Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F18A12_2
         (1950 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17533329|ref|NP_494532.1| neutral endopeptidase 24.11 like fa...  1290   0.0
gi|17533325|ref|NP_494533.1| endothelin-converting enzyme ECE-1a...   520   e-149
gi|49035172|gb|AAB66076.2| Hypothetical protein F18A12.4 [Caenor...   520   e-149
gi|17532485|ref|NP_494679.1| endothelin converting enzyme family...   520   e-146
gi|7497659|pir||T31991 hypothetical protein C49D10.10 - Caenorha...   514   e-144
gi|17544410|ref|NP_503004.1| endothelin converting enzyme 2 fami...   486   e-136
gi|17533319|ref|NP_494537.1| metallopeptidase family member (2D7...   481   e-134
gi|39580407|emb|CAE70967.1| Hypothetical protein CBG17780 [Caeno...   449   e-125
gi|38176042|gb|AAB66125.2| Hypothetical protein T06D4.3 [Caenorh...   398   e-109
gi|34365968|gb|AAB66075.2| Hypothetical protein F18A12.3 [Caenor...   395   e-108
gi|39583140|emb|CAE60680.1| Hypothetical protein CBG04333 [Caeno...   389   e-106
gi|39590202|emb|CAE61200.1| Hypothetical protein CBG04988 [Caeno...   371   e-101
gi|34365969|gb|AAB66077.3| Hypothetical protein F18A12.5 [Caenor...   361   4e-98
gi|17533327|ref|NP_494531.1| endothelin-converting enzyme 1 fami...   352   2e-95
gi|17536059|ref|NP_494530.1| endothelin-converting family member...   329   2e-88
gi|17544412|ref|NP_503005.1| neutral endopeptidase family member...   325   3e-87
gi|39580410|emb|CAE70970.1| Hypothetical protein CBG17784 [Caeno...   323   7e-87
gi|17533323|ref|NP_494534.1| endothelin-converting enzyme ECE-1a...   315   3e-84
gi|39580409|emb|CAE70969.1| Hypothetical protein CBG17783 [Caeno...   303   1e-80
gi|17533815|ref|NP_494497.1| endothelin converting family member...   266   2e-69
gi|17536057|ref|NP_494529.1| endothelin converting enzyme 2 fami...   265   4e-69
gi|25395480|pir||D88099 protein F18A12.5 [imported] - Caenorhabd...   251   3e-65
gi|39583141|emb|CAE60681.1| Hypothetical protein CBG04334 [Caeno...   186   1e-45
gi|17534885|ref|NP_494297.1| endothelin converting family member...   179   2e-43
gi|19568929|gb|AAL91975.1| neprilysin-like protein [Venturia can...   171   4e-41
gi|25395478|pir||C88099 protein F18A12.8 [imported] - Caenorhabd...   166   2e-39
gi|17533333|ref|NP_494538.1| neprilysin family member (2D712) [C...   166   2e-39
gi|39580402|emb|CAE70962.1| Hypothetical protein CBG17774 [Caeno...   165   3e-39
gi|48097695|ref|XP_393860.1| similar to neutral endopeptidase 24...   155   3e-36
gi|48099137|ref|XP_394870.1| similar to ENSANGP00000003181 [Apis...   154   6e-36
gi|7505183|pir||T32020 hypothetical protein K02F6.9 - Caenorhabd...   152   2e-35
gi|7507284|pir||T32025 hypothetical protein T06D4.5 - Caenorhabd...   150   1e-34
gi|39578903|emb|CAE56685.1| Hypothetical protein CBG24463 [Caeno...   147   9e-34
gi|39597229|emb|CAE59457.1| Hypothetical protein CBG02837 [Caeno...   147   9e-34
gi|17537801|ref|NP_496490.1| neprilysin-like zinc metallo-peptid...   147   9e-34
gi|31233489|ref|XP_318885.1| ENSANGP00000015756 [Anopheles gambi...   147   1e-33
gi|31241693|ref|XP_321277.1| ENSANGP00000008439 [Anopheles gambi...   146   2e-33
gi|48102239|ref|XP_395313.1| similar to ENSANGP00000008439 [Apis...   143   2e-32
gi|28302167|gb|AAH46653.1| Ece1-prov protein [Xenopus laevis]         143   2e-32
gi|25245872|gb|AAN73018.1| endothelin-converting enzyme [Locusta...   141   6e-32
gi|1706564|sp|P42893|ECE1_RAT Endothelin-converting enzyme 1 (EC...   138   5e-31
gi|16758380|ref|NP_446048.1| endothelin converting enzyme 1; End...   138   5e-31
gi|45550777|ref|NP_650904.3| CG4058-PA [Drosophila melanogaster]...   137   7e-31
gi|45551938|ref|NP_732540.2| CG4058-PB [Drosophila melanogaster]...   137   7e-31
gi|13359138|dbj|BAB33300.1| neutral endopeptidase 24.11 [Bombyx ...   137   1e-30
gi|47940700|gb|AAH72504.1| Endothelin converting enzyme 1 [Rattu...   135   3e-30
gi|2499916|sp|P97739|ECE1_CAVPO Endothelin-converting enzyme 1 (...   135   3e-30
gi|688290|gb|AAB32062.1| endothelin converting enzyme; ECE [Bos ...   135   4e-30
gi|1169464|sp|P42891|ECE1_BOVIN Endothelin-converting enzyme 1 (...   135   4e-30
gi|30794312|ref|NP_851352.1| endothelin converting enzyme 1 [Bos...   135   5e-30
gi|25148650|ref|NP_494343.2| neprilysin-like zinc metallo-peptid...   135   5e-30
gi|39579130|emb|CAE57019.1| Hypothetical protein CBG24895 [Caeno...   135   5e-30
gi|39584653|emb|CAE72406.1| Hypothetical protein CBG19565 [Caeno...   134   6e-30
gi|535182|emb|CAA84548.1| endothelin-converting-enzyme 1 [Homo s...   134   8e-30
gi|4503443|ref|NP_001388.1| endothelin converting enzyme 1 [Homo...   134   8e-30
gi|24640050|ref|NP_511056.2| CG5905-PA [Drosophila melanogaster]...   134   8e-30
gi|3287157|emb|CAA19767.1| dJ329E20.2 (endothelin converting enz...   134   8e-30
gi|1082351|pir||JC2521 endothelin converting enzyme (EC 3.4.24.-...   134   8e-30
gi|5821116|dbj|BAA83687.1| endothelin-converting enzyme-1c [Homo...   134   8e-30
gi|48097888|ref|XP_393916.1| similar to Ece1-prov protein [Apis ...   134   1e-29
gi|17737761|ref|NP_524227.1| CG9761-PA [Drosophila melanogaster]...   131   7e-29
gi|40556286|ref|NP_955011.1| endothelin converting enzyme 1 [Mus...   131   7e-29
gi|38078992|ref|XP_357400.1| similar to endothelin converting en...   131   7e-29
gi|7529553|emb|CAB86601.1| xce [Homo sapiens] >gnl|BL_ORD_ID|135...   131   7e-29
gi|39580408|emb|CAE70968.1| Hypothetical protein CBG17781 [Caeno...   129   3e-28
gi|45382641|ref|NP_990048.1| endothelin converting enzyme-1 [Gal...   129   3e-28
gi|31207647|ref|XP_312790.1| ENSANGP00000003181 [Anopheles gambi...   129   3e-28
gi|6467401|gb|AAF13153.1| soluble secreted endopeptidase delta [...   128   6e-28
gi|10505360|gb|AAG18446.1| neprilysin-like peptidase alpha [Mus ...   128   6e-28
gi|10505364|gb|AAG18448.1| neprilysin-like peptidase gamma [Mus ...   128   6e-28
gi|50752564|ref|XP_422833.1| PREDICTED: similar to Neprilysin (N...   128   6e-28
gi|7305477|ref|NP_038811.1| mel transforming oncogene-like 1; NE...   128   6e-28
gi|7769083|gb|AAF69247.1| neprilysin-like metallopeptidase 1 [Mu...   128   6e-28
gi|40254536|ref|NP_067281.2| damage-induced neuronal endopeptida...   128   6e-28
gi|48098331|ref|XP_392043.1| similar to endothelin-converting en...   127   7e-28
gi|27733413|gb|AAO21504.1| zinc metalloprotease [Manduca sexta]       127   7e-28
gi|11120734|ref|NP_068544.1| metallopeptidase; damage-induced ne...   127   1e-27
gi|2499917|sp|P78562|PEX_HUMAN Phosphate regulating neutral endo...   127   1e-27
gi|25290006|pir||D88082 protein T05A8.4 [imported] - Caenorhabdi...   127   1e-27
gi|20137989|sp|Q9JMI0|ECEL_MOUSE Endothelin-converting enzyme-li...   126   2e-27
gi|4758232|ref|NP_004817.1| endothelin converting enzyme-like 1;...   126   2e-27
gi|40254424|ref|NP_000435.2| X-linked phosphate regulating endop...   126   2e-27
gi|48095696|ref|XP_394512.1| similar to neprilysin-like peptidas...   126   2e-27
gi|37182964|gb|AAQ89282.1| ECEL1 [Homo sapiens]                       125   5e-27
gi|6755050|ref|NP_035207.1| phosphate regulating gene with homol...   124   6e-27
gi|6981356|ref|NP_037136.1| phosphate regulating gene with homol...   124   8e-27
gi|1843531|gb|AAB47750.1| Pex protein [Mus musculus]                  124   1e-26
gi|39590003|emb|CAE61001.1| Hypothetical protein CBG04739 [Caeno...   123   1e-26
gi|15991813|ref|NP_258428.1| membrane metallo-endopeptidase-like...   123   1e-26
gi|24643425|ref|NP_523417.2| CG9565-PA [Drosophila melanogaster]...   123   2e-26
gi|20177067|gb|AAM12295.1| RE48040p [Drosophila melanogaster]         123   2e-26
gi|48096878|ref|XP_394794.1| similar to ENSANGP00000001161 [Apis...   122   2e-26
gi|17564342|ref|NP_506520.1| neprilysin-like zinc metallo-peptid...   122   3e-26
gi|34758|emb|CAA30157.1| unnamed protein product [Homo sapiens]       121   7e-26
gi|4505203|ref|NP_000893.1| membrane metallo-endopeptidase; nepr...   121   7e-26
gi|128062|sp|P08473|NEP_HUMAN Neprilysin (Neutral endopeptidase)...   121   7e-26
gi|12084341|pdb|1DMT|A Chain A, Structure Of Human Neutral Endop...   121   7e-26
gi|41281433|ref|NP_055508.2| endothelin converting enzyme 2 [Hom...   120   1e-25
gi|5670195|gb|AAD46624.1| endothelin converting enzyme [Hydra vu...   120   1e-25
gi|16903015|gb|AAL30387.1| endothelin converting enzyme-2B [Homo...   120   1e-25
gi|40788300|dbj|BAA25530.2| KIAA0604 protein [Homo sapiens]           120   1e-25
gi|11065940|gb|AAG28399.1| endothelin-converting enzyme 2B [Homo...   120   1e-25
gi|21780271|gb|AAM77664.1| endothelin-converting enzyme-2C [Homo...   120   1e-25
gi|11265773|pir||JC7265 neprilysin (EC 3.4.24.11) II - rat            119   2e-25
gi|37183124|gb|AAQ89362.1| ECE2 [Homo sapiens]                        119   2e-25
gi|50657408|ref|NP_001002815.1| endothelin-converting enzyme 2 [...   119   3e-25
gi|39578902|emb|CAE56684.1| Hypothetical protein CBG24462 [Caeno...   118   4e-25
gi|45219834|gb|AAH66840.1| Mme protein [Mus musculus]                 118   4e-25
gi|31543255|ref|NP_032630.2| membrane metallo endopeptidase; nep...   118   4e-25
gi|2499915|sp|Q61391|NEP_MOUSE Neprilysin (Neutral endopeptidase...   118   4e-25
gi|128064|sp|P08049|NEP_RABIT Neprilysin (Neutral endopeptidase)...   118   6e-25
gi|67701|pir||HYRBN neprilysin (EC 3.4.24.11) - rabbit                118   6e-25
gi|6981210|ref|NP_036740.1| membrane metallo endopeptidase; memb...   117   8e-25
gi|20893704|ref|XP_155862.1| similar to endothelin-converting en...   117   8e-25
gi|47207866|emb|CAF91668.1| unnamed protein product [Tetraodon n...   117   1e-24
gi|27806649|ref|NP_776471.1| endothelin converting enzyme 2 isof...   117   1e-24
gi|21314840|ref|NP_647454.1| endothelin converting enzyme 2 isof...   117   1e-24
gi|29336085|ref|NP_808872.1| endothelin converting enzyme 2 isof...   117   1e-24
gi|2136744|pir||I46078 endothelin converting enzyme (EC 3.4.24.-...   117   1e-24
gi|29336087|ref|NP_808871.1| endothelin converting enzyme 2 isof...   117   1e-24
gi|29336089|ref|NP_808873.1| endothelin converting enzyme 2 isof...   117   1e-24
gi|24650765|ref|NP_651603.1| CG5527-PA [Drosophila melanogaster]...   117   1e-24
gi|47221126|emb|CAG05447.1| unnamed protein product [Tetraodon n...   117   1e-24
gi|3386480|gb|AAC28366.1| neprilysin [Perca flavescens]               117   1e-24
gi|39591154|emb|CAE73207.1| Hypothetical protein CBG20611 [Caeno...   117   1e-24
gi|34365966|gb|AAK31503.2| Hypothetical protein F26G1.6 [Caenorh...   115   4e-24
gi|32563993|ref|NP_871928.1| neprilysin family member (2D712) [C...   115   4e-24
gi|17533479|ref|NP_494857.1| endothelin-converting (2F66) [Caeno...   115   4e-24
gi|29150232|gb|AAO72356.1| endothelin-converting enzyme 2a-1 [Mu...   115   5e-24
gi|29150238|gb|AAO72359.1| endothelin-converting enzyme 2b-2 [Mu...   115   5e-24
gi|29150234|gb|AAO72357.1| endothelin-converting enzyme 2a-2 [Mu...   115   5e-24
gi|29150236|gb|AAO72358.1| endothelin-converting enzyme 2b-1 [Mu...   115   5e-24
gi|24650487|ref|NP_733186.1| CG6265-PB [Drosophila melanogaster]...   114   6e-24
gi|31207075|ref|XP_312504.1| ENSANGP00000001161 [Anopheles gambi...   114   6e-24
gi|24583940|ref|NP_609577.1| CG15485-PA [Drosophila melanogaster...   114   6e-24
gi|47216526|emb|CAG02177.1| unnamed protein product [Tetraodon n...   114   8e-24
gi|17534401|ref|NP_496842.1| zinc metallopeptidase 2 MEP2 precur...   113   2e-23
gi|47229835|emb|CAG07031.1| unnamed protein product [Tetraodon n...   110   9e-23
gi|47224958|emb|CAF97373.1| unnamed protein product [Tetraodon n...   110   2e-22
gi|15607339|ref|NP_214712.1| hypothetical protein Rv0198c [Mycob...   110   2e-22
gi|39591284|emb|CAE73337.1| Hypothetical protein CBG20766 [Caeno...   109   3e-22
gi|24375333|ref|NP_719376.1| peptidase, M13 family [Shewanella o...   108   4e-22
gi|47572442|ref|ZP_00242486.1| COG3590: Predicted metalloendopep...   108   4e-22
gi|21243473|ref|NP_643055.1| metallopeptidase [Xanthomonas axono...   108   6e-22
gi|15828409|ref|NP_302672.1| probable zinc metalloprotease [Myco...   108   6e-22
gi|39580641|emb|CAE72917.1| Hypothetical protein CBG20236 [Caeno...   108   6e-22
gi|5771408|gb|AAD51382.1| neutral endopeptidase [Aplysia califor...   107   8e-22
gi|31226455|ref|XP_317711.1| ENSANGP00000010035 [Anopheles gambi...   107   8e-22
gi|34872982|ref|XP_233712.2| similar to neprilysin (EC 3.4.24.11...   107   8e-22
gi|49091534|ref|XP_407228.1| hypothetical protein AN3091.2 [Aspe...   107   8e-22
gi|39583154|emb|CAE60694.1| Hypothetical protein CBG04353 [Caeno...   107   1e-21
gi|21358001|ref|NP_651646.1| CG14526-PA [Drosophila melanogaster...   106   2e-21
gi|32475678|ref|NP_868672.1| probable zinc metalloproteinase [Pi...   106   2e-21
gi|11078593|gb|AAG29105.1| zinc metallopeptidase 2 MEP2 [Ancylos...   106   2e-21
gi|37619802|emb|CAE48845.1| Hypothetical protein ZK970.1b [Caeno...   105   5e-21
gi|37619803|emb|CAA88892.3| Hypothetical protein ZK970.1a [Caeno...   105   5e-21
gi|20090849|ref|NP_616924.1| endothelin converting enzyme homolo...   104   7e-21
gi|50843361|ref|YP_056588.1| metalloprotease (peptidase family M...   104   9e-21
gi|49072038|ref|XP_400308.1| hypothetical protein UM02693.1 [Ust...   103   1e-20
gi|21232006|ref|NP_637923.1| metallopeptidase [Xanthomonas campe...   103   1e-20
gi|34497442|ref|NP_901657.1| probable metallopeptidase [Chromoba...   103   1e-20
gi|46364197|ref|ZP_00226834.1| COG3590: Predicted metalloendopep...   103   1e-20
gi|47224807|emb|CAG06377.1| unnamed protein product [Tetraodon n...   103   2e-20
gi|21355943|ref|NP_649924.1| CG8358-PA [Drosophila melanogaster]...   100   1e-19
gi|46111733|ref|XP_382924.1| hypothetical protein FG02748.1 [Gib...   100   2e-19
gi|34577157|gb|AAQ75756.1| zinc metallopeptidase 6 [Ancylostoma ...   100   2e-19
gi|50759351|ref|XP_425737.1| PREDICTED: similar to membrane meta...    99   4e-19
gi|17538015|ref|NP_496214.1| neprilysin-like zinc metallo-peptid...    99   5e-19
gi|7511440|pir||T28132 hypothetical protein ZK970.1 - Caenorhabd...    99   5e-19
gi|3415005|gb|AAC31568.1| putative zinc metallopeptidase [Haemon...    98   6e-19
gi|22995227|ref|ZP_00039707.1| COG3590: Predicted metalloendopep...    98   6e-19
gi|29349219|ref|NP_812722.1| putative endothelin-converting enzy...    98   8e-19
gi|28199449|ref|NP_779763.1| metallopeptidase [Xylella fastidios...    98   8e-19
gi|15837178|ref|NP_297866.1| metallopeptidase [Xylella fastidios...    98   8e-19
gi|22996373|ref|ZP_00040631.1| COG3590: Predicted metalloendopep...    97   1e-18
gi|21231483|ref|NP_637400.1| metallopeptidase [Xanthomonas campe...    96   2e-18
gi|34577159|gb|AAQ75757.1| zinc metallopeptidase 7 [Ancylostoma ...    96   4e-18
gi|14211538|ref|NP_115929.1| Kell blood group; Kell protein [Mus...    95   5e-18
gi|46190979|ref|ZP_00120790.2| COG3590: Predicted metalloendopep...    95   7e-18
gi|50365057|ref|YP_053482.1| putative membrane metallo endopepti...    95   7e-18
gi|25026708|ref|NP_736762.1| putative endopeptidase [Corynebacte...    95   7e-18
gi|21243472|ref|NP_643054.1| metallopeptidase [Xanthomonas axono...    95   7e-18
gi|21232005|ref|NP_637922.1| metallopeptidase [Xanthomonas campe...    94   9e-18
gi|50752341|ref|XP_422744.1| PREDICTED: similar to Damage-induce...    94   9e-18
gi|39583155|emb|CAE60695.1| Hypothetical protein CBG04354 [Caeno...    93   2e-17
gi|19551404|ref|NP_599406.1| predicted metalloendopeptidase [Cor...    93   2e-17
gi|21322918|dbj|BAB97547.1| Predicted metalloendopeptidase [Cory...    93   2e-17
gi|50590145|ref|ZP_00331565.1| COG3590: Predicted metalloendopep...    93   3e-17
gi|28493736|ref|NP_787897.1| metalloendopeptidase [Tropheryma wh...    92   3e-17
gi|28572922|ref|NP_789702.1| putative peptidase [Tropheryma whip...    92   3e-17
gi|23466275|ref|NP_696878.1| belongs to peptidase family M13 [Bi...    92   6e-17
gi|38232779|ref|NP_938546.1| Putative endopeptidase [Corynebacte...    91   1e-16
gi|34499760|ref|NP_903975.1| probable metallopeptidase [Chromoba...    91   1e-16
gi|13518042|gb|AAG29103.2| zinc metallopeptidase 1 [Ancylostoma ...    91   1e-16
gi|24372024|ref|NP_716066.1| peptidase, M13 family [Shewanella o...    90   2e-16
gi|21243599|ref|NP_643181.1| metallopeptidase [Xanthomonas axono...    90   2e-16
gi|23121016|ref|ZP_00103455.1| COG3590: Predicted metalloendopep...    89   3e-16
gi|31195785|ref|XP_306840.1| ENSANGP00000000184 [Anopheles gambi...    89   5e-16
gi|42524899|ref|NP_970279.1| metallopeptidase [Bdellovibrio bact...    88   6e-16
gi|2905790|gb|AAC03561.1| putative zinc metallopeptidase precurs...    87   1e-15
gi|1483338|emb|CAA99352.1| zinc metallopeptidase [Haemonchus con...    87   1e-15
gi|24650889|ref|NP_651645.1| CG14527-PA [Drosophila melanogaster...    87   1e-15
gi|21232141|ref|NP_638058.1| metallopeptidase [Xanthomonas campe...    86   2e-15
gi|50769088|ref|XP_427021.1| PREDICTED: similar to Endothelin-co...    86   2e-15
gi|34540021|ref|NP_904500.1| endopeptidase PepO [Porphyromonas g...    86   3e-15
gi|5139244|gb|AAD40473.1| endopeptidase O [Streptococcus parasan...    86   3e-15
gi|38109062|gb|EAA54986.1| hypothetical protein MG06643.4 [Magna...    86   3e-15
gi|30794584|gb|AAP40519.1| Hypothetical protein T25B6.2b [Caenor...    86   4e-15
gi|17570047|ref|NP_509528.1| neprilysin (88.5 kD) (XJ655) [Caeno...    86   4e-15
gi|39588059|emb|CAE57291.1| Hypothetical protein CBG00200 [Caeno...    85   5e-15
gi|2804580|dbj|BAA24495.1| PepO [Porphyromonas gingivalis]             85   5e-15
gi|23003524|ref|ZP_00047184.1| COG3590: Predicted metalloendopep...    85   5e-15
gi|48096703|ref|XP_392502.1| similar to ENSANGP00000015756 [Apis...    85   7e-15
gi|50260040|gb|EAL22703.1| hypothetical protein CNBB1520 [Crypto...    84   1e-14
gi|16127734|ref|NP_422298.1| peptidase M13 family protein [Caulo...    84   1e-14
gi|1381816|gb|AAC50552.1| metalloendopeptidase homolog [Homo sap...    83   2e-14
gi|16768064|gb|AAL28251.1| GH14576p [Drosophila melanogaster]          83   2e-14
gi|50729479|ref|XP_416529.1| PREDICTED: similar to Kell protein ...    82   4e-14
gi|1815789|gb|AAB42219.1| phosphate regulator [Homo sapiens]           82   4e-14
gi|24650883|ref|NP_651641.1| CG14529-PA [Drosophila melanogaster...    82   5e-14
gi|11061678|emb|CAC14579.1| oligopeptidase [Streptococcus thermo...    82   5e-14
gi|34855598|ref|XP_216130.2| similar to Kell protein [Rattus nor...    82   5e-14
gi|21410887|gb|AAH30900.1| Ece2 protein [Mus musculus]                 79   3e-13
gi|33151441|ref|NP_872794.1| metallopeptidase [Haemophilus ducre...    79   3e-13
gi|42519194|ref|NP_965124.1| neutral endopeptidase [Lactobacillu...    79   5e-13
gi|18478358|gb|AAL73136.1| endopeptidase O2 [Lactobacillus helve...    79   5e-13
gi|26327749|dbj|BAC27618.1| unnamed protein product [Mus musculus]     79   5e-13
gi|34451897|gb|AAQ72429.1| endopeptidase O3 [Lactobacillus helve...    78   7e-13
gi|47574014|ref|ZP_00244051.1| COG3590: Predicted metalloendopep...    78   7e-13
gi|16197789|gb|AAL13495.1| GH01974p [Drosophila melanogaster]          77   1e-12
gi|48478126|ref|YP_023832.1| zinc metalloprotease [Picrophilus t...    76   3e-12
gi|23118255|ref|ZP_00101884.1| COG3590: Predicted metalloendopep...    76   3e-12
gi|24649148|ref|NP_651098.2| CG4721-PA [Drosophila melanogaster]...    76   3e-12
gi|67702|pir||HYHUK Kell blood group protein (EC 3.4.24.-) - human     75   4e-12
gi|4557691|ref|NP_000411.1| Kell blood group antigen [Homo sapie...    75   4e-12
gi|42518115|ref|NP_964045.1| endopeptidase O [Lactobacillus john...    75   7e-12
gi|8928253|sp|O52071|PEPO_LACHE Neutral endopeptidase (Endopepti...    74   2e-11
gi|19746966|ref|NP_608102.1| putative endopeptidase O [Streptoco...    73   2e-11
gi|1176911|sp|P42359|YSC6_STRGC Hypothetical zinc metalloprotein...    73   3e-11
gi|15675851|ref|NP_270025.1| putative endopeptidase O [Streptoco...    73   3e-11
gi|23002216|ref|ZP_00045894.1| COG3590: Predicted metalloendopep...    72   4e-11
gi|48852283|ref|ZP_00306472.1| COG3590: Predicted metalloendopep...    72   5e-11
gi|15901483|ref|NP_346087.1| endopeptidase O [Streptococcus pneu...    72   5e-11
gi|15903534|ref|NP_359084.1| Endopeptidase O [Streptococcus pneu...    72   5e-11
gi|42561039|ref|NP_975490.1| peptidase [Mycoplasma mycoides subs...    72   5e-11
gi|46143595|ref|ZP_00134915.2| COG3590: Predicted metalloendopep...    70   1e-10
gi|26554324|ref|NP_758258.1| end peptidase [Mycoplasma penetrans...    70   1e-10
gi|24380377|ref|NP_722332.1| putative peptidase [Streptococcus m...    70   2e-10
gi|24650885|ref|NP_651643.1| CG14528-PA [Drosophila melanogaster...    69   3e-10
gi|21429176|gb|AAM50307.1| RE71324p [Drosophila melanogaster]          69   3e-10
gi|24372085|ref|NP_716127.1| peptidase, M13 family [Shewanella o...    69   4e-10
gi|48870186|ref|ZP_00322914.1| COG3590: Predicted metalloendopep...    69   4e-10
gi|18478322|gb|AAL73125.1| neutral endopeptidase-like protein [D...    69   5e-10
gi|48095938|ref|XP_392366.1| similar to PC2-like prohormone conv...    69   5e-10
gi|48826034|ref|ZP_00287262.1| COG3590: Predicted metalloendopep...    68   7e-10
gi|48851549|ref|ZP_00305760.1| COG3590: Predicted metalloendopep...    68   7e-10
gi|48865575|ref|ZP_00319434.1| COG3590: Predicted metalloendopep...    67   1e-09
gi|50591090|ref|ZP_00332418.1| COG3590: Predicted metalloendopep...    66   3e-09
gi|23003272|ref|ZP_00046938.1| COG3590: Predicted metalloendopep...    66   3e-09
gi|24650887|ref|NP_651644.1| CG14523-PA [Drosophila melanogaster...    66   3e-09
gi|48095957|ref|XP_394570.1| similar to zinc metalloprotease [Ap...    66   3e-09
gi|21233100|ref|NP_639017.1| metallopeptidase [Xanthomonas campe...    65   8e-09
gi|24649145|ref|NP_651096.1| CG4725-PA [Drosophila melanogaster]...    64   1e-08
gi|50727065|gb|AAT81204.1| Hypothetical protein F02E11.6 [Caenor...    63   3e-08
gi|11093966|gb|AAG29510.1| zinc metallopeptidase 4 [Ancylostoma ...    62   5e-08
gi|42518233|ref|NP_964163.1| endopeptidase O [Lactobacillus john...    62   5e-08
gi|45550139|ref|NP_609023.2| CG9508-PA [Drosophila melanogaster]...    62   6e-08
gi|22538028|ref|NP_688879.1| endopeptidase O [Streptococcus agal...    62   6e-08
gi|23023925|ref|ZP_00063153.1| COG3590: Predicted metalloendopep...    61   8e-08
gi|42561222|ref|NP_975673.1| endopeptidase O [Mycoplasma mycoide...    61   8e-08
gi|39583153|emb|CAE60693.1| Hypothetical protein CBG04350 [Caeno...    61   8e-08
gi|48837843|ref|ZP_00294800.1| COG3590: Predicted metalloendopep...    61   8e-08
gi|17861942|gb|AAL39448.1| HL07928p [Drosophila melanogaster]          61   1e-07
gi|4138018|emb|CAA76114.1| metallopeptidase [Rattus norvegicus]        59   5e-07
gi|17533819|ref|NP_494503.1| neprilysin family member (2D600) [C...    58   7e-07
gi|28379770|ref|NP_786662.1| endopeptidase PepO [Lactobacillus p...    58   9e-07
gi|26348415|dbj|BAC37847.1| unnamed protein product [Mus musculus]     57   1e-06
gi|21244437|ref|NP_644019.1| metallopeptidase [Xanthomonas axono...    56   4e-06
gi|7711154|gb|AAF67832.1| endopeptidase PepO2 [Lactococcus lactis]     56   4e-06
gi|21232007|ref|NP_637924.1| metallopeptidase [Xanthomonas campe...    54   1e-05
gi|21243474|ref|NP_643056.1| metallopeptidase [Xanthomonas axono...    54   1e-05
gi|4469350|gb|AAD21221.1| endothelin converting enzyme-1 [Homo s...    54   1e-05
gi|48837504|ref|ZP_00294491.1| COG3590: Predicted metalloendopep...    54   1e-05
gi|21355691|ref|NP_651097.1| CG4723-PA [Drosophila melanogaster]...    54   2e-05
gi|39586767|emb|CAE65809.1| Hypothetical protein CBG10917 [Caeno...    53   2e-05
gi|25009790|gb|AAN71067.1| AT14086p [Drosophila melanogaster]          52   4e-05
gi|15010472|gb|AAK77284.1| GH06227p [Drosophila melanogaster]          52   5e-05
gi|15673785|ref|NP_267960.1| neutral endopeptidase [Lactococcus ...    52   5e-05
gi|24641622|ref|NP_572831.2| CG3775-PA [Drosophila melanogaster]...    52   5e-05
gi|1075745|pir||F53290 endopeptidase PepO (EC 3.4.-.-) - Lactoco...    52   7e-05
gi|11093960|gb|AAG29507.1| zinc metallopeptidase 5 [Ancylostoma ...    52   7e-05
gi|1172065|sp|Q09145|PEPO_LACLC Neutral endopeptidase (Endopepti...    50   1e-04
gi|39596889|emb|CAE59116.1| Hypothetical protein CBG02411 [Caeno...    50   3e-04
gi|48097550|ref|XP_393810.1| similar to endothelin-converting (2...    49   3e-04
gi|11093962|gb|AAG29508.1| zinc metallopeptidase 2 [Ancylostoma ...    49   4e-04
gi|24639874|ref|NP_726999.1| CG3239-PB [Drosophila melanogaster]...    48   0.001
gi|18858121|ref|NP_572226.1| CG3239-PA [Drosophila melanogaster]...    48   0.001
gi|7503468|pir||T25758 hypothetical protein F45E4.7 - Caenorhabd...    47   0.002
gi|20129275|ref|NP_609022.1| CG9507-PA [Drosophila melanogaster]...    47   0.002
gi|17533125|ref|NP_495044.1| endothelin-converting enzyme (2F779...    47   0.002
gi|11078659|gb|AAG29137.1| zinc metallopeptidase 1 MEP1 [Ancylos...    46   0.003
gi|24650489|ref|NP_651527.2| CG6265-PA [Drosophila melanogaster]...    46   0.003
gi|3388169|gb|AAC28740.1| putative zinc metallopeptidase [Haemon...    46   0.003
gi|17540454|ref|NP_501243.1| putative protein family member of a...    44   0.011
gi|33621008|gb|AAO91717.2| Hypothetical protein F45E4.7a [Caenor...    44   0.011
gi|29570472|gb|AAO91719.1| Hypothetical protein F45E4.7c [Caenor...    44   0.011
gi|50729477|ref|XP_416528.1| PREDICTED: similar to Kell protein,...    43   0.024
gi|11093964|gb|AAG29509.1| zinc metallopeptidase 3 [Ancylostoma ...    43   0.031
gi|33621046|gb|AAC71099.2| Hypothetical protein ZK1248.1 [Caenor...    42   0.053
gi|17538075|ref|NP_495164.1| endothelin-converting enzyme 1 fami...    42   0.053
gi|39588061|emb|CAE57293.1| Hypothetical protein CBG00202 [Caeno...    42   0.053
gi|39596980|emb|CAE59207.1| Hypothetical protein CBG02520 [Caeno...    41   0.091
gi|34855600|ref|XP_342675.1| similar to Kell protein [Rattus nor...    41   0.12
gi|5419657|emb|CAB46443.1| human endothelin-converting enzyme-1 ...    40   0.15
gi|48140708|ref|XP_397145.1| similar to neprilysin (EC 3.4.24.11...    40   0.20
gi|20129271|ref|NP_609019.1| CG9505-PA [Drosophila melanogaster]...    40   0.26
gi|37700459|gb|AAR00249.1| endothelin converting enzyme [Oryctol...    39   0.34
gi|16183012|gb|AAL13611.1| GH14621p [Drosophila melanogaster]          39   0.34
gi|8468621|gb|AAF75554.1| mature parasite-infected erythrocyte s...    39   0.34
gi|47221586|emb|CAF97851.1| unnamed protein product [Tetraodon n...    39   0.45
gi|34365986|gb|AAC48280.2| Hypothetical protein C53B7.7 [Caenorh...    39   0.45
gi|17551138|ref|NP_509156.1| metallopeptidase family member (XH4...    39   0.45
gi|29292533|dbj|BAC66225.1| endotheline-converting enzyme ECEL1 ...    39   0.59
gi|17861536|gb|AAL39245.1| GH11680p [Drosophila melanogaster]          39   0.59
gi|15222868|ref|NP_172810.1| expressed protein [Arabidopsis thal...    38   0.77
gi|18859667|ref|NP_573160.1| CG9634-PA [Drosophila melanogaster]...    38   0.77
gi|25372745|pir||D86268 F13B4.3 protein - Arabidopsis thaliana >...    38   0.77
gi|39586603|emb|CAE69323.1| Hypothetical protein CBG15395 [Caeno...    38   1.0
gi|39586763|emb|CAE65805.1| Hypothetical protein CBG10913 [Caeno...    37   1.3
gi|39583817|emb|CAE74890.1| Hypothetical protein CBG22755 [Caeno...    37   1.7
gi|28573261|ref|NP_788572.1| CG9780-PB [Drosophila melanogaster]...    37   1.7
gi|21356037|ref|NP_649449.1| CG9780-PA [Drosophila melanogaster]...    37   1.7
gi|46365946|ref|ZP_00228366.1| COG0296: 1,4-alpha-glucan branchi...    37   2.2
gi|24584742|ref|NP_609815.1| CG13283-PA [Drosophila melanogaster...    37   2.2
gi|50730182|ref|XP_416801.1| PREDICTED: similar to Phosphate reg...    37   2.2
gi|1708849|sp|P52922|LKHA_DICDI Leukotriene A-4 hydrolase (LTA-4...    36   2.9
gi|25013060|gb|AAN71619.1| RH63753p [Drosophila melanogaster]          36   2.9
gi|23480933|gb|EAA17364.1| hypothetical protein [Plasmodium yoel...    36   2.9
gi|28211502|ref|NP_782446.1| 6-phosphogluconate dehydrogenase, d...    36   3.8
gi|30721676|gb|AAP33687.1| phoshoprotein 300 [Plasmodium falcipa...    35   5.0
gi|23612632|ref|NP_704193.1| ubiquitin carboxyl-terminal hydrola...    35   5.0
gi|50292495|ref|XP_448680.1| unnamed protein product [Candida gl...    35   6.5
gi|33322043|gb|AAQ06740.1| neutral endopeptidase [Lactobacillus ...    35   6.5
gi|5281311|gb|AAD41474.1| putative zinc metallopeptidase; MEP4 [...    35   8.5
gi|31209189|ref|XP_313561.1| ENSANGP00000013331 [Anopheles gambi...    35   8.5
gi|39586761|emb|CAE65803.1| Hypothetical protein CBG10911 [Caeno...    35   8.5


>gi|17533329|ref|NP_494532.1| neutral endopeptidase 24.11 like family
            member (74.7 kD) (2D690) [Caenorhabditis elegans]
 gi|25395467|pir||E88098 protein F18A12.6 [imported] - Caenorhabditis
            elegans
 gi|2315628|gb|AAB66078.1| Hypothetical protein F18A12.6
            [Caenorhabditis elegans]
          Length = 649

 Score = 1290 bits (3338), Expect = 0.0
 Identities = 633/649 (97%), Positives = 633/649 (97%)
 Frame = -1

Query: 1950 MNMKKVKEKLSSPWXXXXXXXXXXXXXXXXVTVHIKMTIDVAPVFKSDDPLPRGDPDQKP 1771
            MNMKKVKEKLSSPW                VTVHIKMTIDVAPVFKSDDPLPRGDPDQKP
Sbjct: 1    MNMKKVKEKLSSPWIAFALNLLLLIVFLALVTVHIKMTIDVAPVFKSDDPLPRGDPDQKP 60

Query: 1770 ATIDSETQTVDEPRNVCESPECITLAHELHNYKDPSVDPCQDFYQHFCGKFYEHSAIGQG 1591
            ATIDSETQTVDEPRNVCESPECITLAHELHNYKDPSVDPCQDFYQHFCGKFYEHSAIGQG
Sbjct: 61   ATIDSETQTVDEPRNVCESPECITLAHELHNYKDPSVDPCQDFYQHFCGKFYEHSAIGQG 120

Query: 1590 RMATKRSTLSKLIREFLLKNKTSTSKSENTMKQVYAKCRELQKISDLNSIPPQALLDIFS 1411
            RMATKRSTLSKLIREFLLKNKTSTSKSENTMKQVYAKCRELQKISDLNSIPPQALLDIFS
Sbjct: 121  RMATKRSTLSKLIREFLLKNKTSTSKSENTMKQVYAKCRELQKISDLNSIPPQALLDIFS 180

Query: 1410 DIKKIGAWPVLDKDWDGSKFNLNEMLRQLVNLGETHLGFFHFDFIARPYVLIKPPLKQGV 1231
            DIKKIGAWPVLDKDWDGSKFNLNEMLRQLVNLGETHLGFFHFDFIARPYVLIKPPLKQGV
Sbjct: 181  DIKKIGAWPVLDKDWDGSKFNLNEMLRQLVNLGETHLGFFHFDFIARPYVLIKPPLKQGV 240

Query: 1230 QKSVLEKVVKMILEANEIKMDQGFSEDLDEYFELSNRIKILDTIIRSTSNRALANYLIFN 1051
            QKSVLEKVVKMILEANEIKMDQGFSEDLDEYFELSNRIKILDTIIRSTSNRALANYLIFN
Sbjct: 241  QKSVLEKVVKMILEANEIKMDQGFSEDLDEYFELSNRIKILDTIIRSTSNRALANYLIFN 300

Query: 1050 FIHSSIKFLTFGLKSDRERCEKIVVQELPRPSLRVFMRNCVDKGNREEVAKLTETVKENV 871
            FIHSSIKFLTFGLKSDRERCEKIVVQELPRPSLRVFMRNCVDKGNREEVAKLTETVKENV
Sbjct: 301  FIHSSIKFLTFGLKSDRERCEKIVVQELPRPSLRVFMRNCVDKGNREEVAKLTETVKENV 360

Query: 870  LEMIRESDSFTPSVKKRVLKKVEAIGAIIGYPDHFDPPGTLDKEYENLTLDASDSYYKMS 691
            LEMIRESDSFTPSVKKRVLKKVEAIGAIIGYPDHFDPPGTLDKEYENLTLDASDSYYKMS
Sbjct: 361  LEMIRESDSFTPSVKKRVLKKVEAIGAIIGYPDHFDPPGTLDKEYENLTLDASDSYYKMS 420

Query: 690  QKLHQLRLQHQMEFLAGQTPLSPSDQVLEVNAHYDSKDNALTVLAPFLDDPFFDSTYPEY 511
            QKLHQLRLQHQMEFLAGQTPLSPSDQVLEVNAHYDSKDNALTVLAPFLDDPFFDSTYPEY
Sbjct: 421  QKLHQLRLQHQMEFLAGQTPLSPSDQVLEVNAHYDSKDNALTVLAPFLDDPFFDSTYPEY 480

Query: 510  VNLIFTGFLIGHEFGHSIDPKILRRDGWYKTEDMTEYGKRAQCLIDQYDNYDDPDHGKQM 331
            VNLIFTGFLIGHEFGHSIDPKILRRDGWYKTEDMTEYGKRAQCLIDQYDNYDDPDHGKQM
Sbjct: 481  VNLIFTGFLIGHEFGHSIDPKILRRDGWYKTEDMTEYGKRAQCLIDQYDNYDDPDHGKQM 540

Query: 330  NGTYCIGEIVGDWVGRDVTWRAFKKMDLSKMQKLIGFEDKNLDQLYFRIQSLFFCGPRSM 151
            NGTYCIGEIVGDWVGRDVTWRAFKKMDLSKMQKLIGFEDKNLDQLYFRIQSLFFCGPRSM
Sbjct: 541  NGTYCIGEIVGDWVGRDVTWRAFKKMDLSKMQKLIGFEDKNLDQLYFRIQSLFFCGPRSM 600

Query: 150  KSLEQLLSDPHPTEVFRVNGIYSNMPQFAKAFNCPIGSPMNPEKKCKMF 4
            KSLEQLLSDPHPTEVFRVNGIYSNMPQFAKAFNCPIGSPMNPEKKCKMF
Sbjct: 601  KSLEQLLSDPHPTEVFRVNGIYSNMPQFAKAFNCPIGSPMNPEKKCKMF 649




[DB home][top]