Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F22B3_3
(312 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|70768|pir||HSUR4 histone H4 - sea urchin (Psammechinus miliar... 164 5e-40
gi|3287225|emb|CAA76306.1| histone H4 [Paracentrotus lividus] 164 5e-40
gi|7510983|pir||T27741 hypothetical protein ZK131.4 - Caenorhabd... 164 5e-40
gi|17509199|ref|NP_492641.1| histone (his-67) [Caenorhabditis el... 164 5e-40
gi|17540668|ref|NP_501203.1| histone (his-60) [Caenorhabditis el... 164 5e-40
gi|122104|sp|P27996|H4_SOLST Histone H4 >gnl|BL_ORD_ID|1569858 g... 162 1e-39
gi|47199540|emb|CAF87814.1| unnamed protein product [Tetraodon n... 160 8e-39
gi|70762|pir||HSBO4 histone H4 - bovine >gnl|BL_ORD_ID|1516674 g... 160 8e-39
gi|37590121|gb|AAH58529.1| Hist1h4h protein [Mus musculus] 160 8e-39
gi|50729214|ref|XP_425458.1| PREDICTED: similar to germinal hist... 160 8e-39
gi|34876368|ref|XP_225346.2| similar to germinal histone H4 gene... 160 8e-39
gi|34858262|ref|XP_227462.2| similar to germinal histone H4 gene... 160 8e-39
gi|27692960|gb|AAH28550.2| Hist1h4h protein [Mus musculus] 160 8e-39
gi|48099579|ref|XP_394915.1| similar to Hist1h4i protein [Apis m... 160 8e-39
gi|48099577|ref|XP_394914.1| similar to germinal histone H4 gene... 160 8e-39
gi|31197305|ref|XP_307600.1| ENSANGP00000016197 [Anopheles gambi... 160 8e-39
gi|17975542|ref|NP_524352.1| CG3379-PC [Drosophila melanogaster]... 160 8e-39
gi|33114104|gb|AAP94670.1| histone H4 [Mytilus chilensis] 160 8e-39
gi|4504301|ref|NP_003529.1| H4 histone family, member A [Homo sa... 160 8e-39
gi|50728590|ref|XP_416192.1| PREDICTED: similar to germinal hist... 160 8e-39
gi|31212289|ref|XP_315129.1| ENSANGP00000015255 [Anopheles gambi... 160 8e-39
gi|31195755|ref|XP_306825.1| ENSANGP00000000125 [Anopheles gambi... 160 8e-39
gi|47225212|emb|CAF98839.1| unnamed protein product [Tetraodon n... 160 8e-39
gi|3745759|pdb|1AOI|B Chain B, X-Ray Structure Of The Nucleosome... 160 8e-39
gi|27692935|gb|AAH19757.2| Hist1h4i protein [Mus musculus] 160 8e-39
gi|46015176|pdb|1P3P|B Chain B, Crystallographic Studies Of Nucl... 159 1e-38
gi|462242|sp|P35059|H4_ACRFO Histone H4 >gnl|BL_ORD_ID|500886 gi... 159 1e-38
gi|2495141|sp|Q27443|H4_ASCSU Histone H4 >gnl|BL_ORD_ID|336120 g... 159 1e-38
gi|26800918|emb|CAD38840.1| histone h4 [Oikopleura dioica] 159 2e-38
gi|32363170|sp|P82888|H4_OLILU Histone H4 159 2e-38
gi|484442|pir||JN0688 histone H4 - sea squirt (Styela plicata) >... 159 2e-38
gi|46015166|pdb|1P3O|B Chain B, Crystallographic Studies Of Nucl... 158 2e-38
gi|224293|prf||1101277A histone H4 158 2e-38
gi|70772|pir||HSWT4 histone H4 - wheat 158 2e-38
gi|12845285|dbj|BAB26692.1| unnamed protein product [Mus musculus] 158 2e-38
gi|70774|pir||HSWT41 histone H4 (TH091) - wheat >gnl|BL_ORD_ID|1... 158 2e-38
gi|15226944|ref|NP_180441.1| histone H4 [Arabidopsis thaliana] >... 158 2e-38
gi|45767731|gb|AAH67496.1| HIST1H4D protein [Homo sapiens] 158 2e-38
gi|12847763|dbj|BAB27698.1| unnamed protein product [Mus musculus] 158 2e-38
gi|223582|prf||0901261A histone H4 158 3e-38
gi|46015116|pdb|1P3G|B Chain B, Crystallographic Studies Of Nucl... 158 3e-38
gi|46015126|pdb|1P3I|B Chain B, Crystallographic Studies Of Nucl... 158 3e-38
gi|49457374|emb|CAG46986.1| HIST1H4F [Homo sapiens] 158 3e-38
gi|90626|pir||S03427 histone H4 (clone 53) - mouse >gnl|BL_ORD_I... 158 3e-38
gi|46015096|pdb|1P3B|B Chain B, Crystallographic Studies Of Nucl... 157 4e-38
gi|34876364|ref|XP_344596.1| similar to CG31613-PA [Rattus norve... 157 4e-38
gi|21542071|sp|Q9U7D0|H4_MASBA Histone H4 >gnl|BL_ORD_ID|239488 ... 157 4e-38
gi|42494361|gb|AAS17527.1| histone H4.1 [Bos grunniens] 157 4e-38
gi|50728592|ref|XP_416193.1| PREDICTED: similar to histone prote... 157 4e-38
gi|462243|sp|P35057|H4_LYCES Histone H4 >gnl|BL_ORD_ID|567536 gi... 157 5e-38
gi|1806283|emb|CAB01913.1| Histone H4 homologue [Sesbania rostrata] 157 5e-38
gi|515377|emb|CAA56154.1| histone H4 [Lolium temulentum] 157 5e-38
gi|1883028|emb|CAA62811.1| histone H4 [Diprion pini] 157 5e-38
gi|46015106|pdb|1P3F|B Chain B, Crystallographic Studies Of Nucl... 157 7e-38
gi|47196915|emb|CAF87475.1| unnamed protein product [Tetraodon n... 157 7e-38
gi|84451|pir||JS0314 histone H4 - Caenorhabditis elegans >gnl|BL... 157 7e-38
gi|21307833|gb|AAL54860.1| histone H4 [Aplysia californica] 157 7e-38
gi|6980692|pdb|2HIO|D Chain D, Histone Octamer (Chicken), Chromo... 157 7e-38
gi|38564171|dbj|BAD02436.1| histone 4 [Drosophila sechellia] 157 7e-38
gi|1883034|emb|CAA62810.1| histone H4 [Diadromus pulchellus] 156 9e-38
gi|663070|emb|CAA54829.1| histone H4 [Pyrenomonas salina] 156 9e-38
gi|50058194|dbj|BAD27407.1| histone H4 [Lactuca sativa] 156 9e-38
gi|16797797|dbj|BAB71814.1| histone H4 [Citrus jambhiri] 156 1e-37
gi|886740|emb|CAA59110.1| histone 4 [Zea mays] 156 1e-37
gi|32097|emb|CAA24918.1| unnamed protein product [Homo sapiens] 155 1e-37
gi|1883026|emb|CAA62813.1| histone H4 [Diprion pini] 155 1e-37
gi|50400217|sp|Q9HDF5|H4_MORAP Histone H4 >gnl|BL_ORD_ID|44158 g... 155 3e-37
gi|50256128|gb|EAL18855.1| hypothetical protein CNBI1160 [Crypto... 154 6e-37
gi|50408544|ref|XP_456790.1| unnamed protein product [Debaryomyc... 154 6e-37
gi|10953803|gb|AAG25601.1| histone H4 [Schistosoma mansoni] 153 1e-36
gi|1708110|sp|P50566|H4_CHLRE Histone H4 >gnl|BL_ORD_ID|1763009 ... 153 1e-36
gi|122101|sp|P04915|H4_PHYPO Histone H4 >gnl|BL_ORD_ID|33929 gi|... 153 1e-36
gi|1883001|emb|CAA62809.1| histone H4 [Apis mellifera] 152 1e-36
gi|462244|sp|P35058|H4_PHACH Histone H4 >gnl|BL_ORD_ID|523416 gi... 152 1e-36
gi|1885348|emb|CAA62815.1| histone H4 [Trichogramma cacoeciae] 152 2e-36
gi|102290|pir||S10076 histone H4.2 - slime mold (Physarum polyce... 152 2e-36
gi|19880139|gb|AAM00266.1| histone 4 [Eimeria tenella] 152 2e-36
gi|49615731|gb|AAT67047.1| histone H4 [Petunia x hybrida] 152 2e-36
gi|122105|sp|P08436|H4_VOLCA Histone H4 >gnl|BL_ORD_ID|983807 gi... 152 2e-36
gi|223793|prf||0912198A histone H4 151 3e-36
gi|1883030|emb|CAA62812.1| histone H4 [Diprion pini] 150 5e-36
gi|23508257|ref|NP_700926.1| histone H4, putative [Plasmodium fa... 150 5e-36
gi|47198730|emb|CAF88836.1| unnamed protein product [Tetraodon n... 150 5e-36
gi|47189494|emb|CAF93557.1| unnamed protein product [Tetraodon n... 150 5e-36
gi|49085510|ref|XP_404871.1| H4_NEUCR Histone H4 [Aspergillus ni... 150 6e-36
gi|32415187|ref|XP_328073.1| HISTONE H4 [Neurospora crassa] >gnl... 150 6e-36
gi|32403370|ref|XP_322298.1| hypothetical protein ( Chain F, X-R... 150 6e-36
gi|122092|sp|P23750|H41_EMENI Histone H4.1 >gnl|BL_ORD_ID|252853... 150 6e-36
gi|49089980|ref|XP_406563.1| H42_EMENI Histone H4.2 [Aspergillus... 150 8e-36
gi|21322635|emb|CAC85654.1| histone H4 [Penicillium funiculosum] 150 8e-36
gi|46425442|emb|CAG26759.1| histone 4 [Ustilago maydis] 150 8e-36
gi|50312941|ref|XP_454339.1| unnamed protein product [Kluyveromy... 149 1e-35
gi|38102692|gb|EAA49502.1| hypothetical protein MG01160.4 [Magna... 149 1e-35
gi|50309471|ref|XP_454743.1| unnamed protein product [Kluyveromy... 149 1e-35
gi|49072072|ref|XP_400325.1| H4_PHACH Histone H4 [Ustilago maydi... 149 1e-35
gi|27550961|emb|CAD59972.1| histone H4 [Arxula adeninivorans] 149 1e-35
gi|19112350|ref|NP_595558.1| histone H4 [Schizosaccharomyces pom... 149 1e-35
gi|4139870|pdb|1HIO|D Chain D, Histone Octamer (Chicken), Chromo... 149 2e-35
gi|50285853|ref|XP_445355.1| unnamed protein product [Candida gl... 149 2e-35
gi|39592228|emb|CAE75449.1| Hypothetical protein CBG23443 [Caeno... 148 2e-35
gi|46116894|ref|XP_384465.1| hypothetical protein FG04289.1 [Gib... 148 2e-35
gi|15988133|pdb|1ID3|B Chain B, Crystal Structure Of The Yeast N... 147 4e-35
gi|45187672|ref|NP_983895.1| ADL201Wp [Eremothecium gossypii] >g... 147 4e-35
gi|6319481|ref|NP_009563.1| One of two identical histone H4 prot... 147 4e-35
gi|46432311|gb|EAK91800.1| hypothetical protein CaO19.9412 [Cand... 147 5e-35
gi|32401025|gb|AAP80718.1| histone H4 protein [Griffithsia japon... 147 7e-35
gi|50548501|ref|XP_501720.1| hypothetical protein [Yarrowia lipo... 146 1e-34
gi|13812130|ref|NP_113257.1| Histone H4 [Guillardia theta] >gnl|... 145 2e-34
gi|46228775|gb|EAK89645.1| histone H4 [Cryptosporidium parvum] 144 4e-34
gi|48100494|ref|XP_395012.1| similar to CG9886-like; glycerate k... 142 1e-33
gi|45190618|ref|NP_984872.1| AER012Cp [Eremothecium gossypii] >g... 142 2e-33
gi|102411|pir||S14185 histone H4 (clone H4g) - Stylonychia lemnae 141 4e-33
gi|122100|sp|P18836|H4_OXYNO Histone H4 >gnl|BL_ORD_ID|1259513 g... 141 4e-33
gi|21779960|gb|AAM77593.1| macronuclear histone H4 [Stylonychia ... 141 4e-33
gi|1360628|emb|CAA66648.1| histone H4-2 [Trichomonas vaginalis] ... 140 5e-33
gi|21779945|gb|AAM77588.1| macronuclear histone H4 [Euplotes aed... 140 6e-33
gi|2062367|gb|AAB53361.1| histone H4 [Plasmodium falciparum] 139 2e-32
gi|20141289|sp|P80739|H4_EUPCR Histone H4 >gnl|BL_ORD_ID|342396 ... 138 2e-32
gi|70777|pir||HSTE42 histone H4, minor - Tetrahymena pyriformis ... 135 3e-31
gi|122093|sp|P02310|H41_TETPY Histone H4, major >gnl|BL_ORD_ID|6... 135 3e-31
gi|122095|sp|P02311|H42_TETPY Histone H4, minor >gnl|BL_ORD_ID|6... 135 3e-31
gi|2564209|emb|CAA75404.1| histone H4 [Arbacia lixula] 133 8e-31
gi|729679|sp|P40287|H4_ENTHI Histone H4 >gnl|BL_ORD_ID|631788 gi... 130 7e-30
gi|15430617|dbj|BAB64430.1| histone H4 [Paramecium caudatum] >gn... 130 9e-30
gi|2851582|sp|P80737|H41_BLEJA Histone H4-1 128 3e-29
gi|1731927|emb|CAA71084.1| histone H4 [Anopheles gambiae] 128 3e-29
gi|1708778|emb|CAA66634.1| Histone H4 [Blepharisma japonicum] 128 3e-29
gi|28828124|gb|AAO50807.1| similar to Oxytricha nova, and Stylon... 125 2e-28
gi|22217761|emb|CAD43601.1| histone H4 [Daucus carota] 125 3e-28
gi|6006741|gb|AAF00593.1| histone H4 [Giardia intestinalis] >gnl... 124 6e-28
gi|3023903|sp|P90516|H42_BLEJA Histone H4 >gnl|BL_ORD_ID|645055 ... 123 8e-28
gi|50543650|ref|XP_499991.1| hypothetical protein [Yarrowia lipo... 122 2e-27
gi|29469556|gb|AAO73941.1| histone H4 [Eschscholzia californica ... 121 3e-27
gi|4504319|ref|NP_003538.1| H4 histone family, member L [Homo sa... 117 8e-26
gi|4376196|emb|CAA06063.1| histone H4 [Blepharisma sp.] >gnl|BL_... 115 2e-25
gi|4376214|emb|CAA06065.1| histone H4 [Blepharisma undulans] 114 5e-25
gi|1199967|emb|CAA64985.1| histone H4 [Allium cepa] 113 1e-24
gi|23476928|emb|CAC85445.1| histone H4 [Glomerella acutata] >gnl... 112 1e-24
gi|4376213|emb|CAA06064.1| histone H4 [Blepharisma undulans] 112 1e-24
gi|4379376|emb|CAA06069.1| histone H4 [Protocruzia sp.] >gnl|BL_... 112 2e-24
gi|33944435|ref|XP_340365.1| histone H4, putative [Trypanosoma b... 110 5e-24
gi|2137382|pir||I48404 histone H4 (55AA) (1 is 3rd base in codon... 109 1e-23
gi|4377535|emb|CAA06071.1| histone H4 [Euplotes eurystomus] 108 2e-23
gi|4377536|emb|CAA06072.1| histone H4 [Euplotes eurystomus] 107 6e-23
gi|4377539|emb|CAA06068.1| histone H4 [Euplotes minuta] 107 8e-23
gi|4377541|emb|CAA06067.1| histone H4 [Euplotes vannus] 107 8e-23
gi|23477111|emb|CAC85452.1| histone H4 [Colletotrichum sp.] 104 4e-22
gi|11022579|emb|CAC14237.1| histone H4 [Leishmania major] 103 9e-22
gi|2222684|emb|CAA74210.1| Histone H4 [Leishmania infantum] 102 1e-21
gi|5738233|gb|AAD50306.1| histone H4 [Leishmania tarentolae] 102 1e-21
gi|2222686|emb|CAA74211.1| Histone H4 [Leishmania infantum] 102 1e-21
gi|18677172|gb|AAL78218.1| histone Hgg-28 [Heterodera glycines] 95 4e-19
gi|46121391|ref|XP_385250.1| hypothetical protein FG05074.1 [Gib... 94 9e-19
gi|45268360|gb|AAS55791.1| histone H4 [Succinea putris] >gnl|BL_... 93 2e-18
gi|50787650|emb|CAH04403.1| histone H4 [Euplotes vannus] 93 2e-18
gi|50554815|ref|XP_504816.1| hypothetical protein [Yarrowia lipo... 92 3e-18
gi|2995208|emb|CAA06040.1| histone H4 [Blepharisma undulans] >gn... 91 8e-18
gi|47220009|emb|CAG11542.1| unnamed protein product [Tetraodon n... 89 2e-17
gi|23476924|emb|CAC85442.1| histone H4 [Glomerella cingulata] 86 1e-16
gi|578468|emb|CAA24380.1| unnamed protein product [Psammechinus ... 86 2e-16
gi|23476922|emb|CAC85439.1| histone H4 [Glomerella acutata] 86 2e-16
gi|50542195|gb|AAT78437.1| histone H4 [Gallus gallus] >gnl|BL_OR... 84 7e-16
gi|50542259|gb|AAT78469.1| histone H4 [Callithrix geoffroyi] 84 7e-16
gi|50542233|gb|AAT78456.1| histone H4 [Suricata suricatta] 82 2e-15
gi|32406156|ref|XP_323691.1| predicted protein [Neurospora crass... 82 3e-15
gi|50542227|gb|AAT78453.1| histone H4 [Planorbis corneus] 82 3e-15
gi|50542231|gb|AAT78455.1| histone H4 [Spodoptera frugiperda] 81 5e-15
gi|50542229|gb|AAT78454.1| histone H4 [Saguinus oedipus] 81 6e-15
gi|33327400|gb|AAQ09030.1| histone H4 [Chilodonella uncinata] >g... 80 8e-15
gi|2995265|emb|CAA06074.1| histone H4 [Prorodon teres] 80 1e-14
gi|4379375|emb|CAA06061.1| histone H4 [Protocruzia sp.] 79 2e-14
gi|47218415|emb|CAG12686.1| unnamed protein product [Tetraodon n... 79 3e-14
gi|2995268|emb|CAA06076.1| histone H4 [Prorodon teres] 78 4e-14
gi|2995229|emb|CAA06054.1| histone H4 [Obertrumia georgiana] 77 9e-14
gi|50542237|gb|AAT78458.1| histone H4 [Mammuthus primigenius] >g... 77 9e-14
gi|38106691|gb|EAA52965.1| hypothetical protein MG06093.4 [Magna... 76 1e-13
gi|2995217|emb|CAA06046.1| histone H4 [Colpidium campylum] >gnl|... 76 1e-13
gi|2995235|emb|CAA06058.1| histone H4 [Colpoda cucullus] 76 2e-13
gi|33327392|gb|AAQ09026.1| histone H4 [Chilodonella uncinata] >g... 75 3e-13
gi|2995226|emb|CAA06052.1| histone H4 [Obertrumia georgiana] 75 3e-13
gi|2995232|emb|CAA06056.1| histone H4 [Obertrumia georgiana] 75 3e-13
gi|2352807|gb|AAB69280.1| histone H4 [Ambystoma mexicanum] 73 1e-12
gi|33327396|gb|AAQ09028.1| histone H4 [Chilodonella uncinata] 73 2e-12
gi|10019|emb|CAA24373.1| unnamed protein product [Psammechinus m... 69 2e-11
gi|19173165|ref|NP_596968.1| HISTONE H4 [Encephalitozoon cunicul... 69 3e-11
gi|17543234|ref|NP_501173.1| putative protein (4I100) [Caenorhab... 64 8e-10
gi|84353|pir||A02650 histone H4 - Tetrahymena thermophila (fragm... 60 1e-08
gi|23476926|emb|CAC85444.1| histone H4 [Glomerella graminicola] 59 2e-08
gi|38635915|emb|CAE82074.1| unnamed protein product [Homo sapiens] 52 4e-08
gi|4379340|emb|CAA06062.1| histone H4 [Paramecium bursaria] 57 1e-07
gi|4379388|emb|CAA06060.1| histone H4 [Paramecium tetraurelia] 56 2e-07
gi|4379387|emb|CAA06059.1| histone H4 [Paramecium tetraurelia] 54 1e-06
gi|47225207|emb|CAF98834.1| unnamed protein product [Tetraodon n... 52 2e-06
gi|1881597|gb|AAB49449.1| histone H4 [Drosophila virilis] 52 3e-06
gi|23477103|emb|CAC85448.1| histone H4 [Colletotrichum sp.] 50 9e-06
gi|49084048|ref|XP_404254.1| hypothetical protein AN0117.2 [Aspe... 49 3e-05
gi|2495143|sp|P80738|H4Y_BLEJA Histone H4 48 6e-05
gi|19111907|ref|NP_595115.1| serine rich hypothetical protein; p... 47 7e-05
gi|22788712|ref|NP_690420.1| histone h3, h4 [Heliothis zea virus... 45 3e-04
gi|7578731|gb|AAF64115.1| histone H4 [Drosophila virilis] >gnl|B... 43 0.001
gi|84363|pir||C30309 histone H4 - Euplotes crassus (fragment) 40 0.012
gi|11499088|ref|NP_070322.1| archaeal histone A1 (hpyA1-2) [Arch... 40 0.016
gi|1708290|sp|P50485|HARA_PYRSG Archaeal histone A (Archaeal his... 39 0.035
gi|253264|gb|AAB22815.1| histone H4 {N-terminal} [Trypanosoma cr... 39 0.035
gi|15668340|ref|NP_247136.1| archaeal histone A1 [Methanocaldoco... 37 0.077
gi|1346286|sp|P48784|HFOB_METFO Archaeal histone B >gnl|BL_ORD_I... 37 0.077
gi|15679690|ref|NP_276807.1| histone HMtA2 [Methanothermobacter ... 37 0.077
gi|15669122|ref|NP_247927.1| archaeal histone A2 [Methanocaldoco... 37 0.10
gi|14520563|ref|NP_126038.1| histone-like protein han1 subunit [... 37 0.13
gi|6685518|sp|Q9Y8I1|HARA_PYRKO Archaeal histone A (Archaeal his... 37 0.13
gi|15678843|ref|NP_275960.1| histone HMtA1 [Methanothermobacter ... 37 0.13
gi|258808|gb|AAB23927.1| histone d=core histone H4 homolog [Tryp... 37 0.13
gi|1708271|sp|P50484|HMTB_METTH DNA binding protein HMt-2 (Archa... 36 0.17
gi|15678282|ref|NP_275397.1| histone HMtB [Methanothermobacter t... 36 0.17
gi|6685488|sp|O74098|HARA_PYRHO Archaeal histone A (Archaeal his... 36 0.17
gi|14591540|ref|NP_143622.1| archaeal histon [Pyrococcus horikos... 36 0.17
gi|6685519|sp|Q9Y8I2|HARB_PYRKO Archaeal histone B (Archaeal his... 36 0.17
gi|10954491|ref|NP_044155.1| archaeal histone [Methanocaldococcu... 36 0.22
gi|1346284|sp|P48782|HFO1_METFO Archaeal histone A1 >gnl|BL_ORD_... 35 0.29
gi|48840394|ref|ZP_00297321.1| COG2036: Histones H3 and H4 [Meth... 35 0.50
gi|41615077|ref|NP_963575.1| NEQ288 [Nanoarchaeum equitans Kin4-... 35 0.50
gi|7674065|sp|P95669|HANA_THEZI Archaeal histone HAN1 subunit A ... 34 0.65
gi|32487507|emb|CAE05751.1| OSJNBa0064G10.2 [Oryza sativa (japon... 34 0.85
gi|1346285|sp|P48783|HFO2_METFO Archaeal histone A2 >gnl|BL_ORD_... 34 0.85
gi|1708291|sp|P50486|HARB_PYRSG Archaeal histone B (Archaeal his... 34 0.85
gi|18978094|ref|NP_579451.1| archaeal histone a2 [Pyrococcus fur... 33 1.1
gi|20089557|ref|NP_615632.1| archaeal histone [Methanosarcina ac... 33 1.1
gi|50545391|ref|XP_500233.1| hypothetical protein [Yarrowia lipo... 33 1.1
gi|3080558|dbj|BAA25805.1| archaeal histone [Pyrococcus furiosus] 33 1.1
gi|21227927|ref|NP_633849.1| DNA binding protein [Methanosarcina... 33 1.1
gi|47212427|emb|CAF93583.1| unnamed protein product [Tetraodon n... 33 1.5
gi|3378185|gb|AAC28465.1| ORF1 protein [TT virus] 33 1.5
gi|40642653|emb|CAD33709.1| leafy cotyledon protein [Bixa orellana] 33 1.5
gi|2134085|pir||I51432 histone H4-1 precursor - African clawed f... 33 1.5
gi|15669444|ref|NP_248254.1| archaeal histone A3 [Methanocaldoco... 33 1.5
gi|34869427|ref|XP_344034.1| similar to LIM domain containing pr... 33 1.5
gi|421707|pir||A47036 histone-related protein HMf1 - Methanother... 33 1.9
gi|1346303|sp|P48781|HMFA_METFE DNA binding protein HMf-1 (Archa... 33 1.9
gi|6980538|pdb|1B67|A Chain A, Crystal Structure Of The Histone ... 33 1.9
gi|22536010|gb|AAN01148.1| LEC1-like protein [Phaseolus coccineus] 32 2.5
gi|123365|sp|P19267|HMFB_METFE DNA binding protein HMf-2 (Archae... 32 2.5
gi|3132286|dbj|BAA28156.1| long ORF [TT virus] 32 3.2
gi|48121254|ref|XP_393233.1| similar to ENSANGP00000013395 [Apis... 32 3.2
gi|4928164|gb|AAD33439.1| mating type protein MAT-1/2 [Cochliobo... 32 3.2
gi|45358910|ref|NP_988467.1| archaeal histone B [Methanococcus m... 32 3.2
gi|6685516|sp|O74092|HARB_PYRHO Archaeal histone B (Archaeal his... 32 3.2
gi|14591465|ref|NP_143545.1| archaeal histon [Pyrococcus horikos... 32 3.2
gi|41719024|ref|ZP_00147957.1| COG2036: Histones H3 and H4 [Meth... 32 3.2
gi|11497949|ref|NP_069173.1| archaeal histone A1 (hpyA1-1) [Arch... 32 3.2
gi|27666416|ref|XP_234348.1| similar to taube nuss [Rattus norve... 32 3.2
gi|2959442|dbj|BAA25131.1| ORF1 [TT virus] >gnl|BL_ORD_ID|181392... 32 4.2
gi|29502194|ref|NP_817122.1| VP1 [TT virus] >gnl|BL_ORD_ID|17788... 32 4.2
gi|6097096|dbj|BAA85664.1| ORF1 [TT virus] 32 4.2
gi|6097105|dbj|BAA85666.1| ORF1 [TT virus] 32 4.2
gi|6097087|dbj|BAA85662.1| ORF1 [TT virus] >gnl|BL_ORD_ID|967200... 32 4.2
gi|3132280|dbj|BAA28152.1| long ORF [TT virus] 32 4.2
gi|4574802|gb|AAD24198.1| unknown [TT virus] 32 4.2
gi|50760503|ref|XP_418049.1| PREDICTED: similar to TBP-associate... 32 4.2
gi|7649953|dbj|BAA94196.1| ORF1 [TT virus] 32 4.2
gi|6980541|pdb|1B6W|A Chain A, Crystal Structure Of The Selenome... 32 4.2
gi|41615138|ref|NP_963636.1| NEQ348 [Nanoarchaeum equitans Kin4-... 32 4.2
gi|45502127|emb|CAF74920.1| histone HstA [Methanococcus voltae] 32 4.2
gi|31208413|ref|XP_313173.1| ENSANGP00000013395 [Anopheles gambi... 32 4.2
gi|6815129|dbj|BAA90406.1| pORF1 [TT virus] 32 4.2
gi|31323620|gb|AAP47094.1| TBP-associated factor TAFII43 [Homo s... 31 5.5
gi|34874377|ref|XP_236948.2| similar to taube nuss [Rattus norve... 31 5.5
gi|20070378|ref|NP_612639.1| taube nuss; TAF8 RNA polymerase II,... 31 5.5
gi|49094856|ref|XP_408889.1| hypothetical protein AN4752.2 [Aspe... 31 5.5
gi|26352151|dbj|BAC39712.1| unnamed protein product [Mus musculus] 31 5.5
gi|46129348|ref|XP_389035.1| hypothetical protein FG08859.1 [Gib... 31 5.5
gi|27696376|gb|AAH43877.1| Tbn-prov protein [Xenopus laevis] 31 5.5
gi|26340678|dbj|BAC34001.1| unnamed protein product [Mus musculus] 31 5.5
gi|85325|pir||A29663 histone H4 - starfish (Pisaster ochraceus) ... 31 5.5
gi|21707439|gb|AAH33728.1| Unknown (protein for MGC:45470) [Homo... 31 5.5
gi|37046785|gb|AAH57895.1| Tbn protein [Mus musculus] 31 5.5
gi|26345424|dbj|BAC36363.1| unnamed protein product [Mus musculus] 31 5.5
gi|11528498|ref|NP_071298.1| taube nuss [Mus musculus] >gnl|BL_O... 31 5.5
gi|50841505|ref|YP_054732.1| hypothetical conserved protein [Pro... 31 7.2
gi|15321716|gb|AAK95562.1| leafy cotyledon1 [Zea mays] 31 7.2
gi|5616137|gb|AAD45635.1| unknown [TT virus] 31 7.2
gi|4768833|gb|AAD29634.1| ORF1 [TT virus] 31 7.2
gi|3132277|dbj|BAA28150.1| long ORF [TT virus] 31 7.2
gi|16902056|gb|AAL27660.1| CCAAT-box binding factor HAP3 B domai... 31 7.2
gi|14520688|ref|NP_126163.1| archaeal histone A2/archaeal histon... 31 7.2
gi|16902052|gb|AAL27658.1| CCAAT-box binding factor HAP3 B domai... 31 7.2
gi|31234382|ref|XP_319051.1| ENSANGP00000013197 [Anopheles gambi... 31 7.2
gi|30349365|gb|AAP22065.1| leafy cotyledon 1 [Oryza sativa (indi... 31 7.2
gi|45735894|dbj|BAD12927.1| leafy cotyledon1 [Oryza sativa (japo... 31 7.2
gi|37542680|gb|AAL47209.1| HAP3 transcriptional-activator [Oryza... 31 7.2
gi|47222523|emb|CAG02888.1| unnamed protein product [Tetraodon n... 31 7.2
gi|4928177|gb|AAD33447.1| mating type protein MAT-2 [Cochliobolu... 31 7.2
gi|34907872|ref|NP_915283.1| P0031D02.24 [Oryza sativa (japonica... 31 7.2
gi|39931303|sp|Q9AC25|IF2_CAUCR Translation initiation factor IF-2 30 9.4
gi|38100352|gb|EAA47489.1| hypothetical protein MG02732.4 [Magna... 30 9.4
gi|16124298|ref|NP_418862.1| translation initiation factor IF-2 ... 30 9.4
gi|7670376|dbj|BAA95040.1| unnamed protein product [Mus musculus] 30 9.4
gi|15239251|ref|NP_196199.1| expressed protein [Arabidopsis thal... 30 9.4
gi|17369353|sp|Q9P445|MAT2_COCSA Mating-type protein MAT-2 >gnl|... 30 9.4
gi|4928167|gb|AAD33441.1| mating type protein MAT-2/1 [Cochliobo... 30 9.4
gi|26376452|dbj|BAB28190.2| unnamed protein product [Mus musculus] 30 9.4
gi|28393564|gb|AAO42202.1| unknown protein [Arabidopsis thaliana] 30 9.4
gi|31560078|ref|NP_076154.2| hypothetical protein MNCb-0169 [Mus... 30 9.4
gi|34872595|ref|XP_345605.1| similar to Cc2-27 [Rattus norvegicus] 30 9.4
gi|50753519|ref|XP_414020.1| PREDICTED: similar to RIKEN cDNA G6... 30 9.4
gi|45502129|emb|CAF74921.1| histone HstB [Methanococcus voltae] 30 9.4
gi|37542678|gb|AAL47208.1| HAP3 transcriptional-activator [Oryza... 30 9.4
gi|42525667|ref|NP_970765.1| histidine kinase-related ATPase, pu... 30 9.4
>gi|70768|pir||HSUR4 histone H4 - sea urchin (Psammechinus miliaris)
gi|70769|pir||HSUR4P histone H4, embryonic - sea urchin
(Strongylocentrotus purpuratus)
gi|7439814|pir||S68537 histone H4 - starfish (Asterina pectinifera)
gi|161483|gb|AAA30054.1| H4 histone protein
Length = 102
Score = 164 bits (414), Expect = 5e-40
Identities = 82/82 (100%), Positives = 82/82 (100%)
Frame = +1
Query: 64 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 243
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT
Sbjct: 21 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 80
Query: 244 VTAMDVVYALKRQGRTLYGFGG 309
VTAMDVVYALKRQGRTLYGFGG
Sbjct: 81 VTAMDVVYALKRQGRTLYGFGG 102
>gi|3287225|emb|CAA76306.1| histone H4 [Paracentrotus lividus]
Length = 101
Score = 164 bits (414), Expect = 5e-40
Identities = 82/82 (100%), Positives = 82/82 (100%)
Frame = +1
Query: 64 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 243
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT
Sbjct: 20 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 79
Query: 244 VTAMDVVYALKRQGRTLYGFGG 309
VTAMDVVYALKRQGRTLYGFGG
Sbjct: 80 VTAMDVVYALKRQGRTLYGFGG 101
>gi|7510983|pir||T27741 hypothetical protein ZK131.4 -
Caenorhabditis elegans
Length = 103
Score = 164 bits (414), Expect = 5e-40
Identities = 82/82 (100%), Positives = 82/82 (100%)
Frame = +1
Query: 64 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 243
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT
Sbjct: 22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 81
Query: 244 VTAMDVVYALKRQGRTLYGFGG 309
VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82 VTAMDVVYALKRQGRTLYGFGG 103
>gi|17509199|ref|NP_492641.1| histone (his-67) [Caenorhabditis
elegans]
gi|17534747|ref|NP_496893.1| histone (his-10) [Caenorhabditis
elegans]
gi|17534755|ref|NP_496889.1| histone (his-14) [Caenorhabditis
elegans]
gi|17537811|ref|NP_496896.1| histone (his-26) [Caenorhabditis
elegans]
gi|17538226|ref|NP_502133.1| histone (his-46) [Caenorhabditis
elegans]
gi|17539964|ref|NP_502154.1| predicted CDS, histone (his-64)
[Caenorhabditis elegans]
gi|17540632|ref|NP_502139.1| histone (his-56) [Caenorhabditis
elegans]
gi|17541086|ref|NP_501406.1| predicted CDS, histone (his-31)
[Caenorhabditis elegans]
gi|17559296|ref|NP_505275.1| predicted CDS, histone (his-50)
[Caenorhabditis elegans]
gi|17561984|ref|NP_507034.1| histone (his-1) [Caenorhabditis
elegans]
gi|17561990|ref|NP_505200.1| histone (11.4 kD) (his-5)
[Caenorhabditis elegans]
gi|17562000|ref|NP_505298.1| predicted CDS, histone (his-18)
[Caenorhabditis elegans]
gi|17562012|ref|NP_505291.1| histone (his-28) [Caenorhabditis
elegans]
gi|17562018|ref|NP_505466.1| histone (11.4 kD) (his-37)
[Caenorhabditis elegans]
gi|17568543|ref|NP_509231.1| histone (his-38) [Caenorhabditis
elegans]
gi|47551061|ref|NP_999707.1| H4 histone protein [Strongylocentrotus
purpuratus]
gi|47551073|ref|NP_999713.1| histone H4, late embryonic
[Strongylocentrotus purpuratus]
gi|47551081|ref|NP_999716.1| late histone gene H4 L1
[Strongylocentrotus purpuratus]
gi|47551087|ref|NP_999715.1| late histone gene H4 L2
[Strongylocentrotus purpuratus]
gi|122102|sp|P02306|H4_CAEEL Histone H4
gi|84450|pir||S04240 histone H4 - Caenorhabditis elegans
gi|103587|pir||S20666 histone H4 - starfish (Pisaster brevispinus)
gi|103590|pir||S20670 histone H4 - starfish (Pisaster ochraceus)
gi|103607|pir||S20668 histone H4 - starfish (Pycnopodia
helianthoides)
gi|1079204|pir||S49485 histone H4 - sea cucumber (Holothuria
tubulosa)
gi|7439818|pir||S01618 histone H4, embryonic (clones L1 and L2) -
sea urchin (Strongylocentrotus purpuratus)
gi|6751|emb|CAA33643.1| Histone protein [Caenorhabditis elegans]
gi|9612|emb|CAA25241.1| unnamed protein product [Lytechinus pictus]
gi|9789|emb|CAA38049.1| H4 histone [Pisaster brevispinus]
gi|9990|emb|CAA38053.1| histone H4 [Pycnopodia helianthoides]
gi|10037|emb|CAA25630.1| histone H4 (aa 1-103) [Psammechinus
miliaris]
gi|10045|emb|CAA38051.1| histone H4 [Pisaster ochraceus]
gi|10242|emb|CAA29847.1| unnamed protein product
[Strongylocentrotus purpuratus]
gi|10244|emb|CAA29849.1| unnamed protein product
[Strongylocentrotus purpuratus]
gi|10250|emb|CAA24645.1| reading frame histone H4
[Strongylocentrotus purpuratus]
gi|10257|emb|CAA27581.1| unnamed protein product
[Strongylocentrotus purpuratus]
gi|161385|gb|AAA30024.1| histone H4
gi|461148|gb|AAA30002.1| histone H4
gi|559459|emb|CAA86298.1| histone H4 [Holothuria tubulosa]
gi|894093|gb|AAA69664.1| histone
gi|1118131|gb|AAA83329.1| Histone protein 38 [Caenorhabditis
elegans]
gi|1458313|gb|AAC48026.1| Histone protein 5 [Caenorhabditis
elegans]
gi|1870702|gb|AAB48834.1| cleavage stage histone H4 [Psammechinus
miliaris]
gi|2935372|gb|AAC05101.1| Histone protein 31 [Caenorhabditis
elegans]
gi|3287227|emb|CAA76307.1| histone H4 [Paracentrotus lividus]
gi|3873698|emb|CAA97407.1| Hypothetical protein B0035.9
[Caenorhabditis elegans]
gi|3875125|emb|CAA94742.1| Hypothetical protein C50F4.7
[Caenorhabditis elegans]
gi|3876196|emb|CAA92734.1| Hypothetical protein F22B3.1
[Caenorhabditis elegans]
gi|3877575|emb|CAB05210.1| Hypothetical protein F54E12.3
[Caenorhabditis elegans]
gi|3879736|emb|CAB07657.1| C. elegans HIS-1 protein (corresponding
sequence T10C6.14) [Caenorhabditis elegans]
gi|3880073|emb|CAB03396.1| C. elegans HIS-67 protein (corresponding
sequence T23D8.5) [Caenorhabditis elegans]
gi|3881588|emb|CAB05837.1| C. elegans HIS-14 protein (corresponding
sequence ZK131.8) [Caenorhabditis elegans]
gi|3881590|emb|CAB05839.1| C. elegans HIS-26 protein (corresponding
sequence ZK131.1) [Caenorhabditis elegans]
gi|9755507|gb|AAF98220.1| Histone protein 18 [Caenorhabditis
elegans]
gi|9755510|gb|AAF98223.1| Histone protein 28 [Caenorhabditis
elegans]
gi|15145322|gb|AAK84518.1| Hypothetical protein F07B7.9
[Caenorhabditis elegans]
gi|18376579|emb|CAB05835.4| C. elegans HIS-10 protein
(corresponding sequence ZK131.4) [Caenorhabditis
elegans]
gi|39581588|emb|CAE58373.1| Hypothetical protein CBG01500
[Caenorhabditis briggsae]
gi|39581590|emb|CAE58375.1| Hypothetical protein CBG01504
[Caenorhabditis briggsae]
gi|39592223|emb|CAE75444.1| Hypothetical protein CBG23438
[Caenorhabditis briggsae]
gi|39593569|emb|CAE61861.1| Hypothetical protein CBG05839
[Caenorhabditis briggsae]
gi|39593572|emb|CAE61864.1| Hypothetical protein CBG05842
[Caenorhabditis briggsae]
gi|39593602|emb|CAE61894.1| Hypothetical protein CBG05885
[Caenorhabditis briggsae]
gi|39593747|emb|CAE62040.1| Hypothetical protein CBG06056
[Caenorhabditis briggsae]
gi|39593750|emb|CAE62043.1| Hypothetical protein CBG06059
[Caenorhabditis briggsae]
gi|39594620|emb|CAE72198.1| Hypothetical protein CBG19306
[Caenorhabditis briggsae]
gi|39595173|emb|CAE60210.1| Hypothetical protein CBG03774
[Caenorhabditis briggsae]
gi|1588653|prf||2209257B histone H4
Length = 103
Score = 164 bits (414), Expect = 5e-40
Identities = 82/82 (100%), Positives = 82/82 (100%)
Frame = +1
Query: 64 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 243
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT
Sbjct: 22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 81
Query: 244 VTAMDVVYALKRQGRTLYGFGG 309
VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82 VTAMDVVYALKRQGRTLYGFGG 103
>gi|17540668|ref|NP_501203.1| histone (his-60) [Caenorhabditis
elegans]
gi|7504327|pir||T29230 hypothetical protein F55G1.11 -
Caenorhabditis elegans
gi|1326372|gb|AAB00649.1| Histone protein 60 [Caenorhabditis
elegans]
Length = 118
Score = 164 bits (414), Expect = 5e-40
Identities = 82/82 (100%), Positives = 82/82 (100%)
Frame = +1
Query: 64 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 243
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT
Sbjct: 37 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 96
Query: 244 VTAMDVVYALKRQGRTLYGFGG 309
VTAMDVVYALKRQGRTLYGFGG
Sbjct: 97 VTAMDVVYALKRQGRTLYGFGG 118