Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F17H10_1
         (723 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17567095|ref|NP_510177.1| serine active site containing 1 lik...   483   e-135
gi|39583166|emb|CAE61384.1| Hypothetical protein CBG05232 [Caeno...   448   e-125
gi|50742618|ref|XP_419696.1| PREDICTED: similar to hypothetical ...   142   7e-33
gi|14042785|dbj|BAB55393.1| unnamed protein product [Homo sapiens]    134   1e-30
gi|40254995|ref|NP_116250.2| hypothetical protein FLJ14917 [Homo...   134   2e-30
gi|28893415|ref|NP_796285.1| serine active site containing 1 [Mu...   133   3e-30
gi|47224615|emb|CAG03599.1| unnamed protein product [Tetraodon n...   132   7e-30
gi|48099055|ref|XP_392572.1| similar to hypothetical protein FLJ...   130   2e-29
gi|31198289|ref|XP_308092.1| ENSANGP00000019766 [Anopheles gambi...   110   4e-23
gi|20129595|ref|NP_609896.1| CG10383-PA [Drosophila melanogaster...   105   7e-22
gi|15291485|gb|AAK93011.1| GH23377p [Drosophila melanogaster]         105   7e-22
gi|42567382|ref|NP_195157.2| expressed protein [Arabidopsis thal...   105   1e-21
gi|37523664|ref|NP_927041.1| hypothetical protein gll4095 [Gloeo...    85   2e-15
gi|31197507|ref|XP_307701.1| ENSANGP00000002562 [Anopheles gambi...    84   4e-15
gi|48894571|ref|ZP_00327680.1| COG1075: Predicted acetyltransfer...    79   9e-14
gi|46136249|ref|XP_389816.1| hypothetical protein FG09640.1 [Gib...    75   1e-12
gi|38102340|gb|EAA49192.1| hypothetical protein MG00850.4 [Magna...    74   4e-12
gi|32413381|ref|XP_327170.1| hypothetical protein [Neurospora cr...    73   5e-12
gi|49091142|ref|XP_407032.1| hypothetical protein AN2895.2 [Aspe...    72   1e-11
gi|46125223|ref|XP_387165.1| hypothetical protein FG06989.1 [Gib...    72   1e-11
gi|21356915|ref|NP_651481.1| CG5455-PA [Drosophila melanogaster]...    71   3e-11
gi|48893021|ref|ZP_00326314.1| COG0457: FOG: TPR repeat [Trichod...    70   4e-11
gi|38109271|gb|EAA55165.1| hypothetical protein MG06822.4 [Magna...    66   6e-10
gi|46114472|ref|XP_383254.1| hypothetical protein FG03078.1 [Gib...    66   8e-10
gi|38099440|gb|EAA46787.1| hypothetical protein MG10481.4 [Magna...    65   1e-09
gi|46102477|gb|AAS80314.1| SesB [Nectria haematococca]                 63   5e-09
gi|49106303|ref|XP_411414.1| hypothetical protein AN7277.2 [Aspe...    63   7e-09
gi|46117078|ref|XP_384557.1| hypothetical protein FG04381.1 [Gib...    62   9e-09
gi|38104020|gb|EAA50647.1| hypothetical protein MG04406.4 [Magna...    62   1e-08
gi|32409147|ref|XP_325054.1| predicted protein [Neurospora crass...    62   2e-08
gi|46117406|ref|XP_384721.1| hypothetical protein FG04545.1 [Gib...    59   1e-07
gi|32410541|ref|XP_325751.1| hypothetical protein [Neurospora cr...    59   1e-07
gi|48894553|ref|ZP_00327662.1| COG1075: Predicted acetyltransfer...    57   4e-07
gi|46110585|ref|XP_382350.1| hypothetical protein FG02174.1 [Gib...    56   8e-07
gi|46135873|ref|XP_389628.1| hypothetical protein FG09452.1 [Gib...    56   8e-07
gi|38109222|gb|EAA55126.1| hypothetical protein MG06783.4 [Magna...    54   2e-06
gi|23481574|gb|EAA17810.1| hypothetical protein [Plasmodium yoel...    54   2e-06
gi|23508547|ref|NP_701216.1| hypothetical protein [Plasmodium fa...    54   4e-06
gi|46110967|ref|XP_382541.1| hypothetical protein FG02365.1 [Gib...    53   5e-06
gi|49089596|ref|XP_406463.1| hypothetical protein AN2326.2 [Aspe...    53   5e-06
gi|17230980|ref|NP_487528.1| unknown protein [Nostoc sp. PCC 712...    53   5e-06
gi|31198287|ref|XP_308091.1| ENSANGP00000003097 [Anopheles gambi...    51   3e-05
gi|15208073|dbj|BAB63061.1| hypothetical protein [Macaca fascicu...    50   4e-05
gi|46226938|gb|EAK87904.1| possible HSMGG motif (esterase?) [Cry...    50   5e-05
gi|7452422|pir||T04777 hypothetical protein F10M10.80 - Arabidop...    49   1e-04
gi|32407046|ref|XP_324124.1| predicted protein [Neurospora crass...    47   4e-04
gi|46130868|ref|XP_389165.1| hypothetical protein FG08989.1 [Gib...    47   5e-04
gi|49097530|ref|XP_410225.1| hypothetical protein AN6088.2 [Aspe...    46   9e-04
gi|48893124|ref|ZP_00326417.1| hypothetical protein Tery02003479...    45   0.001
gi|46115934|ref|XP_383985.1| hypothetical protein FG03809.1 [Gib...    44   0.003
gi|15642828|ref|NP_227869.1| esterase, putative [Thermotoga mari...    44   0.004
gi|49085232|ref|XP_404753.1| hypothetical protein AN0616.2 [Aspe...    42   0.010
gi|48770897|ref|ZP_00275240.1| COG1075: Predicted acetyltransfer...    42   0.010
gi|49073948|ref|XP_401143.1| hypothetical protein UM03528.1 [Ust...    42   0.013
gi|45657882|ref|YP_001968.1| conserved hypothetical protein [Lep...    42   0.013
gi|24214561|ref|NP_712042.1| conserved hypothetical protein [Lep...    42   0.017
gi|38101713|gb|EAA48633.1| hypothetical protein MG00291.4 [Magna...    41   0.022
gi|48857398|ref|ZP_00311406.1| COG1075: Predicted acetyltransfer...    41   0.028
gi|42524221|ref|NP_969601.1| hypothetical protein predicted by G...    41   0.028
gi|49092454|ref|XP_407688.1| hypothetical protein AN3551.2 [Aspe...    40   0.037
gi|46130706|ref|XP_389133.1| hypothetical protein FG08957.1 [Gib...    40   0.048
gi|50258218|gb|EAL20912.1| hypothetical protein CNBE2730 [Crypto...    40   0.063
gi|46137009|ref|XP_390196.1| hypothetical protein FG10020.1 [Gib...    39   0.082
gi|46115670|ref|XP_383853.1| hypothetical protein FG03677.1 [Gib...    39   0.082
gi|45269275|gb|AAS56017.1| YDR058C [Saccharomyces cerevisiae]          39   0.11
gi|6320263|ref|NP_010343.1| Triglyceride Lipase; Tgl2p [Saccharo...    39   0.11
gi|1332597|emb|CAA66637.1| triglyceride lipase [Saccharomyces ce...    39   0.11
gi|50875280|emb|CAG35120.1| hypothetical protein [Desulfotalea p...    39   0.11
gi|46126669|ref|XP_387888.1| hypothetical protein FG07712.1 [Gib...    39   0.14
gi|45519484|ref|ZP_00171035.1| COG1075: Predicted acetyltransfer...    38   0.18
gi|45199169|ref|NP_986198.1| AFR650Wp [Eremothecium gossypii] >g...    38   0.24
gi|47573683|ref|ZP_00243721.1| COG1075: Predicted acetyltransfer...    38   0.24
gi|6322558|ref|NP_012632.1| Hypothetical ORF; Yjr098cp [Saccharo...    37   0.31
gi|45657338|ref|YP_001424.1| conserved hypothetical protein [Lep...    37   0.41
gi|24215205|ref|NP_712686.1| esterase, putative [Leptospira inte...    37   0.41
gi|1017754|gb|AAA79183.1| esterase                                     37   0.41
gi|50304751|ref|XP_452331.1| unnamed protein product [Kluyveromy...    37   0.41
gi|17546801|ref|NP_520203.1| PUTATIVE LIPASE TRANSMEMBRANE PROTE...    37   0.41
gi|15207869|dbj|BAB62959.1| hypothetical protein [Macaca fascicu...    37   0.41
gi|27376677|ref|NP_768206.1| bll1566 [Bradyrhizobium japonicum U...    36   0.69
gi|32405136|ref|XP_323181.1| hypothetical protein [Neurospora cr...    36   0.69
gi|30248781|ref|NP_840851.1| Esterase/lipase/thioesterase family...    36   0.69
gi|46127471|ref|XP_388289.1| hypothetical protein FG08113.1 [Gib...    36   0.69
gi|42780938|ref|NP_978185.1| conserved hypothetical protein [Bac...    36   0.91
gi|42573169|ref|NP_974681.1| expressed protein [Arabidopsis thal...    35   1.2
gi|15597574|ref|NP_251068.1| probable aldehyde dehydrogenase [Ps...    35   1.2
gi|27363654|ref|NP_759182.1| Predicted hydrolase or acyltransfer...    35   1.2
gi|28897611|ref|NP_797216.1| putative esterase/lipase YbfF [Vibr...    35   1.2
gi|18976508|ref|NP_577865.1| hypothetical protein PF0136 [Pyroco...    35   1.2
gi|14318494|ref|NP_116628.1| Negatively regulates COPII vesicle ...    35   1.2
gi|47565526|ref|ZP_00236567.1| predicted acetyltransferases and ...    35   1.2
gi|46139411|ref|XP_391396.1| hypothetical protein FG11220.1 [Gib...    35   1.5
gi|46913630|emb|CAG20416.1| conserved hypothetical protein [Phot...    35   1.5
gi|49090906|ref|XP_406914.1| hypothetical protein AN2777.2 [Aspe...    35   1.5
gi|22971644|ref|ZP_00018583.1| hypothetical protein [Chloroflexu...    35   2.0
gi|15806369|ref|NP_295075.1| dihydrolipoamide acetyltransferase-...    35   2.0
gi|41723082|ref|ZP_00150038.1| COG1075: Predicted acetyltransfer...    35   2.0
gi|49094030|ref|XP_408476.1| hypothetical protein AN4339.2 [Aspe...    35   2.0
gi|38102398|gb|EAA49239.1| hypothetical protein MG00897.4 [Magna...    35   2.0
gi|38102253|gb|EAA49115.1| hypothetical protein MG00773.4 [Magna...    34   2.6
gi|46120386|ref|XP_385016.1| hypothetical protein FG04840.1 [Gib...    34   2.6
gi|2326314|emb|CAA04232.1| infection responsive serine protease ...    34   2.6
gi|49084000|gb|AAT51165.1| PA4813 [synthetic construct]                34   2.6
gi|50259038|gb|EAL21717.1| hypothetical protein CNBC5810 [Crypto...    34   2.6
gi|15600006|ref|NP_253500.1| lipase LipC [Pseudomonas aeruginosa...    34   2.6
gi|3550950|gb|AAC34733.1| lipase [Pseudomonas aeruginosa]              34   2.6
gi|50554461|ref|XP_504639.1| hypothetical protein [Yarrowia lipo...    34   3.4
gi|50304727|ref|XP_452319.1| unnamed protein product [Kluyveromy...    34   3.4
gi|31240627|ref|XP_320727.1| ENSANGP00000020252 [Anopheles gambi...    34   3.4
gi|31240625|ref|XP_320726.1| ENSANGP00000023523 [Anopheles gambi...    34   3.4
gi|20808687|ref|NP_623858.1| predicted acetyltransferases and hy...    33   4.5
gi|50555123|ref|XP_504970.1| hypothetical protein [Yarrowia lipo...    33   4.5
gi|15614459|ref|NP_242762.1| BH1896~unknown conserved protein [B...    33   5.9
gi|50405007|ref|YP_054099.1| Guanylyl cyclase, putative [Paramec...    33   5.9
gi|46139009|ref|XP_391195.1| hypothetical protein FG11019.1 [Gib...    33   5.9
gi|15240892|ref|NP_198652.1| esterase/lipase/thioesterase family...    33   5.9
gi|31207933|ref|XP_312933.1| ENSANGP00000014730 [Anopheles gambi...    33   5.9
gi|30263681|ref|NP_846058.1| prophage LambdaBa01, acyltransferas...    33   7.7
gi|42566968|ref|NP_193721.2| lecithin:cholesterol acyltransferas...    33   7.7
gi|49071294|ref|XP_399936.1| hypothetical protein UM02321.1 [Ust...    33   7.7
gi|45513130|ref|ZP_00164696.1| COG0596: Predicted hydrolases or ...    33   7.7
gi|50312333|ref|XP_456200.1| unnamed protein product [Kluyveromy...    33   7.7
gi|46319469|ref|ZP_00219875.1| COG1075: Predicted acetyltransfer...    33   7.7
gi|46130704|ref|XP_389132.1| hypothetical protein FG08956.1 [Gib...    33   7.7
gi|21401649|ref|NP_657634.1| LACT, Lecithin:cholesterol acyltran...    33   7.7
gi|38344254|emb|CAD41792.2| OSJNBa0008M17.7 [Oryza sativa (japon...    33   7.7


>gi|17567095|ref|NP_510177.1| serine active site containing 1 like
           (57.4 kD) (XN725) [Caenorhabditis elegans]
 gi|7499332|pir||T21079 hypothetical protein F17H10.1 -
           Caenorhabditis elegans
 gi|3876053|emb|CAA93652.1| Hypothetical protein F17H10.1
           [Caenorhabditis elegans]
 gi|3878811|emb|CAA93682.1| Hypothetical protein F17H10.1
           [Caenorhabditis elegans]
          Length = 506

 Score =  483 bits (1244), Expect = e-135
 Identities = 240/240 (100%), Positives = 240/240 (100%)
 Frame = +1

Query: 1   IDIVLIHGLRGSVAYTWRQKDSDENLLSSCWPKDWLPLDIKKPFRIIGLEYPSYIFHFTG 180
           IDIVLIHGLRGSVAYTWRQKDSDENLLSSCWPKDWLPLDIKKPFRIIGLEYPSYIFHFTG
Sbjct: 267 IDIVLIHGLRGSVAYTWRQKDSDENLLSSCWPKDWLPLDIKKPFRIIGLEYPSYIFHFTG 326

Query: 181 TQQSLQTRSERFKEQLEIAGIGKRPVLFICHSMGGLLAKKLLIDSTNLLKNTVGVLFIAT 360
           TQQSLQTRSERFKEQLEIAGIGKRPVLFICHSMGGLLAKKLLIDSTNLLKNTVGVLFIAT
Sbjct: 327 TQQSLQTRSERFKEQLEIAGIGKRPVLFICHSMGGLLAKKLLIDSTNLLKNTVGVLFIAT 386

Query: 361 PHKGSPVANWGYSVFQPTEDVRMLNENNAINRKLNEDFSAVSKEIPVIVSMVETVESNII 540
           PHKGSPVANWGYSVFQPTEDVRMLNENNAINRKLNEDFSAVSKEIPVIVSMVETVESNII
Sbjct: 387 PHKGSPVANWGYSVFQPTEDVRMLNENNAINRKLNEDFSAVSKEIPVIVSMVETVESNII 446

Query: 541 ANAKSIVVPNKSAVFEQGAVYHIADVHLNLCKPTRDSASYGVIINFLQDCLRESDKRKKL 720
           ANAKSIVVPNKSAVFEQGAVYHIADVHLNLCKPTRDSASYGVIINFLQDCLRESDKRKKL
Sbjct: 447 ANAKSIVVPNKSAVFEQGAVYHIADVHLNLCKPTRDSASYGVIINFLQDCLRESDKRKKL 506




[DB home][top]