Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F19H8_1
(526 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531459|ref|NP_497034.1| ATPase (2O883) [Caenorhabditis eleg... 364 e-100
gi|39587568|emb|CAE58506.1| Hypothetical protein CBG01656 [Caeno... 340 1e-92
gi|39593193|emb|CAE64662.1| Hypothetical protein CBG09434 [Caeno... 179 3e-44
gi|17559224|ref|NP_506269.1| EATing: abnormal pharyngeal pumping... 178 4e-44
gi|604515|gb|AAB02615.1| Na,K-ATPase alpha subunit 178 4e-44
gi|114385|sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATP... 178 4e-44
gi|48095913|ref|XP_392363.1| similar to sodium pump alpha subuni... 176 3e-43
gi|20377497|gb|AAM20793.1| Na,K-ATPase alpha-4 subunit [Homo sap... 175 4e-43
gi|33324437|gb|AAQ07964.1| ATPase Na+/K+ transporting alpha 4 [H... 175 4e-43
gi|23428511|gb|AAL18002.1| sodium/potassium ATPase alpha subunit... 175 4e-43
gi|23830899|sp|Q13733|A1A4_HUMAN Sodium/potassium-transporting A... 175 4e-43
gi|37577153|ref|NP_653300.1| Na+/K+ -ATPase alpha 4 subunit isof... 175 4e-43
gi|24648576|ref|NP_732572.1| CG5670-PA [Drosophila melanogaster]... 174 6e-43
gi|2944333|gb|AAC05260.1| Na+/K+ ATPase alpha subunit [Drosophil... 174 6e-43
gi|45553435|ref|NP_996247.1| CG5670-PH [Drosophila melanogaster]... 174 6e-43
gi|45553437|ref|NP_996248.1| CG5670-PG [Drosophila melanogaster]... 174 6e-43
gi|24648578|ref|NP_732573.1| CG5670-PB [Drosophila melanogaster]... 174 6e-43
gi|732656|emb|CAA32638.1| unnamed protein product [Drosophila me... 174 6e-43
gi|85070|pir||S03632 Na+/K+-exchanging ATPase (EC 3.6.3.9) alpha... 174 6e-43
gi|18203649|sp|Q9YH26|A1A1_OREMO Sodium/potassium-transporting A... 174 8e-43
gi|1079184|pir||A56594 Na+/K+-exchanging ATPase (EC 3.6.3.9) alp... 173 1e-42
gi|34812025|gb|AAQ82789.1| Na/K ATPase alpha subunit isoform 1b ... 172 3e-42
gi|23380400|gb|AAN17736.1| putative Na+/K+-ATPase alpha subunit ... 172 3e-42
gi|47209218|emb|CAF93092.1| unnamed protein product [Tetraodon n... 172 4e-42
gi|47207614|emb|CAF95281.1| unnamed protein product [Tetraodon n... 172 4e-42
gi|13487791|gb|AAK27722.1| sodium/potassium pump alpha subunit [... 171 5e-42
gi|2493013|sp|Q92030|A1A1_ANGAN Sodium/potassium-transporting AT... 170 1e-41
gi|28566430|gb|AAO42613.1| Na+,K+ ATPase alpha 1 subunit [Anas p... 170 1e-41
gi|18858301|ref|NP_571764.1| ATPase, Na+/K+ transporting, alpha ... 170 1e-41
gi|11067034|gb|AAG27060.1| Na+/K+ ATPase alpha subunit isoform 8... 170 1e-41
gi|12044396|gb|AAG47843.1| Na+/K+ ATPase alpha subunit [Callinec... 170 2e-41
gi|28277456|gb|AAH45283.1| ATPase, Na+/K+ transporting, alpha 1a... 169 3e-41
gi|18858295|ref|NP_571761.1| ATPase, Na+/K+ transporting, alpha ... 169 3e-41
gi|31206211|ref|XP_312057.1| ENSANGP00000016876 [Anopheles gambi... 169 3e-41
gi|31206213|ref|XP_312058.1| ENSANGP00000022526 [Anopheles gambi... 169 3e-41
gi|31206209|ref|XP_312056.1| ENSANGP00000024378 [Anopheles gambi... 169 3e-41
gi|23428513|gb|AAL18003.1| sodium/potassium ATPase alpha subunit... 169 3e-41
gi|5457150|gb|AAD43813.1| Na,K-ATPase alpha-4 subunit [Mus muscu... 168 4e-41
gi|18203577|sp|Q9WV27|A1A4_MOUSE Sodium/potassium-transporting A... 168 4e-41
gi|38074109|ref|XP_355283.1| similar to Sodium/potassium-transpo... 168 4e-41
gi|49249977|ref|NP_001001734.1| Na+/K+ -ATPase alpha 4 subunit i... 168 6e-41
gi|114386|sp|P25489|A1A1_CATCO Sodium/potassium-transporting ATP... 168 6e-41
gi|20521652|dbj|BAA34498.2| KIAA0778 protein [Homo sapiens] 167 8e-41
gi|114388|sp|P05025|AT1A_TORCA Sodium/potassium-transporting ATP... 167 8e-41
gi|34812023|gb|AAQ82788.1| Na/K ATPase alpha subunit isoform 1c ... 167 8e-41
gi|4502271|ref|NP_000693.1| Na+/K+ -ATPase alpha 2 subunit propr... 167 8e-41
gi|34812019|gb|AAQ82786.1| Na/K ATPase alpha subunit isoform 2 [... 167 1e-40
gi|18858305|ref|NP_571758.1| ATPase, Na+/K+ transporting, alpha ... 167 1e-40
gi|16197630|gb|AAK33032.1| Na+/K+ ATPase alpha2 subunit [Danio r... 167 1e-40
gi|205632|gb|AAA41671.1| Na,K-ATPase alpha-1 subunit 167 1e-40
gi|6978543|ref|NP_036636.1| ATPase, Na+K+ transporting, alpha 1;... 167 1e-40
gi|6978545|ref|NP_036637.1| ATPase, Na+K+ transporting, alpha 2;... 167 1e-40
gi|15488862|gb|AAH13561.1| Unknown (protein for IMAGE:3492058) [... 167 1e-40
gi|27697104|gb|AAH41774.1| Atp1a2 protein [Mus musculus] 167 1e-40
gi|19387955|gb|AAH25807.1| Atp1a2 protein [Mus musculus] 167 1e-40
gi|20810136|gb|AAH29190.1| Unknown (protein for IMAGE:3709516) [... 166 2e-40
gi|18858303|ref|NP_571765.1| ATPase, Na+/K+ transporting, alpha ... 166 2e-40
gi|16307541|gb|AAH10319.1| Atp1a1 protein [Mus musculus] 166 2e-40
gi|21450277|ref|NP_659149.1| Na+/K+ -ATPase alpha 1 subunit [Mus... 166 2e-40
gi|19263746|gb|AAH25037.1| Atp1a1 protein [Mus musculus] 166 2e-40
gi|20988462|gb|AAH30326.1| Atp1a1 protein [Mus musculus] 166 2e-40
gi|114377|sp|P04074|A1A1_SHEEP Sodium/potassium-transporting ATP... 166 2e-40
gi|15824396|gb|AAL09322.1| SNaK1 [Schistosoma mansoni] 166 2e-40
gi|18858299|ref|NP_571763.1| ATPase, Na+/K+ transporting, alpha ... 166 2e-40
gi|32493317|gb|AAH54591.1| Atp1a1a.3 protein [Danio rerio] 166 2e-40
gi|1364218|emb|CAA26582.1| unnamed protein product [Ovis aries] 166 2e-40
gi|45382945|ref|NP_990852.1| (Na+ + K+)-ATPase [Gallus gallus] >... 166 3e-40
gi|12408294|ref|NP_074039.1| Na+/K+ -ATPase alpha 4 subunit [Rat... 166 3e-40
gi|47221725|emb|CAG10197.1| unnamed protein product [Tetraodon n... 165 5e-40
gi|45382691|ref|NP_990807.1| Na,K-ATPase alpha-2-subunit [Gallus... 164 6e-40
gi|227450|prf||1704129A Na/K ATPase alpha2 164 6e-40
gi|47523570|ref|NP_999414.1| (Na+, K+)-ATPase alpha-subunit [Sus... 164 6e-40
gi|20073360|gb|AAH27000.1| Atp1a3 protein [Mus musculus] 164 8e-40
gi|22748667|ref|NP_689509.1| Na+/K+ -ATPase alpha 3 subunit; sod... 164 8e-40
gi|19855078|sp|P06687|A1A3_RAT Sodium/potassium-transporting ATP... 164 8e-40
gi|88221|pir||S00801 Na+/K+-exchanging ATPase (EC 3.6.3.9) alpha... 164 8e-40
gi|29839750|sp|P13637|A1A3_HUMAN Sodium/potassium-transporting A... 164 8e-40
gi|1703466|sp|P50997|A1A1_CANFA Sodium/potassium-transporting AT... 164 8e-40
gi|28277361|gb|AAH44670.1| MGC53886 protein [Xenopus laevis] >gn... 164 8e-40
gi|20071904|gb|AAH27114.1| Atp1a3 protein [Mus musculus] 164 8e-40
gi|26251984|gb|AAH40512.1| Atp1a3 protein [Mus musculus] 164 8e-40
gi|358960|prf||1309271B ATPase alpha2,Na/K 164 8e-40
gi|35188002|gb|AAF60310.2| Na/K ATPase alpha 1 subunit [Oryctola... 164 1e-39
gi|45382681|ref|NP_990806.1| Na,K-ATPase alpha-3-subunit [Gallus... 164 1e-39
gi|179227|gb|AAA52286.1| Na+, K+ activated adenosine triphosphat... 163 1e-39
gi|88214|pir||A26641 Na+/K+-exchanging ATPase (EC 3.6.3.9) alpha... 163 1e-39
gi|358959|prf||1309271A ATPase alpha1,Na/K 163 1e-39
gi|1359715|emb|CAA31390.1| Na+,K+ ATPase [Homo sapiens] 163 1e-39
gi|12654965|gb|AAH01330.1| Unknown (protein for IMAGE:3457513) [... 163 1e-39
gi|164382|gb|AAA31002.1| Na+, K+-ATPase beta-subunit precursor 163 1e-39
gi|225173|prf||1210234A ATPase alpha,Na/K 163 1e-39
gi|21361181|ref|NP_000692.2| Na+/K+ -ATPase alpha 1 subunit isof... 163 1e-39
gi|104285|pir||S24650 Na+/K+-exchanging ATPase (EC 3.6.3.9) alph... 163 1e-39
gi|30923213|sp|P30714|A1A1_BUFMA Sodium/potassium-transporting A... 163 1e-39
gi|48735027|gb|AAH72077.1| Atp1a1a.1 protein [Xenopus laevis] 163 2e-39
gi|18202616|sp|Q92123|A1A1_XENLA Sodium/potassium-transporting A... 163 2e-39
gi|226444|prf||1513185A Na/K ATPase alpha 163 2e-39
gi|47208840|emb|CAF95488.1| unnamed protein product [Tetraodon n... 163 2e-39
gi|114373|sp|P18907|A1A1_HORSE Sodium/potassium-transporting ATP... 163 2e-39
gi|1228150|gb|AAC59759.1| adenosine triphosphatase, sodium-potas... 163 2e-39
gi|45361667|ref|NP_989407.1| hypothetical protein MGC76277 [Xeno... 163 2e-39
gi|497763|gb|AAA51798.1| Na+, K+ -ATPase catalytic subunit 162 2e-39
gi|18858297|ref|NP_571762.1| ATPase, Na+/K+ transporting, alpha ... 162 3e-39
gi|27694612|gb|AAH43743.1| Atp1a3-prov protein [Xenopus laevis] 162 4e-39
gi|34812027|gb|AAQ82790.1| Na/K ATPase alpha subunit isoform 1a ... 161 7e-39
gi|18858309|ref|NP_571760.1| ATPase, Na+/K+ transporting, alpha ... 160 9e-39
gi|37805389|gb|AAH60332.1| MGC68460 protein [Xenopus laevis] 160 9e-39
gi|14349292|dbj|BAB60722.1| Na,K-ATPase alpha subunit 3 [Carassi... 160 1e-38
gi|6978547|ref|NP_036638.1| Na+/K+ -ATPase alpha 3 subunit; ATPa... 160 2e-38
gi|461547|sp|P35317|AT1A_HYDAT Sodium/potassium-transporting ATP... 160 2e-38
gi|41282137|ref|NP_571759.2| ATPase, Na+/K+ transporting, alpha ... 159 2e-38
gi|34812021|gb|AAQ82787.1| Na/K ATPase alpha subunit isoform 3 [... 159 2e-38
gi|18202326|sp|P58312|A1A3_OREMO Sodium/potassium-transporting A... 159 4e-38
gi|11096277|gb|AAG30275.1| Na+/K+ ATPase alpha subunit isoform 5... 157 1e-37
gi|3551199|dbj|BAA32798.1| Na+/K+-ATPase alpha-subunit [Dugesia ... 156 2e-37
gi|45360118|gb|AAS59168.1| Na+/K+-ATPase alpha subunit [Taenia s... 156 2e-37
gi|30017425|ref|NP_835200.1| ATPase, Na+/K+ transporting, alpha ... 155 4e-37
gi|48095242|ref|XP_394389.1| similar to sodium pump alpha subuni... 155 5e-37
gi|114384|sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATP... 155 5e-37
gi|37360088|dbj|BAC98022.1| mKIAA0778 protein [Mus musculus] 154 7e-37
gi|24638486|ref|NP_652153.2| CG17923-PA [Drosophila melanogaster... 153 2e-36
gi|6573196|gb|AAF17586.1| Na/K-ATPase alpha subunit isoform 2 [D... 153 2e-36
gi|21450321|ref|NP_659170.1| Na+/K+ -ATPase alpha 3 subunit [Mus... 152 4e-36
gi|47221539|emb|CAF97804.1| unnamed protein product [Tetraodon n... 149 4e-35
gi|225191|prf||1211231A ATPase alpha C term,Na/K 141 8e-33
gi|21758011|dbj|BAC05228.1| unnamed protein product [Homo sapiens] 140 1e-32
gi|5921653|gb|AAD56285.1| H+/K+-ATPase alpha subunit [Pseudopleu... 139 2e-32
gi|1096610|prf||2112199A H/K ATPase:SUBUNIT=alpha 139 3e-32
gi|20137386|sp|Q92126|ATHA_XENLA Potassium-transporting ATPase a... 139 3e-32
gi|31322952|gb|AAP35241.1| putative H+/K+-ATPase isoform alpha 1... 135 4e-31
gi|47206013|emb|CAF91532.1| unnamed protein product [Tetraodon n... 135 4e-31
gi|33318311|gb|AAQ05026.1| Na+K+ATPase alpha 4 [Scophthalmus max... 134 7e-31
gi|27924347|gb|AAH45045.1| MGC53249 protein [Xenopus laevis] 134 9e-31
gi|47523652|ref|NP_999456.1| (H+ + K+)-ATPase [Sus scrofa] >gnl|... 133 2e-30
gi|2282014|gb|AAB64182.1| ATHA_HUMAN (partial) [Homo sapiens] 131 6e-30
gi|4502291|ref|NP_000695.1| ATPase, H+/K+ exchanging, alpha poly... 131 6e-30
gi|1905895|gb|AAB50172.1| human gastric H,K-ATPase catalytic sub... 131 6e-30
gi|29165659|gb|AAH49176.1| Atp12a-prov protein [Xenopus laevis] 131 8e-30
gi|114342|sp|P27112|ATHA_RABIT Potassium-transporting ATPase alp... 131 8e-30
gi|37700453|gb|AAR00246.1| Na+/K+ ATPase alpha2 subunit [Oryctol... 131 8e-30
gi|20137385|sp|Q92036|ATHL_BUFMA Potassium-transporting ATPase a... 130 1e-29
gi|1703460|sp|P50996|ATHA_CANFA Potassium-transporting ATPase al... 130 1e-29
gi|543066|pir||JN0903 H+/K+-exchanging ATPase (EC 3.6.3.10) alph... 130 1e-29
gi|48374113|emb|CAE11807.1| Na+,K+-adenosine triphosphatase [Str... 130 1e-29
gi|15929663|gb|AAH15262.1| Atp4a protein [Mus musculus] 129 2e-29
gi|12844617|dbj|BAB26432.1| unnamed protein product [Mus musculus] 129 2e-29
gi|48374107|emb|CAC82206.1| Na/K ATPase [Meleagris gallopavo] 129 3e-29
gi|34855711|ref|XP_341835.1| ATPase, H+/K+ transporting, alpha p... 129 3e-29
gi|114343|sp|P09626|ATHA_RAT Potassium-transporting ATPase alpha... 129 3e-29
gi|50760059|ref|XP_417883.1| PREDICTED: similar to H+,K+ -ATPase... 128 7e-29
gi|9055170|ref|NP_061201.1| ATPase, H+/K+ transporting, alpha po... 128 7e-29
gi|1096611|prf||2112199B H/K ATPase:SUBUNIT=alpha 128 7e-29
gi|14330322|emb|CAC41078.1| alpha subunit of sodium potassium AT... 127 9e-29
gi|5915706|sp|Q64392|ATHL_CAVPO Potassium-transporting ATPase al... 127 9e-29
gi|10280618|ref|NP_001667.2| ATPase, H+/K+ transporting, nongast... 125 4e-28
gi|21618764|gb|AAH31609.1| ATP12A protein [Homo sapiens] 125 4e-28
gi|20149728|ref|NP_619593.1| ATPase, H+/K+ transporting, nongast... 125 4e-28
gi|7436346|pir||I38401 ATP-driven ion pump - human >gnl|BL_ORD_I... 125 4e-28
gi|2735428|gb|AAB93902.1| H-K-ATPase alpha 2b subunit [Rattus no... 124 1e-27
gi|19424160|ref|NP_598201.1| ATPase, H+/K+ transporting, nongast... 124 1e-27
gi|33318309|gb|AAQ05025.1| Na+K+ATPase alpha 3 [Scophthalmus max... 123 2e-27
gi|15216033|emb|CAC51421.1| Na+ /K+ ATPase alpha 1 subunit [Sus ... 120 1e-26
gi|20137568|sp|Q9TV52|ATHL_RABIT Potassium-transporting ATPase a... 119 3e-26
gi|2511767|gb|AAB80941.1| H+,K+-ATPase alpha 2a subunit [Oryctol... 119 3e-26
gi|4206771|gb|AAD11800.1| H,K-ATPase alpha2 subunit [Oryctolagus... 119 3e-26
gi|45758470|gb|AAS76541.1| H+,K+-ATPase alpha 2 subunit [Oryctol... 119 3e-26
gi|1049018|gb|AAA92291.1| H+/K+ ATPase 119 3e-26
gi|179212|gb|AAA51803.1| Na+ K+ ATPase alpha subunit 113 2e-24
gi|205634|gb|AAA41672.1| Na,K-ATPase alpha-2-subunit 107 9e-23
gi|14486420|gb|AAK62046.1| Na+/K+-ATPase alpha subunit [Carcinus... 100 2e-20
gi|48138664|ref|XP_396915.1| similar to sodium pump alpha subuni... 100 2e-20
gi|3719464|gb|AAD03418.1| non-gastric H+/K+-ATPase alpha-chain [... 99 4e-20
gi|24658150|ref|NP_611674.1| CG3701-PA [Drosophila melanogaster]... 95 8e-19
gi|14456618|dbj|BAA82752.2| Na-ATPase [Heterosigma akashiwo] 73 3e-12
gi|20137588|sp|Q9Z1W8|ATHL_MOUSE Potassium-transporting ATPase a... 72 7e-12
gi|46142648|ref|ZP_00149403.2| COG0474: Cation transport ATPase ... 71 1e-11
gi|38108670|gb|EAA54653.1| hypothetical protein MG05445.4 [Magna... 60 2e-08
gi|42108915|emb|CAF25027.1| putative K, P-type ATPase [Magnaport... 60 2e-08
gi|48839673|ref|ZP_00296603.1| COG0474: Cation transport ATPase ... 60 2e-08
gi|20093165|ref|NP_619240.1| sodium/potassium-transporting ATPas... 58 1e-07
gi|46117340|ref|XP_384688.1| hypothetical protein FG04512.1 [Gib... 58 1e-07
gi|50404902|ref|YP_053994.1| Na+\K+ ATPase alpha subunit, putati... 58 1e-07
gi|21227171|ref|NP_633093.1| Cation-transporting ATPase [Methano... 57 2e-07
gi|42108921|emb|CAF25028.1| putative K, P-type ATPase [Magnaport... 55 6e-07
gi|38103119|gb|EAA49863.1| hypothetical protein MG10027.4 [Magna... 55 6e-07
gi|5457152|gb|AAD43814.1| Na,K-ATPase alpha-4 subunit [Mus muscu... 52 6e-06
gi|49081236|ref|XP_404048.1| hypothetical protein UM06433.1 [Ust... 52 8e-06
gi|49077630|ref|XP_402653.1| hypothetical protein UM05038.1 [Ust... 52 8e-06
gi|41629710|emb|CAF22246.1| K, P-type ATPase [Ustilago maydis] 52 8e-06
gi|41629712|emb|CAF22247.1| K, P-type ATPase [Pichia farinosa] 47 2e-04
gi|41725420|ref|ZP_00152178.1| COG0474: Cation transport ATPase ... 45 7e-04
gi|46439977|gb|EAK99288.1| hypothetical protein CaO19.2552 [Cand... 45 7e-04
gi|46440077|gb|EAK99387.1| hypothetical protein CaO19.10084 [Can... 45 0.001
gi|39580994|emb|CAE72475.1| Hypothetical protein CBG19651 [Caeno... 42 0.006
gi|39580749|emb|CAE64135.1| Hypothetical protein CBG08751 [Caeno... 42 0.008
gi|25145458|ref|NP_740940.1| sodium potassium-transporting ATPas... 41 0.011
gi|45548734|ref|ZP_00188764.1| COG0474: Cation transport ATPase ... 38 0.091
gi|29247649|gb|EAA39205.1| GLP_160_40180_44187 [Giardia lamblia ... 38 0.12
gi|1079222|pir||A56809 Na+/K+-exchanging ATPase (EC 3.6.3.9) alp... 37 0.20
gi|7503501|pir||T22251 hypothetical protein F45H11.3 - Caenorhab... 36 0.45
gi|30145815|emb|CAB01710.3| Hypothetical protein F45H11.3 [Caeno... 36 0.45
gi|17507353|ref|NP_492718.1| putative protein (91.4 kD) (1K955) ... 36 0.45
gi|107395|pir||S13028 ion-transporting ATPase (EC 3.6.1.-) ATP1A... 36 0.45
gi|32490911|ref|NP_871165.1| b2257 [Wigglesworthia glossinidia e... 34 1.7
gi|48862918|ref|ZP_00316813.1| COG1033: Predicted exporters of t... 33 2.3
gi|108126|pir||B24303 Na+/K+-exchanging ATPase (EC 3.6.3.9) alph... 33 2.9
gi|15642052|ref|NP_231684.1| cytochrome c-type biogenesis protei... 33 2.9
gi|47215254|emb|CAG01146.1| unnamed protein product [Tetraodon n... 33 3.8
gi|30912811|sp|Q8HL81|CYB_SYNMA Cytochrome b >gnl|BL_ORD_ID|1208... 33 3.8
gi|42490801|gb|AAH66155.1| Carnitine palmitoyltransferase 1, bra... 32 5.0
gi|24211027|ref|NP_710146.1| carnitine palmitoyltransferase 1, b... 32 5.0
gi|23103757|ref|ZP_00090233.1| COG2120: Uncharacterized proteins... 32 5.0
gi|23097923|ref|NP_691389.1| chloramphenicol resistance protein ... 32 5.0
gi|26327919|dbj|BAC27700.1| unnamed protein product [Mus musculus] 32 5.0
gi|45527540|ref|ZP_00178740.1| COG5635: Predicted NTPase (NACHT ... 32 6.6
gi|15239084|ref|NP_196718.1| proton-dependent oligopeptide trans... 32 6.6
gi|11466319|ref|NP_051147.1| NADH dehydrogenase subunit 2 [Cafet... 32 8.6
gi|48839918|ref|ZP_00296847.1| COG1665: Uncharacterized protein ... 32 8.6
gi|12002046|gb|AAG43166.1| brain my050 protein [Homo sapiens] 32 8.6
gi|30425060|ref|NP_780567.1| zinc finger, DHHC domain containing... 27 9.8
gi|21450653|ref|NP_659406.1| zinc finger, DHHC domain containing... 27 9.8
gi|26328697|dbj|BAC28087.1| unnamed protein product [Mus musculus] 27 9.8
>gi|17531459|ref|NP_497034.1| ATPase (2O883) [Caenorhabditis elegans]
gi|7436347|pir||T18833 Na+/K+-exchanging ATPase (EC 3.6.3.9) alpha
chain - Caenorhabditis elegans
gi|3873885|emb|CAB03818.1| Hypothetical protein C01G12.8
[Caenorhabditis elegans]
gi|3876172|emb|CAB07586.1| Hypothetical protein C01G12.8
[Caenorhabditis elegans]
Length = 1049
Score = 364 bits (935), Expect = e-100
Identities = 174/174 (100%), Positives = 174/174 (100%)
Frame = +2
Query: 2 VMFSYMQIGAIQACAGFTTYFVLMMSNGWFPQDLLNISEQWDNKYIDDLEDSYGQQWSYE 181
VMFSYMQIGAIQACAGFTTYFVLMMSNGWFPQDLLNISEQWDNKYIDDLEDSYGQQWSYE
Sbjct: 876 VMFSYMQIGAIQACAGFTTYFVLMMSNGWFPQDLLNISEQWDNKYIDDLEDSYGQQWSYE 935
Query: 182 SRKALESCCYGTFFFTIVVTQWSDLFASKTRKNSLVMQGMENHVLNTSVIFTCFLAIFVL 361
SRKALESCCYGTFFFTIVVTQWSDLFASKTRKNSLVMQGMENHVLNTSVIFTCFLAIFVL
Sbjct: 936 SRKALESCCYGTFFFTIVVTQWSDLFASKTRKNSLVMQGMENHVLNTSVIFTCFLAIFVL 995
Query: 362 NTPFVNEVLGVQGFRLEIGFLALPFAFFIGLYDEVRRYFIRTYPGGYIYKETYY 523
NTPFVNEVLGVQGFRLEIGFLALPFAFFIGLYDEVRRYFIRTYPGGYIYKETYY
Sbjct: 996 NTPFVNEVLGVQGFRLEIGFLALPFAFFIGLYDEVRRYFIRTYPGGYIYKETYY 1049