087|ref|NP_615162.1| helicase (SNF2 family) [Methanosarc... 166 1e-39
gi|45190977|ref|NP_985231.1| AER375Cp [Eremothecium gossypii] >g... 165 2e-39
gi|18463957|gb|AAL73042.1| chromatin complex subunit A101 [Zea m... 165 2e-39
gi|22095171|emb|CAD43278.1| brahma-related protein 1 [Rattus nor... 164 3e-39
gi|1711407|sp|P51532|SN24_HUMAN Possible global transcription ac... 164 3e-39
gi|21071056|ref|NP_003063.2| SWI/SNF-related matrix-associated a... 164 3e-39
gi|32563629|ref|NP_491994.2| chromo domain and SNF2 related doma... 164 3e-39
gi|25011706|ref|NP_736101.1| Unknown [Streptococcus agalactiae N... 164 3e-39
gi|39930329|ref|NP_035547.1| SWI/SNF related, matrix associated,... 164 3e-39
gi|10946129|gb|AAG24790.1| SMARCA4 isoform 2 [Homo sapiens] 164 3e-39
gi|4056412|gb|AAC97986.1| BRG-1-HUMAN [AA 812-1440]; nuclear pr... 164 3e-39
gi|20072056|gb|AAH26672.1| Smarca4 protein [Mus musculus] 164 3e-39
gi|7504867|pir||T23056 hypothetical protein H06O01.2 - Caenorhab... 164 3e-39
gi|34860432|ref|XP_343359.1| SWI/SNF related, matrix associated,... 164 3e-39
gi|4056413|gb|AAC97987.1| SN24_HUMAN; nuclear protein GRB1; home... 164 3e-39
gi|2143481|pir||I53078 homeotic gene regulator - mouse (fragment... 164 3e-39
gi|45384232|ref|NP_990390.1| BRG1 protein [Gallus gallus] >gnl|B... 164 3e-39
gi|45199080|ref|NP_986109.1| AFR562Cp [Eremothecium gossypii] >g... 164 3e-39
gi|39583607|emb|CAE65711.1| Hypothetical protein CBG10790 [Caeno... 164 4e-39
gi|46129542|ref|ZP_00164017.2| COG0553: Superfamily II DNA/RNA h... 164 5e-39
gi|38104231|gb|EAA50830.1| hypothetical protein MG04589.4 [Magna... 164 5e-39
gi|48894083|ref|ZP_00327281.1| COG0553: Superfamily II DNA/RNA h... 163 7e-39
gi|46226948|gb|EAK87914.1| chromodomain-helicase-DNA-binding'mul... 163 9e-39
gi|15901369|ref|NP_345973.1| Snf2 family protein [Streptococcus ... 163 9e-39
gi|15903418|ref|NP_358968.1| SWF/SNF family ATP-dependent RNA he... 163 9e-39
gi|46125449|ref|XP_387278.1| hypothetical protein FG07102.1 [Gib... 163 9e-39
gi|46119555|ref|ZP_00176801.2| COG0553: Superfamily II DNA/RNA h... 162 1e-38
gi|48137452|ref|XP_393364.1| similar to SD21488p [Apis mellifera] 162 1e-38
gi|21227581|ref|NP_633503.1| SWF/SNF family helicase [Methanosar... 162 1e-38
gi|50551421|ref|XP_503184.1| hypothetical protein [Yarrowia lipo... 162 1e-38
gi|21224583|ref|NP_630362.1| putative helicase [Streptomyces coe... 162 1e-38
gi|738309|prf||1924378A nucler protein GRB1 162 1e-38
gi|481644|pir||S39059 protein BRG1 - human 162 1e-38
gi|32040815|ref|ZP_00138398.1| COG0553: Superfamily II DNA/RNA h... 161 3e-38
gi|47213811|emb|CAF92584.1| unnamed protein product [Tetraodon n... 161 3e-38
gi|15240074|ref|NP_201476.1| SNF2 domain-containing protein / he... 161 3e-38
gi|48851519|ref|ZP_00305733.1| COG0553: Superfamily II DNA/RNA h... 161 3e-38
gi|15595996|ref|NP_249490.1| probable helicase [Pseudomonas aeru... 161 3e-38
gi|37542688|gb|AAL47203.1| chromatin-remodeling factor CHD3 [Ory... 161 3e-38
gi|37542684|gb|AAL47211.1| chromatin-remodeling factor CHD3 [Ory... 161 3e-38
gi|24380105|ref|NP_722060.1| putative SNF helicase [Streptococcu... 161 3e-38
gi|32420105|ref|XP_330496.1| hypothetical protein [Neurospora cr... 160 4e-38
gi|34559250|gb|AAQ75381.1| global transcription activator Snf2p ... 160 6e-38
gi|11359727|pir||T18404 chromatin remodelling complex protein SN... 160 6e-38
gi|23508249|ref|NP_700918.1| PfSNF2L [Plasmodium falciparum 3D7]... 160 6e-38
gi|37521835|ref|NP_925212.1| probable helicase [Gloeobacter viol... 160 7e-38
gi|49089400|ref|XP_406415.1| hypothetical protein AN2278.2 [Aspe... 160 7e-38
gi|15241584|ref|NP_199293.1| chromodomain-helicase-DNA-binding f... 160 7e-38
gi|46441784|gb|EAL01078.1| hypothetical protein CaO19.239 [Candi... 159 1e-37
gi|16332119|ref|NP_442847.1| helicase of the snf2/rad54 family [... 159 1e-37
gi|49481223|ref|YP_039235.1| SNF2 family helicase [Bacillus thur... 159 1e-37
gi|42784409|ref|NP_981656.1| helicase, putative [Bacillus cereus... 159 1e-37
gi|228213|prf||1718318A GAM1 gene 159 1e-37
gi|1078857|pir||S44645 hypothetical protein F37A4.8 - Caenorhabd... 159 1e-37
gi|50590777|ref|ZP_00332127.1| COG0553: Superfamily II DNA/RNA h... 159 1e-37
gi|25144179|ref|NP_498468.2| yeast Imitation SWI homolog (116.7 ... 159 1e-37
gi|33086941|gb|AAP92713.1| Swi2/Snf2-related protein DDM1; decre... 159 2e-37
gi|30023277|ref|NP_834908.1| SWF/SNF family helicase [Bacillus c... 159 2e-37
gi|23100530|ref|NP_693997.1| helicase [Oceanobacillus iheyensis ... 158 2e-37
gi|17737463|ref|NP_523719.1| CG8625-PA [Drosophila melanogaster]... 158 2e-37
gi|20151803|gb|AAM11261.1| RH13158p [Drosophila melanogaster] 158 2e-37
gi|23489925|gb|EAA21818.1| SNF2 family N-terminal domain, putati... 158 3e-37
gi|34851567|ref|XP_226380.2| similar to ATP-dependent chromatin ... 158 3e-37
gi|40254124|ref|NP_444354.2| SWI/SNF related, matrix associated,... 158 3e-37
gi|46227736|gb|EAK88656.1| SWI/SNF related putative transcriptio... 158 3e-37
gi|2967452|dbj|BAA25173.1| hSNF2H [Homo sapiens] >gnl|BL_ORD_ID|... 158 3e-37
gi|21071058|ref|NP_003592.2| SWI/SNF-related matrix-associated a... 158 3e-37
gi|46437717|gb|EAK97058.1| hypothetical protein CaO19.7401 [Cand... 157 4e-37
gi|50303907|ref|XP_451901.1| unnamed protein product [Kluyveromy... 157 4e-37
gi|50425079|ref|XP_461131.1| unnamed protein product [Debaryomyc... 157 4e-37
gi|21397710|ref|NP_653695.1| SNF2_N, SNF2 and others N-terminal ... 157 4e-37
gi|47569742|ref|ZP_00240415.1| helicase, SNF2/RAD54 family [Baci... 157 4e-37
gi|50547703|ref|XP_501321.1| hypothetical protein [Yarrowia lipo... 157 4e-37
gi|18400745|ref|NP_565587.1| chromatin remodeling factor CHD3 (P... 157 5e-37
gi|25412286|pir||B84645 hypothetical protein At2g25170 [imported... 157 5e-37
gi|33146539|dbj|BAC79716.1| chromodomain helicase DNA binding pr... 157 5e-37
gi|34901830|ref|NP_912261.1| putative zinc-finger helicase [Oryz... 157 5e-37
gi|6324864|ref|NP_014933.1| involved in the coordinate regulatio... 157 6e-37
gi|30687235|ref|NP_197432.2| homeotic gene regulator, putative [... 156 1e-36
gi|45199055|ref|NP_986084.1| AFR537Wp [Eremothecium gossypii] >g... 156 1e-36
gi|49069018|ref|XP_398798.1| hypothetical protein UM01183.1 [Ust... 156 1e-36
gi|48730026|ref|ZP_00263775.1| COG0553: Superfamily II DNA/RNA h... 155 1e-36
gi|46228591|gb|EAK89461.1| SNF2L ortholog with a SWI/SNF2 like A... 155 1e-36
gi|50746279|ref|XP_420423.1| PREDICTED: similar to hSNF2H [Gallu... 155 1e-36
gi|5917754|gb|AAD56022.1| chromodomain helicase DNA binding prot... 155 1e-36
gi|50761329|ref|XP_429117.1| PREDICTED: similar to chromodomain ... 155 2e-36
gi|50254945|gb|EAL17685.1| hypothetical protein CNBL2000 [Crypto... 155 2e-36
gi|14028669|gb|AAK52454.1| DNA-dependent ATPase SNF2H [Mus muscu... 155 2e-36
gi|6680928|ref|NP_031716.1| chromodomain helicase DNA binding pr... 155 2e-36
gi|476961|pir||A47392 chromodomain-helicase-DNA-binding protein,... 155 2e-36
gi|5917753|gb|AAD56021.1| chromodomain helicase DNA binding prot... 155 2e-36
gi|5917756|gb|AAD56024.1| chromodomain helicase DNA binding prot... 155 2e-36
gi|26340418|dbj|BAC33872.1| unnamed protein product [Mus musculus] 155 2e-36
gi|45384402|ref|NP_990272.1| chromo-helicase-DNA-binding on the ... 155 2e-36
gi|4557447|ref|NP_001261.1| chromodomain helicase DNA binding pr... 155 2e-36
gi|49086734|ref|XP_405392.1| hypothetical protein AN1255.2 [Aspe... 155 2e-36
gi|20152037|gb|AAM11378.1| LD39323p [Drosophila melanogaster] 155 2e-36
gi|50420017|ref|XP_458541.1| unnamed protein product [Debaryomyc... 155 2e-36
gi|40215423|gb|AAR82736.1| SD21488p [Drosophila melanogaster] 155 2e-36
gi|38102523|gb|EAA49354.1| hypothetical protein MG01012.4 [Magna... 155 2e-36
gi|17137266|ref|NP_477197.1| CG3733-PA [Drosophila melanogaster]... 155 2e-36
gi|34881588|ref|XP_229124.2| similar to SWI/SNF-related matrix-a... 155 2e-36
gi|14028667|gb|AAK52453.1| DNA-dependent ATPase SNF2L [Mus muscu... 154 3e-36
gi|34783716|gb|AAH57115.1| Smarca1 protein [Mus musculus] 154 3e-36
gi|5917757|gb|AAD56025.1| chromodomain helicase DNA binding prot... 154 3e-36
gi|42567315|ref|NP_194918.2| chromatin remodeling factor, putati... 154 3e-36
gi|13603721|gb|AAK31908.1| putative chromatin remodeling protein... 154 4e-36
gi|30683830|ref|NP_850116.1| chromatin remodeling protein, putat... 154 4e-36
gi|45524679|ref|ZP_00175949.1| COG0553: Superfamily II DNA/RNA h... 154 4e-36
gi|29828134|ref|NP_822768.1| putative SNF2/RAD54 family helicase... 154 4e-36
gi|46435400|gb|EAK94782.1| hypothetical protein CaO19.4437 [Cand... 154 4e-36
gi|30578398|ref|NP_444353.2| SWI/SNF related, matrix associated,... 154 4e-36
gi|28975391|gb|AAO61781.1| chromo-helicase DNA-binding protein [... 154 4e-36
gi|30683833|ref|NP_850117.1| chromatin remodeling protein, putat... 154 4e-36
gi|7511822|pir||T13944 chromodomain-helicase-DNA-binding protein... 154 4e-36
gi|49257014|dbj|BAD24805.1| lymphoid specific helicase variant10... 154 5e-36
gi|50547625|ref|XP_501282.1| hypothetical protein [Yarrowia lipo... 154 5e-36
gi|33944265|ref|XP_340280.1| transcription activator, putative [... 154 5e-36
gi|21914927|ref|NP_060533.2| helicase, lymphoid-specific; prolif... 154 5e-36
gi|34763541|ref|ZP_00144479.1| SWF/SNF family helicase [Fusobact... 154 5e-36
gi|47217344|emb|CAG11049.1| unnamed protein product [Tetraodon n... 154 5e-36
gi|42407259|dbj|BAD10846.1| lymphoid specific helicase variant3 ... 154 5e-36
gi|28975395|gb|AAO61783.1| chromo-helicase DNA-binding protein [... 153 7e-36
gi|50749410|ref|XP_421626.1| PREDICTED: similar to helicase, lym... 153 7e-36
gi|50293735|ref|XP_449279.1| unnamed protein product [Candida gl... 153 7e-36
gi|50312307|ref|XP_456186.1| unnamed protein product [Kluyveromy... 153 7e-36
gi|46444408|gb|EAL03683.1| hypothetical protein CaO19.9102 [Cand... 153 7e-36
gi|46444555|gb|EAL03829.1| hypothetical protein CaO19.1526 [Cand... 153 7e-36
gi|50426167|ref|XP_461680.1| unnamed protein product [Debaryomyc... 153 9e-36
gi|15230608|ref|NP_187252.1| homeotic gene regulator, putative [... 153 9e-36
gi|31204937|ref|XP_311417.1| ENSANGP00000016886 [Anopheles gambi... 153 9e-36
gi|50306047|ref|XP_452985.1| unnamed protein product [Kluyveromy... 152 1e-35
gi|30019888|ref|NP_831519.1| SWF/SNF family helicase [Bacillus c... 152 1e-35
gi|49096640|ref|XP_409780.1| hypothetical protein AN5643.2 [Aspe... 152 1e-35
gi|34495520|ref|NP_899735.1| probable SWI/SNF family helicase [C... 152 1e-35
gi|29244924|ref|NP_115597.3| chromodomain helicase DNA binding p... 152 1e-35
gi|19421557|gb|AAK56405.1| chromodomain helicase DNA binding pro... 152 1e-35
gi|23396493|sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-bindi... 152 1e-35
gi|23101871|ref|ZP_00088417.1| COG0553: Superfamily II DNA/RNA h... 152 2e-35
gi|50549971|ref|XP_502458.1| hypothetical protein [Yarrowia lipo... 152 2e-35
gi|6321012|ref|NP_011091.1| Sole S. cerevisiae member of CHD gen... 152 2e-35
gi|34881247|ref|XP_228546.2| similar to SNF2/RAD54 family protei... 152 2e-35
gi|47228067|emb|CAF97696.1| unnamed protein product [Tetraodon n... 152 2e-35
gi|45201219|ref|NP_986789.1| AGR123Cp [Eremothecium gossypii] >g... 152 2e-35
gi|49071866|ref|XP_400222.1| hypothetical protein UM02607.1 [Ust... 152 2e-35
gi|46190976|ref|ZP_00120784.2| COG0553: Superfamily II DNA/RNA h... 152 2e-35
gi|23466281|ref|NP_696884.1| possible helicase [Bifidobacterium ... 152 2e-35
gi|48782007|ref|ZP_00278580.1| COG0553: Superfamily II DNA/RNA h... 152 2e-35
gi|48824514|ref|ZP_00285879.1| COG0553: Superfamily II DNA/RNA h... 152 2e-35
gi|50255395|gb|EAL18130.1| hypothetical protein CNBK1510 [Crypto... 152 2e-35
gi|24583161|ref|NP_609320.2| CG5899-PA [Drosophila melanogaster]... 152 2e-35
gi|31874139|emb|CAD97978.1| hypothetical protein [Homo sapiens] 152 2e-35
gi|41725682|ref|ZP_00152440.1| COG0553: Superfamily II DNA/RNA h... 152 2e-35
gi|42525525|ref|NP_970623.1| Snf2 family protein [Treponema dent... 152 2e-35
gi|50294289|ref|XP_449556.1| unnamed protein product [Candida gl... 152 2e-35
gi|32405162|ref|XP_323194.1| hypothetical protein [Neurospora cr... 151 3e-35
gi|19704721|ref|NP_604283.1| SWF/SNF family helicase [Fusobacter... 151 3e-35
gi|50285639|ref|XP_445248.1| unnamed protein product [Candida gl... 151 3e-35
gi|46443171|gb|EAL02455.1| hypothetical protein CaO19.10553 [Can... 151 3e-35
gi|46189143|ref|ZP_00124369.2| COG0553: Superfamily II DNA/RNA h... 151 3e-35
gi|39594011|emb|CAE70121.1| Hypothetical protein CBG16574 [Caeno... 151 3e-35
gi|46137507|ref|XP_390445.1| conserved hypothetical protein [Gib... 151 3e-35
gi|30261851|ref|NP_844228.1| helicase, putative [Bacillus anthra... 151 3e-35
gi|49481102|ref|YP_035985.1| helicase, SWF/SNF family [Bacillus ... 151 3e-35
gi|6319722|ref|NP_009804.1| has strong homology to Drosophila IS... 151 3e-35
gi|25027819|ref|NP_737873.1| putative chromodomain helicase [Cor... 151 3e-35
gi|47211690|emb|CAF91815.1| unnamed protein product [Tetraodon n... 151 3e-35
gi|626929|pir||S46122 SNF2 protein homolog YBR245c - yeast (Sacc... 151 3e-35
gi|20197603|gb|AAD29835.2| putative SNF2 subfamily transcription... 151 3e-35
gi|50553882|ref|XP_504352.1| hypothetical protein [Yarrowia lipo... 151 3e-35
gi|48108143|ref|XP_396195.1| similar to ENSANGP00000016886 [Apis... 151 3e-35
gi|47211143|emb|CAF96563.1| unnamed protein product [Tetraodon n... 151 3e-35
gi|5917755|gb|AAD56023.1| chromodomain helicase DNA binding prot... 150 4e-35
gi|34872518|ref|XP_243049.2| similar to chromodomain helicase DN... 150 4e-35
gi|26988870|ref|NP_744295.1| helicase, SNF2/RAD54 family [Pseudo... 150 4e-35
gi|31211661|ref|XP_314800.1| ENSANGP00000011045 [Anopheles gambi... 150 4e-35
gi|28869303|ref|NP_791922.1| helicase/SNF2 family domain protein... 150 4e-35
gi|2645435|gb|AAB87384.1| CHD3 [Drosophila melanogaster] 150 4e-35
gi|24666729|ref|NP_649111.1| CG9594-PA [Drosophila melanogaster]... 150 6e-35
gi|50745990|ref|XP_420328.1| PREDICTED: similar to SWI/SNF-relat... 150 6e-35
gi|34857217|ref|XP_218790.2| similar to Chromodomain-helicase-DN... 150 6e-35
gi|50256686|gb|EAL19409.1| hypothetical protein CNBH1020 [Crypto... 150 6e-35
gi|42780946|ref|NP_978193.1| helicase, putative [Bacillus cereus... 150 8e-35
gi|47217489|emb|CAG10869.1| unnamed protein product [Tetraodon n... 150 8e-35
gi|24308089|ref|NP_056372.1| chromodomain helicase DNA binding p... 150 8e-35
gi|7022541|dbj|BAA91637.1| unnamed protein product [Homo sapiens] 150 8e-35
gi|7512678|pir||T17269 hypothetical protein DKFZp434N231.1 - hum... 150 8e-35
gi|28175792|gb|AAH43501.1| Similar to RIKEN cDNA 4432404A22 gene... 150 8e-35
gi|6324879|ref|NP_014948.1| has strong homology to Drosophila IS... 150 8e-35
gi|12654665|gb|AAH01171.1| Unknown (protein for IMAGE:3355762) [... 150 8e-35
gi|19074741|ref|NP_586247.1| similarity to THE ATPase COMPONENT ... 150 8e-35
gi|42734377|ref|NP_004275.2| chromodomain helicase DNA binding p... 150 8e-35
gi|42520462|ref|NP_966377.1| helicase, SNF2 family [Wolbachia en... 149 1e-34
gi|49899007|gb|AAH76715.1| ISWI protein [Xenopus laevis] 149 1e-34
gi|32141133|ref|NP_733524.1| putative helicase [Streptomyces coe... 149 1e-34
gi|29826907|ref|NP_821541.1| putative SNF2/RAD54 family helicase... 149 1e-34
gi|25407972|pir||A84683 probable SNF2 subfamily transcription re... 149 1e-34
gi|45198479|ref|NP_985508.1| AFL040Wp [Eremothecium gossypii] >g... 149 1e-34
gi|50426953|ref|XP_462077.1| unnamed protein product [Debaryomyc... 149 1e-34
gi|11035016|gb|AAG01537.2| imitation switch ISWI [Xenopus laevis] 149 1e-34
gi|4557449|ref|NP_001262.1| chromodomain helicase DNA binding pr... 149 1e-34
gi|38344264|emb|CAE02069.2| OSJNBa0005N02.1 [Oryza sativa (japon... 149 2e-34
gi|14042443|dbj|BAB55248.1| unnamed protein product [Homo sapiens] 149 2e-34
gi|50290467|ref|XP_447665.1| unnamed protein product [Candida gl... 149 2e-34
gi|50875884|emb|CAG35724.1| probable helicase [Desulfotalea psyc... 149 2e-34
gi|26378644|dbj|BAB28757.2| unnamed protein product [Mus musculus] 149 2e-34
gi|12232371|ref|NP_032260.2| helicase, lymphoid specific; prolif... 149 2e-34
gi|2137490|pir||JC4666 lymphocyte specific helicase - mouse 149 2e-34
gi|33667842|gb|AAQ24521.1| Rad26 [Giardia intestinalis] 148 2e-34
gi|1769947|emb|CAA67095.1| SNF [Bacillus cereus] 148 2e-34
gi|47565536|ref|ZP_00236577.1| Snf2 family protein [Bacillus cer... 148 2e-34
gi|41053461|ref|NP_956607.1| similar to chromodomain helicase DN... 148 2e-34
gi|37521987|ref|NP_925364.1| probable helicase [Gloeobacter viol... 148 2e-34
gi|15674024|ref|NP_268199.1| SWI/SNF family helicase [Lactococcu... 148 2e-34
gi|11267547|pir||T43334 helicase-related protein hrp1 - fission ... 148 2e-34
gi|19114572|ref|NP_593660.1| putative helicase [Schizosaccharomy... 148 2e-34
gi|23485366|gb|EAA20388.1| Arabidopsis thaliana BRAHMA ortholog-... 148 3e-34
gi|19115879|ref|NP_594967.1| putative transcriptional regulator;... 148 3e-34
gi|50738005|ref|XP_419222.1| PREDICTED: similar to Probable chro... 148 3e-34
gi|22299156|ref|NP_682403.1| ORF_ID:tlr1613~putative helicase [T... 147 4e-34
gi|34866132|ref|XP_232671.2| similar to Probable chromodomain-he... 147 4e-34
gi|42658959|ref|XP_098762.6| KIAA1416 protein [Homo sapiens] 147 5e-34
gi|38079062|ref|XP_196334.3| similar to chromodomain helicase DN... 147 5e-34
gi|38637840|ref|NP_942814.1| putative helicase, superfamily II [... 147 5e-34
gi|23396522|sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-bindi... 147 5e-34
gi|4325130|gb|AAD17276.1| dMi-2 protein [Drosophila melanogaster] 147 5e-34
gi|24667055|ref|NP_649154.2| CG8103-PA [Drosophila melanogaster]... 147 5e-34
gi|38078060|ref|XP_149413.3| RIKEN cDNA A730019I05 gene [Mus mus... 147 5e-34
gi|27414501|ref|NP_666347.2| SNF2/RAD54 family protein [Mus musc... 147 6e-34
gi|26324980|dbj|BAC26244.1| unnamed protein product [Mus musculus] 147 6e-34
gi|24047226|gb|AAH38596.1| CHD4 protein [Homo sapiens] 147 6e-34
gi|34858460|ref|XP_232354.2| similar to chromodomain helicase DN... 147 6e-34
gi|39204553|ref|NP_666091.1| chromodomain helicase DNA binding p... 147 6e-34
gi|4557453|ref|NP_001264.1| chromodomain helicase DNA binding pr... 147 6e-34
gi|31544906|ref|NP_853484.1| HepA/SNF2 [Mycoplasma gallisepticum... 147 6e-34
gi|26330021|dbj|BAC28749.1| unnamed protein product [Mus musculus] 147 6e-34
gi|32398963|emb|CAD98428.1| SNF2 helicase, possible [Cryptospori... 146 8e-34
gi|15615476|ref|NP_243779.1| SNF2 helicase [Bacillus halodurans ... 146 8e-34
gi|29377168|ref|NP_816322.1| Snf2 family protein [Enterococcus f... 146 8e-34
gi|50551961|ref|XP_503455.1| hypothetical protein [Yarrowia lipo... 146 8e-34
gi|19704495|ref|NP_604057.1| SWF/SNF family helicase [Fusobacter... 146 1e-33
gi|28422180|gb|AAH46866.1| B230399n07-prov protein [Xenopus laevis] 146 1e-33
gi|21071046|ref|NP_620604.1| SWI/SNF-related matrix-associated a... 146 1e-33
gi|21071044|ref|NP_003060.2| SWI/SNF-related matrix-associated a... 146 1e-33
gi|479805|pir||S35458 SNF2 protein homolog - human (fragment) >g... 146 1e-33
gi|134584|sp|P28370|SN21_HUMAN Possible global transcription act... 146 1e-33
gi|41149958|ref|XP_370738.1| helicase with SNF2 domain 1 [Homo s... 145 1e-33
gi|47215569|emb|CAG10740.1| unnamed protein product [Tetraodon n... 145 1e-33
gi|49077756|ref|XP_402701.1| hypothetical protein UM05086.1 [Ust... 145 1e-33
gi|34328020|dbj|BAB13390.3| KIAA1564 protein [Homo sapiens] 145 1e-33
gi|17233188|ref|NP_490278.1| putative helicase [Nostoc sp. PCC 7... 145 1e-33
gi|23396512|sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-bindi... 145 1e-33
gi|45200885|ref|NP_986455.1| AGL212Wp [Eremothecium gossypii] >g... 145 2e-33
gi|50310725|ref|XP_455384.1| unnamed protein product [Kluyveromy... 145 2e-33
gi|17986031|ref|NP_523441.1| CG3696-PA [Drosophila melanogaster]... 145 2e-33
gi|23508035|ref|NP_700705.1| hypothetical protein [Plasmodium fa... 145 2e-33
gi|47206405|emb|CAG01534.1| unnamed protein product [Tetraodon n... 144 3e-33
gi|15609238|ref|NP_216617.1| helZ [Mycobacterium tuberculosis H3... 144 3e-33
gi|31793283|ref|NP_855776.1| PROBABLE HELICASE HELZ [Mycobacteri... 144 3e-33
gi|33239499|ref|NP_874441.1| Superfamily II DNA/RNA helicases, S... 144 3e-33
gi|35505451|gb|AAH57567.1| Chromodomain helicase DNA binding pro... 144 3e-33
gi|13386044|ref|NP_080815.1| chromodomain helicase DNA binding p... 144 3e-33
gi|15841592|ref|NP_336629.1| helicase, SNF2/RAD54 family [Mycoba... 144 3e-33
gi|38079103|ref|XP_110500.2| similar to ATP-dependent chromatin ... 144 3e-33
gi|38637850|ref|NP_942824.1| putative helicase, superfamily II [... 144 3e-33
gi|49085796|ref|XP_404992.1| hypothetical protein AN0855.2 [Aspe... 144 4e-33
gi|19552388|ref|NP_600390.1| putative helicase [Corynebacterium ... 144 5e-33
gi|50758555|ref|XP_417313.1| PREDICTED: similar to chromodomain ... 143 7e-33
gi|45185972|ref|NP_983688.1| ACR286Cp [Eremothecium gossypii] >g... 143 7e-33
gi|31240219|ref|XP_320523.1| ENSANGP00000008665 [Anopheles gambi... 143 7e-33
gi|3298562|gb|AAC39923.1| zinc-finger helicase [Homo sapiens] 143 9e-33
gi|50294037|ref|XP_449430.1| unnamed protein product [Candida gl... 143 9e-33
gi|5921743|sp|Q12873|CHD3_HUMAN Chromodomain helicase-DNA-bindin... 143 9e-33
gi|15226870|ref|NP_178318.1| SNF2 domain-containing protein / he... 143 9e-33
gi|34870936|ref|XP_220602.2| similar to zinc-finger helicase [Ra... 142 1e-32
gi|33866892|ref|NP_898451.1| SNF2 helicase homolog [Synechococcu... 142 1e-32
gi|38079010|ref|XP_110546.2| similar to ATP-dependent chromatin ... 142 2e-32
gi|17569817|ref|NP_510140.1| CHromoDomain protein, DNA binding h... 142 2e-32
gi|49022903|dbj|BAC41410.3| mKIAA0308 protein [Mus musculus] 142 2e-32
gi|49355790|ref|NP_079410.3| chromodomain helicase DNA binding p... 142 2e-32
gi|38089687|ref|XP_284439.2| RIKEN cDNA 1810014J18 [Mus musculus] 142 2e-32
gi|42569009|ref|NP_178970.2| chromodomain-helicase-DNA-binding f... 142 2e-32
gi|34327952|dbj|BAA20767.2| KIAA0308 [Homo sapiens] 142 2e-32
gi|25411492|pir||C84507 hypothetical protein At2g13370 [imported... 142 2e-32
gi|49476336|gb|AAT66509.1| KISH2; hKISH2; Kismet homolog 2 [Homo... 141 3e-32
gi|10434055|dbj|BAB14112.1| unnamed protein product [Homo sapiens] 141 3e-32
gi|12083522|gb|AAG48831.1| similar to Arabidopsis thaliana putat... 141 4e-32
gi|34914698|ref|NP_918696.1| putative DNA-dependent ATPase [Oryz... 141 4e-32
gi|41055574|ref|NP_957438.1| similar to RAD54-like [Danio rerio]... 140 5e-32
gi|46432408|gb|EAK91891.1| hypothetical protein CaO19.13670 [Can... 140 5e-32
gi|33864422|ref|NP_895982.1| SNF2 related domain:DEAD/DEAH box h... 140 5e-32
gi|34851357|ref|XP_226325.2| similar to Probable chromodomain-he... 140 5e-32
gi|45382655|ref|NP_990041.1| RAD54B protein [Gallus gallus] >gnl... 140 6e-32
gi|48102618|ref|XP_395401.1| similar to DNA excision repair prot... 140 6e-32
gi|46228555|gb|EAK89425.1| brahma like protein with a HSA domain... 140 8e-32
gi|23489816|gb|EAA21734.1| chromodomain-helicase-DNA-binding pro... 140 8e-32
gi|39589511|emb|CAE74540.1| Hypothetical protein CBG22297 [Caeno... 139 1e-31
gi|23193483|gb|AAN14536.1| SNF2P [Oryza sativa (japonica cultiva... 139 2e-31
gi|50753684|ref|XP_414088.1| PREDICTED: similar to hypothetical ... 138 2e-31
gi|16080681|ref|NP_391509.1| ywqA [Bacillus subtilis subsp. subt... 138 2e-31
gi|1763712|emb|CAB05939.1| ywqA [Bacillus subtilis] 138 2e-31
gi|24373219|ref|NP_717262.1| Snf2 family protein [Shewanella one... 138 2e-31
gi|17508849|ref|NP_491426.1| chromodomain-helicase-DNA-binding p... 138 3e-31
gi|31043816|emb|CAA88960.2| Hypothetical protein M03C11.8 [Caeno... 138 3e-31
gi|13507759|ref|NP_109708.1| similar to helicases [Mycoplasma pn... 138 3e-31
gi|17554270|ref|NP_499301.1| SNF2 related domain and helicase, C... 138 3e-31
gi|50424107|ref|XP_460638.1| unnamed protein product [Debaryomyc... 137 4e-31
gi|31204935|ref|XP_311416.1| ENSANGP00000016881 [Anopheles gambi... 137 4e-31
gi|46227356|gb|EAK88291.1| CHD3 ortholog with 2x chromodomains p... 137 4e-31
gi|19115202|ref|NP_594290.1| DNA repair protein rhp54 [Schizosac... 137 5e-31
gi|542215|pir||S41886 DNA repair protein - fission yeast (Schizo... 137 5e-31
gi|45533168|ref|ZP_00184160.1| COG0553: Superfamily II DNA/RNA h... 137 7e-31
gi|12853471|dbj|BAB29753.1| unnamed protein product [Mus musculus] 136 9e-31
gi|34867177|ref|XP_232785.2| similar to RAD54B homolog isoform 1... 136 9e-31
gi|38109409|gb|EAA55288.1| hypothetical protein MG06945.4 [Magna... 136 9e-31
gi|39593093|emb|CAE64562.1| Hypothetical protein CBG09312 [Caeno... 136 1e-30
gi|17562600|ref|NP_504523.1| CHromoDomain protein, helicase Mi-2... 136 1e-30
gi|20259462|gb|AAM13851.1| putative ATPase (ISW2) [Arabidopsis t... 136 1e-30
gi|22330875|ref|NP_187291.2| DNA-dependent ATPase, putative [Ara... 136 1e-30
gi|50418184|gb|AAH77717.1| CHD1L protein [Homo sapiens] 135 1e-30
gi|6437558|gb|AAF08585.1| putative ATPase (ISW2-like) [Arabidops... 135 1e-30
gi|42407269|dbj|BAD10851.1| lymphoid specific helicase variant8 ... 135 1e-30
gi|39591892|emb|CAE71470.1| Hypothetical protein CBG18388 [Caeno... 135 2e-30
gi|49092974|ref|XP_407948.1| hypothetical protein AN3811.2 [Aspe... 135 2e-30
gi|47459148|ref|YP_016010.1| swf/snf family helicase-like protei... 135 2e-30
gi|50729550|ref|XP_416560.1| PREDICTED: similar to chromodomain ... 135 3e-30
gi|50311185|ref|XP_455616.1| unnamed protein product [Kluyveromy... 135 3e-30
gi|2130312|pir||S62418 hypothetical protein SPAC22F3.03c - fissi... 134 3e-30
gi|32421361|ref|XP_331124.1| hypothetical protein ( (AB032901) R... 134 3e-30
gi|38258935|sp|Q09772|RD54_SCHPO Meiotic recombination protein r... 134 3e-30
gi|19113950|ref|NP_593038.1| hypothetical helicase; putative dna... 134 3e-30
gi|30686915|ref|NP_568365.2| DNA-dependent ATPase, putative [Ara... 134 4e-30
gi|30686918|ref|NP_850847.1| DNA-dependent ATPase, putative [Ara... 134 4e-30
gi|49091298|ref|XP_407110.1| hypothetical protein AN2973.2 [Aspe... 134 4e-30
gi|15806278|ref|NP_294983.1| DNA helicase, SNF2/RAD54 family [De... 133 7e-30
gi|50259517|gb|EAL22190.1| hypothetical protein CNBC3280 [Crypto... 133 1e-29
gi|46447118|ref|YP_008483.1| conserved hypothetical protein [Par... 132 1e-29
gi|42569923|ref|NP_182025.2| transcription regulatory protein SN... 132 1e-29
gi|7485374|pir||T06312 hypothetical protein F11C18.100 - Arabido... 132 2e-29
gi|46438788|gb|EAK98114.1| hypothetical protein CaO19.12827 [Can... 132 2e-29
gi|50258657|gb|EAL21342.1| hypothetical protein CNBD0390 [Crypto... 132 2e-29
gi|42523166|ref|NP_968546.1| putative helicase/SNF2 family domai... 132 2e-29
gi|7384851|dbj|BAA93079.1| Rad54 homolog [Neurospora crassa] 131 3e-29
gi|46127169|ref|XP_388138.1| hypothetical protein FG07962.1 [Gib... 131 3e-29
gi|6912622|ref|NP_036547.1| RAD54 homolog B isoform 1; RAD54, S.... 131 3e-29
gi|38233618|ref|NP_939385.1| SNF2/RAD54 family protein [Coryneba... 131 3e-29
gi|19114529|ref|NP_593617.1| SNF2 family helicase [Schizosacchar... 130 5e-29
gi|32412838|ref|XP_326899.1| hypothetical protein [Neurospora cr... 130 6e-29
gi|38566825|emb|CAE76132.1| related to helicase-DNA-binding prot... 130 6e-29
gi|46228613|gb|EAK89483.1| Swr1p like SWI/SNF2 family ATpase wit... 130 6e-29
gi|25408914|pir||B84885 probable transcription activator [import... 129 1e-28
gi|20521890|dbj|BAA92573.2| KIAA1335 protein [Homo sapiens] 129 2e-28
gi|22775414|dbj|BAC11858.1| recombinational repair protein [Magn... 129 2e-28
gi|49068154|ref|XP_398366.1| hypothetical protein UM00751.1 [Ust... 129 2e-28
gi|38105538|gb|EAA51954.1| hypothetical protein MG03549.4 [Magna... 129 2e-28
gi|42571231|ref|NP_973689.1| transcription regulatory protein SN... 128 2e-28
gi|29247792|gb|EAA39344.1| GLP_177_26570_34507 [Giardia lamblia ... 128 2e-28
gi|45357049|gb|AAS58478.1| SNF2P [Hordeum vulgare subsp. vulgare] 127 4e-28
gi|23193481|gb|AAN14535.1| SNF2P [Hordeum vulgare] 127 4e-28
gi|46227534|gb|EAK88469.1| RAD54 like SWI/SNF2 ATpase [Cryptospo... 127 4e-28
gi|49088566|ref|XP_406093.1| hypothetical protein AN1956.2 [Aspe... 127 4e-28
gi|45357056|gb|AAS58484.1| SNF2P [Triticum monococcum] 127 5e-28
gi|34907414|ref|NP_915054.1| putative chromodomain-helicase-DNA-... 127 5e-28
gi|19112177|ref|NP_595385.1| helicase C protein with SNF2 domain... 126 9e-28
gi|34533780|dbj|BAC86802.1| unnamed protein product [Homo sapiens] 126 1e-27
gi|46104617|ref|ZP_00191573.2| COG0553: Superfamily II DNA/RNA h... 125 2e-27
gi|8777308|dbj|BAA96898.1| unnamed protein product [Arabidopsis ... 125 2e-27
gi|42407261|dbj|BAD10847.1| lymphoid specific helicase variant4 ... 125 3e-27
gi|6321289|ref|NP_011365.1| ATPase that forms a large complex, c... 125 3e-27
gi|728695|emb|CAA88537.1| DNA helicase type protein [Saccharomyc... 125 3e-27
gi|48763750|ref|ZP_00268304.1| COG0553: Superfamily II DNA/RNA h... 124 3e-27
gi|42407265|dbj|BAD10849.1| lymphoid specific helicase variant6 ... 124 3e-27
gi|26347721|dbj|BAC37509.1| unnamed protein product [Mus musculus] 124 4e-27
gi|50748161|ref|XP_421134.1| PREDICTED: similar to hypothetical ... 124 4e-27
gi|31209871|ref|XP_313902.1| ENSANGP00000003358 [Anopheles gambi... 124 4e-27
gi|45515961|ref|ZP_00167515.1| COG0553: Superfamily II DNA/RNA h... 124 6e-27
gi|46397086|sp|O13682|YDY1_SCHPO Hypothetical helicase C11E3.01c... 124 6e-27
gi|32411361|ref|XP_326161.1| hypothetical protein [Neurospora cr... 124 6e-27
gi|38102212|gb|EAA49078.1| hypothetical protein MG00736.4 [Magna... 124 6e-27
gi|38567839|emb|CAE05788.2| OSJNBb0020J19.17 [Oryza sativa (japo... 123 8e-27
gi|33469139|ref|NP_115572.2| yeast INO80-like protein [Homo sapi... 123 8e-27
gi|6330933|dbj|BAA86573.1| KIAA1259 protein [Homo sapiens] 123 8e-27
gi|37360298|dbj|BAC98127.1| mKIAA1259 protein [Mus musculus] 123 1e-26
gi|26383483|dbj|BAB31000.2| unnamed protein product [Mus musculus] 123 1e-26
gi|37590263|gb|AAH59235.1| 4632409L19Rik protein [Mus musculus] 123 1e-26
gi|38075621|ref|XP_355376.1| RIKEN cDNA 4632409L19 [Mus musculus] 123 1e-26
gi|31199727|ref|XP_308811.1| ENSANGP00000007696 [Anopheles gambi... 123 1e-26
gi|19347965|gb|AAL86315.1| putative helicase [Arabidopsis thaliana] 122 1e-26
gi|34857610|ref|XP_230473.2| similar to KIAA1259 protein [Rattus... 122 1e-26
gi|15836368|ref|NP_300892.1| SWI/SNF family helicase_1 [Chlamydo... 122 1e-26
gi|30694618|ref|NP_191289.2| transcriptional activator, putative... 122 1e-26
gi|11360069|pir||T43485 hypothetical protein DKFZp434J1672.1 - h... 122 2e-26
>gi|17533247|ref|NP_496802.1| TBP-associated factor BTAF homolog
(btf-1) [Caenorhabditis elegans]
gi|7499185|pir||T20986 hypothetical protein F15D4.1 - Caenorhabditis
elegans
gi|3875971|emb|CAB02491.1| Hypothetical protein F15D4.1
[Caenorhabditis elegans]
gi|3880600|emb|CAB04949.1| Hypothetical protein F15D4.1
[Caenorhabditis elegans]
Length = 1529
Score = 760 bits (1962), Expect = 0.0
Identities = 386/405 (95%), Positives = 386/405 (95%)
Frame = +2
Query: 2 ILSGTPVQNSPADLWSLFAWLMPGYLGSEKQFRSQFLKKIMKCRLPKANEADLKAGSAAI 181
ILSGTPVQNSPADLWSLFAWLMPGYLGSEKQFRSQFLKKIMKCRLPKANEADLKAGSAAI
Sbjct: 1125 ILSGTPVQNSPADLWSLFAWLMPGYLGSEKQFRSQFLKKIMKCRLPKANEADLKAGSAAI 1184
Query: 182 SQLHKLVLPFVMRRLKTEVLKELPEKNVQDYECELTEDQKEIYRFVVDRCTSSQEDVGLS 361
SQLHKLVLPFVMRRLKTEVLKELPEKNVQDYECELTEDQKEIYRFVVDRCTSSQEDVGLS
Sbjct: 1185 SQLHKLVLPFVMRRLKTEVLKELPEKNVQDYECELTEDQKEIYRFVVDRCTSSQEDVGLS 1244
Query: 362 SLVTLITLRKLTDHTKLVHDTLAKIGAPQYILSKALAAKSGKMEALKQLLIECEICKNPD 541
SLVTLITLRKLTDHTKLVHDTLAKIGAPQYILSKALAAKSGKMEALKQLLIECEICKNPD
Sbjct: 1245 SLVTLITLRKLTDHTKLVHDTLAKIGAPQYILSKALAAKSGKMEALKQLLIECEICKNPD 1304
Query: 542 EEVEQPEDLGGLVASGHRALIFCQWKTSAKLVSDALKSGEFGSVVSHLVLDGSVPAGDRM 721
EEVEQPEDLGGLVASGHRALIFCQWKTSAKLVSDALKSGEFGSVVSHLVLDGSVPAGDRM
Sbjct: 1305 EEVEQPEDLGGLVASGHRALIFCQWKTSAKLVSDALKSGEFGSVVSHLVLDGSVPAGDRM 1364
Query: 722 KMVNRFNEDKTIDVLILTTHVGGVGLNLTGADTVIFLDHDWNPMKDLQAIDRAHRLGQTR 901
KMVNRFNEDKTIDVLILTTHVGGVGLNLTGADTVIFLDHDWNPMKDLQAIDRAHRLGQTR
Sbjct: 1365 KMVNRFNEDKTIDVLILTTHVGGVGLNLTGADTVIFLDHDWNPMKDLQAIDRAHRLGQTR 1424
Query: 902 NVNVYRLITQGTVEEKVMSLAKFKLNTAQALIGADNTSMMTMETGELMNMFTLDGDXXXX 1081
NVNVYRLITQGTVEEKVMSLAKFKLNTAQALIGADNTSMMTMETGELMNMFTLDGD
Sbjct: 1425 NVNVYRLITQGTVEEKVMSLAKFKLNTAQALIGADNTSMMTMETGELMNMFTLDGDEAKK 1484
Query: 1082 XXXXXXXXXXXXXXXTGAPEEVDLASMWDESQYDDFQVDSFLRNT 1216
TGAPEEVDLASMWDESQYDDFQVDSFLRNT
Sbjct: 1485 KPGGGEPAAKKSKKSTGAPEEVDLASMWDESQYDDFQVDSFLRNT 1529
>gi|39597216|emb|CAE59443.1| Hypothetical protein CBG02816
[Caenorhabditis briggsae]
Length = 1510
Score = 677 bits (1748), Expect = 0.0
Identities = 346/417 (82%), Positives = 371/417 (87%), Gaps = 12/417 (2%)
Frame = +2
Query: 2 ILSGTPVQNSPADLWSLFAWLMPGYLGSEKQFRSQFLKKIMKCRLPKANEADLKAGSAAI 181
ILSGTPVQNSPADLWSLF WLMPGYLG+EKQFRSQFLKKIMKCRLPKANE +LKAGSAAI
Sbjct: 1094 ILSGTPVQNSPADLWSLFTWLMPGYLGTEKQFRSQFLKKIMKCRLPKANETELKAGSAAI 1153
Query: 182 SQLHKLVLPFVMRRLKTEVLKELPEKNVQDYECELTEDQKEIYRFVVDRCTSSQEDV--- 352
+QLHKLVLPFV+RRLKTEVLKELP+KNVQDYECELTEDQK++YRF+VDRCTSS E+V
Sbjct: 1154 TQLHKLVLPFVLRRLKTEVLKELPDKNVQDYECELTEDQKDVYRFIVDRCTSSYEEVQNK 1213
Query: 353 -GLSSLVTLITLRKLTDHTKLVHDTLAKIGAPQYILSKALAAKSGKMEALKQLLIECEIC 529
G+SSLVTLI+LRKLTDHTKLV+DTL KIGAPQ IL KAL +KSGKMEALKQLLIECEIC
Sbjct: 1214 TGISSLVTLISLRKLTDHTKLVYDTLLKIGAPQDILQKALTSKSGKMEALKQLLIECEIC 1273
Query: 530 KNPDEEVE-QPEDLGGL--VASGHRALIFCQWKTSAKLVSDALKSGEFGSVVSHLVLDGS 700
KNPDEEV + ++LGGL V GHRALIFCQWKTSA+LVS+AL+SGEFGSVVSHLVLDG+
Sbjct: 1274 KNPDEEVAAEADELGGLNEVGQGHRALIFCQWKTSAQLVSEALRSGEFGSVVSHLVLDGN 1333
Query: 701 VPAGDRMKMVNRFNEDKTIDVLILTTHVGGVGLNLTGADTVIFLDHDWNPMKDLQAIDRA 880
VP GDRMKMVNRFNEDKTI+VLILTTHVGGVGLNLTGADTVIF+DHDWNPMKDLQAIDRA
Sbjct: 1334 VPVGDRMKMVNRFNEDKTIEVLILTTHVGGVGLNLTGADTVIFMDHDWNPMKDLQAIDRA 1393
Query: 881 HRLGQTRNVNVYRLITQGTVEEKVMSLAKFKLNTAQALIGADNTSMMTMETGELMNMFTL 1060
HRLGQTRNVNVYRLITQGTVEEKVMSLAKFKLNTAQALIGADNTSMMTMETGELMNMFTL
Sbjct: 1394 HRLGQTRNVNVYRLITQGTVEEKVMSLAKFKLNTAQALIGADNTSMMTMETGELMNMFTL 1453
Query: 1061 DGD-----XXXXXXXXXXXXXXXXXXXTGAPEEVDLASMWDESQYDDFQVDSFLRNT 1216
DGD G EE++LASMWDESQYDDFQVD+FLRNT
Sbjct: 1454 DGDEPTKKRGETSGEPAVKKSKKATSSGGPSEEINLASMWDESQYDDFQVDNFLRNT 1510