Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F21F3_3
(888 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17506725|ref|NP_491473.1| carboxyl methyltransferase (33.4 kD... 606 e-172
gi|17508325|ref|NP_491635.1| carboxyl methyltransferase (1G151) ... 441 e-122
gi|39598224|emb|CAE68916.1| Hypothetical protein CBG14895 [Caeno... 414 e-114
gi|21356091|ref|NP_648623.1| CG11268-PA [Drosophila melanogaster... 224 3e-57
gi|48735059|gb|AAH72278.1| LOC397717 protein [Xenopus laevis] 209 9e-53
gi|14548074|sp|O12947|ICMT_XENLA Protein-S-isoprenylcysteine O-m... 209 9e-53
gi|31242813|ref|XP_321837.1| ENSANGP00000009786 [Anopheles gambi... 207 3e-52
gi|50759141|ref|XP_417535.1| PREDICTED: similar to Protein-S iso... 202 1e-50
gi|34872514|ref|XP_342989.1| isoprenylcysteine carboxyl methyltr... 197 3e-49
gi|38079113|ref|XP_131821.2| isoprenylcysteine carboxyl methyltr... 197 3e-49
gi|14548071|sp|Q9WVM4|ICMT_RAT Protein-S-isoprenylcysteine O-met... 196 8e-49
gi|12082483|gb|AAG48552.1| prenylcysteine carboxylmethyltransfer... 195 1e-48
gi|14548084|sp|Q9EQK7|ICMT_MOUSE Protein-S-isoprenylcysteine O-m... 195 1e-48
gi|6912430|ref|NP_036537.1| isoprenylcysteine carboxyl methyltra... 194 2e-48
gi|19849286|gb|AAL99548.1| prenyl cysteine carboxyl methyltransf... 183 4e-45
gi|24797156|ref|NP_733806.1| isoprenylcysteine carboxyl methyltr... 182 7e-45
gi|28828734|gb|AAO51329.1| similar to Dictyostelium discoideum (... 178 2e-43
gi|50287325|ref|XP_446092.1| unnamed protein product [Candida gl... 167 3e-40
gi|50302323|ref|XP_451096.1| unnamed protein product [Kluyveromy... 162 7e-39
gi|6320618|ref|NP_010698.1| farnesyl cysteine-carboxyl methyltra... 160 5e-38
gi|19114175|ref|NP_593263.1| protein-s isoprenylcysteine o-methy... 154 2e-36
gi|38344151|emb|CAE01825.2| OSJNBa0041A02.18 [Oryza sativa (japo... 154 3e-36
gi|32403014|ref|XP_322120.1| hypothetical protein [Neurospora cr... 151 2e-35
gi|47207048|emb|CAF90765.1| unnamed protein product [Tetraodon n... 145 9e-34
gi|18415785|ref|NP_568191.1| isoprenylcysteine carboxyl methyltr... 145 2e-33
gi|49097678|ref|XP_410299.1| hypothetical protein AN6162.2 [Aspe... 143 6e-33
gi|50553748|ref|XP_504285.1| hypothetical protein [Yarrowia lipo... 142 8e-33
gi|49069792|ref|XP_399185.1| hypothetical protein UM01570.1 [Ust... 142 1e-32
gi|15237283|ref|NP_197723.1| isoprenylcysteine carboxyl methyltr... 140 5e-32
gi|29247498|gb|EAA39058.1| GLP_21_31387_32034 [Giardia lamblia A... 139 8e-32
gi|46124623|ref|XP_386865.1| hypothetical protein FG06689.1 [Gib... 137 3e-31
gi|45184946|ref|NP_982664.1| AAR122Cp [Eremothecium gossypii] >g... 133 6e-30
gi|34482036|tpg|DAA01792.1| TPA: prenylcystein carboxymethyl tra... 132 1e-29
gi|38106313|gb|EAA52639.1| hypothetical protein MG05331.4 [Magna... 132 1e-29
gi|24461831|gb|AAN62334.1| prenyl protein specific carboxyl meth... 131 2e-29
gi|50258903|gb|EAL21584.1| hypothetical protein CNBC6220 [Crypto... 127 4e-28
gi|47206117|emb|CAF92713.1| unnamed protein product [Tetraodon n... 120 3e-26
gi|50426365|ref|XP_461779.1| unnamed protein product [Debaryomyc... 116 8e-25
gi|10178276|emb|CAC08334.1| putative protein [Arabidopsis thaliana] 114 4e-24
gi|46435577|gb|EAK94956.1| hypothetical protein CaO19.7766 [Cand... 110 5e-23
gi|46435883|gb|EAK95256.1| hypothetical protein CaO19.119 [Candi... 94 4e-18
gi|50426367|ref|XP_461780.1| unnamed protein product [Debaryomyc... 87 4e-16
gi|46435578|gb|EAK94957.1| hypothetical protein CaO19.7767 [Cand... 84 5e-15
gi|46435884|gb|EAK95257.1| hypothetical protein CaO19.120 [Candi... 83 9e-15
gi|23509050|ref|NP_701718.1| hypothetical protein [Plasmodium fa... 79 1e-13
gi|29840955|gb|AAP05956.1| similar to NM_012405 prenylcysteine c... 77 7e-13
gi|47199336|emb|CAF87737.1| unnamed protein product [Tetraodon n... 62 1e-08
gi|48771564|ref|ZP_00275906.1| COG2020: Putative protein-S-isopr... 59 1e-07
gi|20091522|ref|NP_617597.1| hypothetical protein (multi-domain)... 58 2e-07
gi|46915739|emb|CAG22510.1| hypothetical protein [Photobacterium... 56 9e-07
gi|20089876|ref|NP_615951.1| conserved hypothetical protein [Met... 56 9e-07
gi|45515807|ref|ZP_00167361.1| COG2020: Putative protein-S-isopr... 53 1e-05
gi|46317874|ref|ZP_00218452.1| COG2020: Putative protein-S-isopr... 52 2e-05
gi|45532791|ref|ZP_00183790.1| COG2020: Putative protein-S-isopr... 52 2e-05
gi|17989335|ref|NP_541968.1| farnesyl cysteine carboxyl-methyltr... 51 3e-05
gi|21229585|ref|NP_635502.1| conserved hypothetical protein [Xan... 50 7e-05
gi|21228010|ref|NP_633932.1| hypothetical protein MM1908 [Methan... 49 1e-04
gi|48733704|ref|ZP_00267447.1| COG2020: Putative protein-S-isopr... 49 1e-04
gi|27376329|ref|NP_767858.1| blr1218 [Bradyrhizobium japonicum U... 47 7e-04
gi|24215166|ref|NP_712647.1| Putative protein-S-isoprenylcystein... 46 0.001
gi|19075148|ref|NP_586749.1| hypothetical protein [Encephalitozo... 46 0.001
gi|23481240|gb|EAA17576.1| hypothetical protein [Plasmodium yoel... 45 0.002
gi|50877908|emb|CAG37748.1| unknown protein [Desulfotalea psychr... 45 0.003
gi|15965342|ref|NP_385695.1| HYPOTHETICAL TRANSMEMBRANE PROTEIN ... 45 0.003
gi|17546741|ref|NP_520143.1| PROBABLE TRANSMEMBRANE PROTEIN [Ral... 44 0.004
gi|267468|sp|P29940|YCB7_PSEDE Hypothetical 21.2 kDa protein in ... 44 0.005
gi|11499964|ref|NP_071210.1| conserved hypothetical protein [Arc... 44 0.005
gi|46313198|ref|ZP_00213789.1| COG2020: Putative protein-S-isopr... 44 0.005
gi|39997024|ref|NP_952975.1| conserved hypothetical protein [Geo... 43 0.011
gi|45915236|ref|ZP_00193806.2| COG2020: Putative protein-S-isopr... 43 0.011
gi|23126912|ref|ZP_00108793.1| COG2020: Putative protein-S-isopr... 43 0.011
gi|15603878|ref|NP_246952.1| unknown [Pasteurella multocida Pm70... 43 0.011
gi|48892176|ref|ZP_00325588.1| COG2020: Putative protein-S-isopr... 42 0.018
gi|20091088|ref|NP_617163.1| conserved hypothetical protein [Met... 42 0.018
gi|13471585|ref|NP_103151.1| unknown protein [Mesorhizobium loti... 42 0.018
gi|27379104|ref|NP_770633.1| bll3993 [Bradyrhizobium japonicum U... 42 0.024
gi|31980099|emb|CAD98780.1| hypothetical protein [Sinorhizobium ... 42 0.024
gi|15921450|ref|NP_377119.1| 199aa long conserved hypothetical p... 42 0.024
gi|46128847|ref|ZP_00154359.2| COG2020: Putative protein-S-isopr... 41 0.031
gi|46129757|ref|ZP_00164337.2| COG2020: Putative protein-S-isopr... 41 0.031
gi|20089619|ref|NP_615694.1| conserved hypothetical protein [Met... 41 0.041
gi|32041411|ref|ZP_00138994.1| COG2020: Putative protein-S-isopr... 40 0.053
gi|48863157|ref|ZP_00317051.1| COG2020: Putative protein-S-isopr... 40 0.053
gi|50551095|ref|XP_503021.1| hypothetical protein [Yarrowia lipo... 40 0.053
gi|21242126|ref|NP_641708.1| conserved hypothetical protein [Xan... 40 0.069
gi|41723084|ref|ZP_00150040.1| COG2020: Putative protein-S-isopr... 40 0.069
gi|16332290|ref|NP_443018.1| unknown protein [Synechocystis sp. ... 39 0.12
gi|24378841|ref|NP_720796.1| hypothetical protein [Streptococcus... 39 0.12
gi|27365705|ref|NP_761233.1| Putative protein-S-isoprenylcystein... 39 0.12
gi|37680139|ref|NP_934748.1| putative protein-S-isoprenylcystein... 39 0.12
gi|21230784|ref|NP_636701.1| conserved hypothetical protein [Xan... 39 0.12
gi|21228971|ref|NP_634893.1| hypothetical protein MM2869 [Methan... 39 0.15
gi|50084789|ref|YP_046299.1| conserved hypothetical protein; put... 39 0.20
gi|46319658|ref|ZP_00220060.1| COG2020: Putative protein-S-isopr... 39 0.20
gi|27380852|ref|NP_772381.1| blr5741 [Bradyrhizobium japonicum U... 38 0.34
gi|13471040|ref|NP_102609.1| hypothetical protein mll0909 [Mesor... 38 0.34
gi|39934000|ref|NP_946276.1| conserved hypothetical protein [Rho... 38 0.34
gi|45914710|ref|ZP_00196783.1| COG2020: Putative protein-S-isopr... 38 0.34
gi|17158726|ref|NP_478237.1| unknown protein [Nostoc sp. PCC 712... 38 0.34
gi|45915618|ref|ZP_00194340.2| COG2020: Putative protein-S-isopr... 37 0.45
gi|45917140|ref|ZP_00196282.2| COG2020: Putative protein-S-isopr... 37 0.59
gi|15964215|ref|NP_384568.1| HYPOTHETICAL TRANSMEMBRANE PROTEIN ... 37 0.59
gi|30794210|ref|NP_084454.1| bromodomain and PHD finger containi... 37 0.76
gi|21281961|ref|NP_645047.1| ORFID:MW0232~hypotheticl protein, s... 37 0.76
gi|15923246|ref|NP_370780.1| hypothetical protein SAV0256 [Staph... 37 0.76
gi|12859784|dbj|BAB31777.1| unnamed protein product [Mus musculus] 37 0.76
gi|34858312|ref|XP_342736.1| similar to BRPF1 protein [Rattus no... 37 0.76
gi|21619522|gb|AAH31594.1| Brpf1 protein [Mus musculus] 37 0.76
gi|29830066|ref|NP_824700.1| hypothetical protein SAV3523 [Strep... 37 0.76
gi|13542909|gb|AAH05647.1| Brpf1 protein [Mus musculus] 37 0.76
gi|48850700|ref|ZP_00304942.1| COG3752: Predicted membrane prote... 36 1.00
gi|31753086|gb|AAH53851.1| BRPF1 protein [Homo sapiens] 36 1.00
gi|4757866|ref|NP_004625.1| bromodomain-containing protein; brom... 36 1.00
gi|543063|pir||JC2069 zinc-finger protein, BR140 - human 36 1.00
gi|6630865|gb|AAF19605.1| putative 8-hydroxyguanine DNA glycosyl... 36 1.00
gi|19584408|emb|CAD28495.1| hypothetical protein [Homo sapiens] 36 1.00
gi|32476875|ref|NP_869869.1| similar to protein-S-isoprenylcyste... 36 1.00
gi|15610374|ref|NP_217755.1| hypothetical protein Rv3238c [Mycob... 36 1.3
gi|38100771|gb|EAA47860.1| hypothetical protein MG03103.4 [Magna... 36 1.3
gi|19347912|gb|AAL85978.1| unknown protein [Arabidopsis thaliana] 36 1.3
gi|21593420|gb|AAM65387.1| unknown [Arabidopsis thaliana] 36 1.3
gi|15238431|ref|NP_200758.1| expressed protein [Arabidopsis thal... 36 1.3
gi|50540510|ref|NP_001002720.1| zgc:86649 [Danio rerio] >gnl|BL_... 36 1.3
gi|46192664|ref|ZP_00207373.1| COG2020: Putative protein-S-isopr... 36 1.3
gi|27382124|ref|NP_773653.1| bll7013 [Bradyrhizobium japonicum U... 35 1.7
gi|47570300|ref|ZP_00240948.1| ABC transporter, permease protein... 35 1.7
gi|15923242|ref|NP_370776.1| hypothetical protein SAV0252 [Staph... 35 1.7
gi|34498671|ref|NP_902886.1| conserved hypothetical protein [Chr... 35 1.7
gi|15896653|ref|NP_350002.1| Predicted protein-S-isoprenylcystei... 35 1.7
gi|45358357|ref|NP_987914.1| hypothetical protein MMP0794 [Metha... 35 2.2
gi|14626300|gb|AAK71568.1| putative receptor-associated protein ... 35 2.2
gi|47229213|emb|CAG03965.1| unnamed protein product [Tetraodon n... 35 2.2
gi|46111137|ref|XP_382626.1| hypothetical protein FG02450.1 [Gib... 35 2.9
gi|46319773|ref|ZP_00220172.1| COG0477: Permeases of the major f... 35 2.9
gi|15641212|ref|NP_230844.1| conserved hypothetical protein [Vib... 35 2.9
gi|28898045|ref|NP_797650.1| conserved hypothetical protein [Vib... 35 2.9
gi|27381676|ref|NP_773205.1| blr6565 [Bradyrhizobium japonicum U... 35 2.9
gi|48865885|ref|ZP_00319743.1| COG4485: Predicted membrane prote... 35 2.9
gi|22298063|ref|NP_681310.1| ORF_ID:tll0520~hypothetical protein... 34 3.8
gi|15218701|ref|NP_171806.1| expressed protein [Arabidopsis thal... 34 3.8
gi|21281957|ref|NP_645043.1| ORFID:MW0228~hypothetical protein, ... 34 3.8
gi|49482486|ref|YP_039710.1| putative zinc-binding dehydrogenase... 34 3.8
gi|15965158|ref|NP_385511.1| HYPOTHETICAL TRANSMEMBRANE PROTEIN ... 34 3.8
gi|21674496|ref|NP_662561.1| conserved hypothetical protein [Chl... 34 3.8
gi|46106715|ref|ZP_00187736.2| COG0477: Permeases of the major f... 34 3.8
gi|46580812|ref|YP_011620.1| conserved hypothetical protein [Des... 34 5.0
gi|23478872|gb|EAA15844.1| unnamed protein product, putative [Pl... 34 5.0
gi|23510034|ref|NP_702700.1| hypothetical protein [Plasmodium fa... 34 5.0
gi|16800141|ref|NP_470409.1| similar to glucitol dehydrogenase [... 34 5.0
gi|30023069|ref|NP_834700.1| Sensor protein vanSB [Bacillus cere... 34 5.0
gi|18490748|gb|AAH22664.1| Villp protein [Mus musculus] 34 5.0
gi|15054458|dbj|BAB62315.1| rhamnosidase B [Bacillus sp. GL1] 34 5.0
gi|23016641|ref|ZP_00056395.1| COG2020: Putative protein-S-isopr... 34 5.0
gi|26390015|dbj|BAC25828.1| unnamed protein product [Mus musculus] 34 5.0
gi|15487264|emb|CAC69079.1| villin-like protein [Mus musculus] 34 5.0
gi|48867311|ref|ZP_00320863.1| COG2020: Putative protein-S-isopr... 34 5.0
gi|45525499|ref|ZP_00176731.1| COG2020: Putative protein-S-isopr... 34 5.0
gi|27378608|ref|NP_770137.1| blr3497 [Bradyrhizobium japonicum U... 34 5.0
gi|48856610|ref|ZP_00310767.1| COG1108: ABC-type Mn2+/Zn2+ trans... 34 5.0
gi|15229411|ref|NP_191890.1| expressed protein [Arabidopsis thal... 33 6.5
gi|40645916|dbj|BAD06657.1| NADH dehydrogenese subunit 5 [Luciol... 33 6.5
gi|23502254|ref|NP_698381.1| potassium uptake protein [Brucella ... 33 6.5
gi|17986905|ref|NP_539539.1| KUP SYSTEM POTASSIUM UPTAKE PROTEIN... 33 6.5
gi|16331580|ref|NP_442308.1| Na(+)/H(+) antiporter [Synechocysti... 33 6.5
gi|15672564|ref|NP_266738.1| hypothetical protein L176238 [Lacto... 33 6.5
gi|13937298|gb|AAK50129.1| unknown protein [Oryza sativa] 33 6.5
gi|46907312|ref|YP_013701.1| alcohol dehydrogenase, zinc-depende... 33 8.5
gi|47091883|ref|ZP_00229677.1| alcohol dehydrogenase, zinc-depen... 33 8.5
gi|44889976|emb|CAF32094.1| hypothetical protein [Aspergillus fu... 33 8.5
gi|33860708|ref|NP_892269.1| conserved hypothetical protein [Pro... 33 8.5
gi|48731088|ref|ZP_00264834.1| COG0668: Small-conductance mechan... 33 8.5
gi|30249280|ref|NP_841350.1| conserved hypothetical protein [Nit... 33 8.5
gi|26992065|ref|NP_747490.1| hypothetical protein [Pseudomonas p... 33 8.5
gi|38045959|ref|NP_899051.1| zinc finger protein, subfamily 1A, ... 33 8.5
gi|17932718|emb|CAC80427.1| AIOLOS isoform two [Homo sapiens] 33 8.5
>gi|17506725|ref|NP_491473.1| carboxyl methyltransferase (33.4 kD)
(1F471) [Caenorhabditis elegans]
gi|7499584|pir||T25721 hypothetical protein F21F3.3 -
Caenorhabditis elegans
gi|1825661|gb|AAB42280.1| Hypothetical protein F21F3.3
[Caenorhabditis elegans]
Length = 295
Score = 606 bits (1562), Expect = e-172
Identities = 295/295 (100%), Positives = 295/295 (100%)
Frame = +1
Query: 1 MAPNSTPPPTFFGRIVFHLTSDDVFRTAIFAFIASFTVIAAVASVTGSFLVGLLASVIVL 180
MAPNSTPPPTFFGRIVFHLTSDDVFRTAIFAFIASFTVIAAVASVTGSFLVGLLASVIVL
Sbjct: 1 MAPNSTPPPTFFGRIVFHLTSDDVFRTAIFAFIASFTVIAAVASVTGSFLVGLLASVIVL 60
Query: 181 LVAYAVGESCEFINNQILMPAAFLGCAVAVNLVYTVAHEGELWEYFSRYFLFLSVFHFSE 360
LVAYAVGESCEFINNQILMPAAFLGCAVAVNLVYTVAHEGELWEYFSRYFLFLSVFHFSE
Sbjct: 61 LVAYAVGESCEFINNQILMPAAFLGCAVAVNLVYTVAHEGELWEYFSRYFLFLSVFHFSE 120
Query: 361 FVFTALTNRRTLGPDSFLLKHSFGYWLAASIGWIEFLIEANFYPEIKMYSVLWIGTFGCI 540
FVFTALTNRRTLGPDSFLLKHSFGYWLAASIGWIEFLIEANFYPEIKMYSVLWIGTFGCI
Sbjct: 121 FVFTALTNRRTLGPDSFLLKHSFGYWLAASIGWIEFLIEANFYPEIKMYSVLWIGTFGCI 180
Query: 541 IGEIVRKVGMVHAGLAFTHLMARTKRSGHTLINTGIYAYMRHPGYFGWFIWAVSTQIVLC 720
IGEIVRKVGMVHAGLAFTHLMARTKRSGHTLINTGIYAYMRHPGYFGWFIWAVSTQIVLC
Sbjct: 181 IGEIVRKVGMVHAGLAFTHLMARTKRSGHTLINTGIYAYMRHPGYFGWFIWAVSTQIVLC 240
Query: 721 NPISFVIYTFVTWRFFANRIEIEEKDLISFFGDDYAEYQRKTWSGVPFARGYQKP 885
NPISFVIYTFVTWRFFANRIEIEEKDLISFFGDDYAEYQRKTWSGVPFARGYQKP
Sbjct: 241 NPISFVIYTFVTWRFFANRIEIEEKDLISFFGDDYAEYQRKTWSGVPFARGYQKP 295