Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F22B5_1
(771 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17533393|ref|NP_495778.1| eukaryotic Initiation Factor (eif-3... 499 e-140
gi|39578878|emb|CAE57074.1| Hypothetical protein CBG24970 [Caeno... 460 e-128
gi|49619137|gb|AAT68153.1| eukaryotic translation initiation fac... 155 7e-37
gi|4097873|gb|AAD00176.1| eIF3-p44 [Mus musculus] 154 3e-36
gi|31980808|ref|NP_058572.2| eukaryotic translation initiation f... 154 3e-36
gi|41055906|ref|NP_957293.1| similar to eukaryotic translation i... 152 6e-36
gi|47220039|emb|CAG12187.1| unnamed protein product [Tetraodon n... 152 6e-36
gi|49472822|ref|NP_003746.2| eukaryotic translation initiation f... 151 1e-35
gi|48146385|emb|CAG33415.1| EIF3S4 [Homo sapiens] 151 1e-35
gi|30583983|gb|AAP36240.1| Homo sapiens eukaryotic translation i... 151 1e-35
gi|3264859|gb|AAC78728.1| translation initiation factor eIF3 p44... 149 5e-35
gi|49670432|gb|AAH75190.1| Unknown (protein for MGC:83369) [Xeno... 147 2e-34
gi|24639372|ref|NP_570011.1| CG8636-PA [Drosophila melanogaster]... 146 5e-34
gi|24648403|ref|NP_650887.1| CG10881-PA [Drosophila melanogaster... 144 2e-33
gi|31198509|ref|XP_308202.1| ENSANGP00000021554 [Anopheles gambi... 137 3e-31
gi|49074938|ref|XP_401567.1| hypothetical protein UM03952.1 [Ust... 134 3e-30
gi|19112519|ref|NP_595727.1| eukaryotic translation initiation f... 127 3e-28
gi|48097679|ref|XP_391934.1| similar to ENSANGP00000021554 [Apis... 126 6e-28
gi|2951777|dbj|BAA25105.1| translation initiation factor 3 [Schi... 124 3e-27
gi|50552081|ref|XP_503515.1| hypothetical protein [Yarrowia lipo... 120 4e-26
gi|6320637|ref|NP_010717.1| Subunit of the core complex of trans... 117 2e-25
gi|50420255|ref|XP_458660.1| unnamed protein product [Debaryomyc... 117 4e-25
gi|46121373|ref|XP_385241.1| hypothetical protein FG05065.1 [Gib... 116 5e-25
gi|49097388|ref|XP_410154.1| hypothetical protein AN6017.2 [Aspe... 112 9e-24
gi|34860401|ref|XP_216611.2| similar to eukaryotic translation i... 110 3e-23
gi|46436639|gb|EAK95998.1| hypothetical protein CaO19.7236 [Cand... 110 4e-23
gi|50303253|ref|XP_451568.1| unnamed protein product [Kluyveromy... 107 3e-22
gi|50289137|ref|XP_446998.1| unnamed protein product [Candida gl... 106 5e-22
gi|12407751|gb|AAG53636.1| initiation factor 3g [Arabidopsis tha... 106 6e-22
gi|47497762|dbj|BAD19862.1| putative initiation factor 3g [Oryza... 105 8e-22
gi|38111130|gb|EAA56754.1| hypothetical protein MG07109.4 [Magna... 105 1e-21
gi|15229743|ref|NP_187747.1| eukaryotic translation initiation f... 104 2e-21
gi|32416548|ref|XP_328752.1| hypothetical protein [Neurospora cr... 101 2e-20
gi|39979172|emb|CAE85545.1| related to translation initiation fa... 101 2e-20
gi|10177573|dbj|BAB10805.1| eukaryotic translation initiation fa... 100 4e-20
gi|30681225|ref|NP_196219.2| eukaryotic translation initiation f... 100 4e-20
gi|47497761|dbj|BAD19861.1| putative initiation factor 3g [Oryza... 100 4e-20
gi|45188062|ref|NP_984285.1| ADR189Wp [Eremothecium gossypii] >g... 97 3e-19
gi|50255454|gb|EAL18189.1| hypothetical protein CNBK2070 [Crypto... 96 6e-19
gi|23612859|ref|NP_704398.1| eukaryotic translation initiation f... 91 3e-17
gi|23480115|gb|EAA16764.1| eukaryotic translation initiation fac... 88 2e-16
gi|12641792|emb|CAC27531.1| eukaryotic translation initiation fa... 87 3e-16
gi|29841248|gb|AAP06280.1| similar to GenBank Accession Number A... 82 1e-14
gi|1749496|dbj|BAA13806.1| similar to Saccharomyces cerevisiae n... 79 1e-13
gi|15021899|dbj|BAB62225.1| Hu/elav class neuron-specific RNA bi... 73 8e-12
gi|31234589|ref|XP_319085.1| ENSANGP00000005999 [Anopheles gambi... 70 4e-11
gi|18858613|ref|NP_571527.1| ELAV (embryonic lethal, abnormal vi... 70 4e-11
gi|28279908|gb|AAH44184.1| Elavl1 protein [Danio rerio] 70 5e-11
gi|45382281|ref|NP_990163.1| RNA-binding protein HuC [Gallus gal... 70 6e-11
gi|46592818|ref|NP_997568.1| ELAV-like 2 isoform 1; HU-antigen; ... 69 8e-11
gi|34869592|ref|XP_346744.1| hypothetical protein XP_346743 [Rat... 69 8e-11
gi|12274833|emb|CAC22160.1| bA31K16.2 (ELAV (embryonic lethal, a... 69 8e-11
gi|4758262|ref|NP_004423.1| ELAV (embryonic lethal, abnormal vis... 69 8e-11
gi|46592826|ref|NP_997569.1| ELAV-like 2 isoform 3; HU-antigen; ... 69 8e-11
gi|15020256|gb|AAK74153.1| ELAV-like neuronal protein-2 [Mus mus... 69 8e-11
gi|41944855|gb|AAH65965.1| Elavl4 protein [Danio rerio] 69 8e-11
gi|18858617|ref|NP_571528.1| ELAV (embryonic lethal, abnormal vi... 69 8e-11
gi|15020254|gb|AAK74152.1| ELAV-like neuronal protein-3 [Mus mus... 69 8e-11
gi|21265137|gb|AAH30692.1| ELAVL2 protein [Homo sapiens] 69 8e-11
gi|2136127|pir||I39077 RNA-binding protein Hel-N2 - human >gnl|B... 69 8e-11
gi|6754264|ref|NP_034616.1| ELAV-like 2 isoform 2; HU-antigen; H... 69 8e-11
gi|47225636|emb|CAG07979.1| unnamed protein product [Tetraodon n... 69 1e-10
gi|27545382|ref|NP_775431.1| RNA binding protein HuB [Rattus nor... 69 1e-10
gi|17532863|ref|NP_496057.1| EXCretory canal abnormal EXC-7, ELA... 69 1e-10
gi|39589166|emb|CAE57899.1| Hypothetical protein CBG00948 [Caeno... 69 1e-10
gi|48094405|ref|XP_394166.1| similar to ENSANGP00000018039 [Apis... 69 1e-10
gi|6226775|sp|O97018|SXL_CHRRU Sex-lethal protein homolog >gnl|B... 69 1e-10
gi|14280325|gb|AAK57539.1| HUD4 [Homo sapiens] 69 1e-10
gi|11386163|ref|NP_068771.1| ELAV (embryonic lethal, abnormal vi... 69 1e-10
gi|13357168|gb|AAK20025.1| sex-lethal protein SXL1 [Lucilia cupr... 69 1e-10
gi|2565362|gb|AAB81985.1| Sex-lethal protein [Musca domestica] 69 1e-10
gi|6226777|sp|O17310|SXL_MUSDO Sex-lethal protein homolog >gnl|B... 69 1e-10
gi|13357170|gb|AAK20026.1| sex-lethal protein SXL2 [Lucilia cupr... 69 1e-10
gi|14280323|gb|AAK57538.1| HUD3 [Homo sapiens] 69 1e-10
gi|14280327|gb|AAK57540.1| HUD1 [Homo sapiens] 69 1e-10
gi|23271926|gb|AAH36071.1| ELAVL4 protein [Homo sapiens] 69 1e-10
gi|45549052|ref|NP_476936.2| CG3151-PD [Drosophila melanogaster]... 69 1e-10
gi|18463972|gb|AAL73053.1| HUC [Sphoeroides nephelus] 69 1e-10
gi|47220048|emb|CAG12196.1| unnamed protein product [Tetraodon n... 69 1e-10
gi|19549690|ref|NP_599125.1| CG3151-PE [Drosophila melanogaster]... 69 1e-10
gi|45549053|ref|NP_476937.2| CG3151-PA [Drosophila melanogaster]... 69 1e-10
gi|7322081|gb|AAB25519.2| RRM9 [Drosophila melanogaster] 69 1e-10
gi|19549688|ref|NP_599124.1| CG3151-PB [Drosophila melanogaster]... 69 1e-10
gi|2500581|sp|O09032|ELV4_RAT ELAV-like protein 4 (Paraneoplasti... 68 2e-10
gi|28879001|gb|AAH48159.1| Elavl4 protein [Mus musculus] 68 2e-10
gi|42768810|gb|AAS45605.1| sex-lethal [Trichomegalosphys pubescens] 68 2e-10
gi|26347767|dbj|BAC37532.1| unnamed protein product [Mus musculus] 68 2e-10
gi|2500580|sp|Q61701|ELV4_MOUSE ELAV-like protein 4 (Paraneoplas... 68 2e-10
gi|45382273|ref|NP_990161.1| RNA-binding protein HuD [Gallus gal... 68 2e-10
gi|12851808|dbj|BAB29173.1| unnamed protein product [Mus musculus] 68 2e-10
gi|6754266|ref|NP_034618.1| ELAV (embryonic lethal, abnormal vis... 68 2e-10
gi|48104588|ref|XP_392958.1| similar to sex-lethal [Apis mellifera] 68 2e-10
gi|50345000|ref|NP_001002172.1| zgc:91918 [Danio rerio] >gnl|BL_... 68 2e-10
gi|38201714|ref|NP_001410.2| ELAV-like 1; embryonic lethal, abno... 68 2e-10
gi|45382283|ref|NP_990164.1| RNA-binding protein HuA [Gallus gal... 68 2e-10
gi|1022961|gb|AAB41913.1| HuR RNA binding protein 68 2e-10
gi|2134155|pir||I51678 ribonucleoprotein - African clawed frog >... 68 2e-10
gi|47219575|emb|CAG02281.1| unnamed protein product [Tetraodon n... 68 2e-10
gi|26354232|dbj|BAC40744.1| unnamed protein product [Mus musculus] 68 2e-10
gi|49355761|ref|NP_001411.2| ELAV-like protein 3 isoform 1; Hu a... 68 2e-10
gi|27229298|ref|NP_758827.1| ELAV-like protein 3 [Rattus norvegi... 68 2e-10
gi|49355765|ref|NP_115657.2| ELAV-like protein 3 isoform 2; Hu a... 68 2e-10
gi|26344670|dbj|BAC35984.1| unnamed protein product [Mus musculus] 68 2e-10
gi|26330019|dbj|BAC28748.1| unnamed protein product [Mus musculus] 68 2e-10
gi|13124196|sp|P70372|ELV1_MOUSE ELAV-like protein 1 (Hu-antigen... 68 2e-10
gi|31542602|ref|NP_034615.2| ELAV (embryonic lethal, abnormal vi... 68 2e-10
gi|40807107|gb|AAH65343.1| Elavl3 protein [Danio rerio] 67 3e-10
gi|431093|gb|AAA58677.1| huc 67 3e-10
gi|27752871|gb|AAO19468.1| sex-lethal [Sciara ocellaris] 67 3e-10
gi|42768808|gb|AAS45604.1| sex-lethal [Rhynchosciara americana] 67 3e-10
gi|42768806|gb|AAS45603.1| sex-lethal [Bradysia coprophila] 67 3e-10
gi|18858615|ref|NP_571524.1| ELAV-like protein 3; elav/huc homol... 67 3e-10
gi|14585790|gb|AAK67714.1| HUC [Homo sapiens] 67 3e-10
gi|2134152|pir||I51675 ribonucleoprotein - African clawed frog >... 67 3e-10
gi|542846|pir||JC2116 hippocampal 38K autoantigen protein - huma... 67 4e-10
gi|7767194|pdb|1D8Z|A Chain A, Solution Structure Of The First R... 67 4e-10
gi|33356910|pdb|1FNX|H Chain H, Solution Structure Of The Huc Rb... 67 4e-10
gi|49658982|emb|CAE01482.1| HUR [Tetraodon nigroviridis] 67 4e-10
gi|18858877|ref|NP_570984.1| HuG; etID19626.11 [Danio rerio] >gn... 67 4e-10
gi|2981305|gb|AAC38968.1| sex-lethal homolog CcSXL [Ceratitis ca... 67 5e-10
gi|13096196|pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-... 67 5e-10
gi|6226164|sp|O61374|SXL_CERCA Sex-lethal protein homolog (CCSXL) 67 5e-10
gi|49250885|gb|AAH74585.1| Unknown (protein for MGC:69387) [Xeno... 66 9e-10
gi|4930239|pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domain... 65 1e-09
gi|28317144|gb|AAO39587.1| LD15933p [Drosophila melanogaster] 65 1e-09
gi|4929888|pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX >gn... 65 1e-09
gi|45552119|ref|NP_788881.2| CG33070-PG [Drosophila melanogaster... 65 1e-09
gi|45552120|ref|NP_788882.2| CG33070-PK [Drosophila melanogaster... 65 1e-09
gi|640423|pdb|1SXL| Sex-Lethal Protein (C-Terminus, Or Second R... 65 1e-09
gi|2134154|pir||I51677 ribonucleoprotein - African clawed frog >... 65 1e-09
gi|28571394|ref|NP_788879.1| CG33070-PA [Drosophila melanogaster... 65 1e-09
gi|12643503|sp|Q24668|SXL_DROSU Sex-lethal protein 65 1e-09
gi|45552118|ref|NP_788880.2| CG33070-PF [Drosophila melanogaster... 65 1e-09
gi|28571398|ref|NP_788878.1| CG33070-PH [Drosophila melanogaster... 65 1e-09
gi|1403308|emb|CAA67016.1| sex-lethal [Drosophila subobscura] 65 1e-09
gi|31200419|ref|XP_309157.1| ENSANGP00000018039 [Anopheles gambi... 65 1e-09
gi|28571408|ref|NP_788876.1| CG33070-PD [Drosophila melanogaster... 65 1e-09
gi|103381|pir||B39725 sex-lethal sex determination protein MS11 ... 65 1e-09
gi|28571396|ref|NP_788875.1| CG33070-PC [Drosophila melanogaster... 65 1e-09
gi|31198365|ref|XP_308130.1| ENSANGP00000017132 [Anopheles gambi... 65 2e-09
gi|2134153|pir||I51676 ribonucleoprotein - African clawed frog >... 65 2e-09
gi|26347149|dbj|BAC37223.1| unnamed protein product [Mus musculus] 64 3e-09
gi|31241499|ref|XP_321180.1| ENSANGP00000020835 [Anopheles gambi... 64 4e-09
gi|13898849|gb|AAK48899.1| ribonucleoprotein [Labeo rohita] 64 4e-09
gi|728726|emb|CAA59430.1| Xel-1 [Xenopus laevis] 64 5e-09
gi|6456838|emb|CAA04179.2| Sex-lethal orthologous protein [Megas... 63 6e-09
gi|30179878|sp|O01671|SXL_MEGSC Sex-lethal protein homolog >gnl|... 63 6e-09
gi|31242563|ref|XP_321712.1| ENSANGP00000023817 [Anopheles gambi... 60 5e-08
gi|31242567|ref|XP_321714.1| ENSANGP00000025309 [Anopheles gambi... 60 5e-08
gi|38107608|gb|EAA53755.1| hypothetical protein MG09505.4 [Magna... 60 7e-08
gi|37535012|ref|NP_921808.1| putative spliceosomal protein [Oryz... 60 7e-08
gi|14280337|gb|AAK57545.1| Hu antigen C long [Homo sapiens] 60 7e-08
gi|38099305|gb|EAA46664.1| hypothetical protein MG09885.4 [Magna... 59 9e-08
gi|50746763|ref|XP_420643.1| PREDICTED: similar to HDCMA18P prot... 59 1e-07
gi|18399701|ref|NP_565513.1| RNA recognition motif (RRM)-contain... 59 1e-07
gi|38047677|gb|AAR09741.1| similar to Drosophila melanogaster fn... 59 1e-07
gi|18860091|ref|NP_572842.1| CG4396-PA [Drosophila melanogaster]... 59 1e-07
gi|28828645|gb|AAO51248.1| similar to Dictyostelium discoideum (... 59 1e-07
gi|15030328|gb|AAH11441.1| RNA binding motif protein, X chromoso... 59 1e-07
gi|38104394|gb|EAA50968.1| hypothetical protein MG04727.4 [Magna... 59 1e-07
gi|21361809|ref|NP_062556.2| kynurenine aminotransferase III [Ho... 59 1e-07
gi|542850|pir||S41766 heterogeneous nuclear ribonucleoprotein G ... 58 2e-07
gi|4504451|ref|NP_002130.1| RNA binding motif protein, X chromos... 58 2e-07
gi|23503093|sp|P38159|ROG_HUMAN Heterogeneous nuclear ribonucleo... 58 2e-07
gi|6755296|ref|NP_035382.1| RNA binding motif protein, X chromos... 58 2e-07
gi|31249706|gb|AAP46199.1| putative splicing factor [Oryza sativ... 58 2e-07
gi|31242561|ref|XP_321711.1| ENSANGP00000023687 [Anopheles gambi... 58 2e-07
gi|34881706|ref|XP_229192.2| similar to heterogeneous nuclear ri... 58 2e-07
gi|27497553|gb|AAO13018.1| RNA-binding protein HU [Oncorhynchus ... 58 2e-07
gi|48893520|ref|ZP_00326756.1| COG0724: RNA-binding proteins (RR... 58 2e-07
gi|5579009|emb|CAB51361.1| heterogeneous nuclear ribonucleoprote... 58 2e-07
gi|39591634|emb|CAE71211.1| Hypothetical protein CBG18074 [Caeno... 58 3e-07
gi|12849735|dbj|BAB28459.1| unnamed protein product [Mus musculus] 57 3e-07
gi|12853228|dbj|BAB29687.1| unnamed protein product [Mus musculus] 57 3e-07
gi|4098582|gb|AAD00328.1| RBM1 [Sminthopsis macroura] 57 3e-07
gi|3402035|pdb|2SXL| Sex-Lethal Rbd1, Nmr, Minimized Average St... 57 3e-07
gi|45524744|ref|ZP_00176010.1| COG0724: RNA-binding proteins (RR... 57 3e-07
gi|32307761|gb|AAP79277.1| Hu/elav [Saccoglossus kowalevskii] 57 3e-07
gi|38077060|ref|XP_131189.2| RIKEN cDNA C330027G06 [Mus musculus] 57 3e-07
gi|34851585|ref|XP_226369.2| similar to heterogeneous nuclear ri... 57 4e-07
gi|17554514|ref|NP_497891.1| RNA-binding protein like (rnp-5) [C... 57 6e-07
gi|6469493|emb|CAB61832.1| Sex-lethal orthologous protein [Megas... 57 6e-07
gi|998355|gb|AAA76605.1| colony 1 57 6e-07
gi|49095082|ref|XP_409002.1| hypothetical protein AN4865.2 [Aspe... 57 6e-07
gi|6469495|emb|CAB61831.1| Sex-lethal orthologous protein [Megas... 57 6e-07
gi|630730|pir||S43599 Snf5 homolog R07E5.3 - Caenorhabditis elegans 57 6e-07
gi|47682580|gb|AAH70649.1| MGC82187 protein [Xenopus laevis] 56 7e-07
gi|1144009|gb|AAC53000.1| mHuC-S 56 7e-07
gi|2961399|emb|CAA18091.1| EG:65F1.2 [Drosophila melanogaster] 56 1e-06
gi|4104336|gb|AAD01997.1| heterogeneous nuclear ribonucleoprotei... 56 1e-06
gi|19115433|ref|NP_594521.1| putative rna binding ribonucleoprot... 56 1e-06
gi|49072414|ref|XP_400496.1| hypothetical protein UM02881.1 [Ust... 56 1e-06
gi|39580200|emb|CAE71707.1| Hypothetical protein CBG18684 [Caeno... 56 1e-06
gi|18079265|ref|NP_525033.1| CG4262-PA [Drosophila melanogaster]... 56 1e-06
gi|1723533|sp|Q10422|YDC1_SCHPO Hypothetical RNA-binding protein... 56 1e-06
gi|2133909|pir||I50512 ribonucleoprotein - zebra fish (fragment)... 56 1e-06
gi|32421993|ref|XP_331440.1| hypothetical protein [Neurospora cr... 55 1e-06
gi|103516|pir||A40252 elav protein - fruit fly (Drosophila virilis) 55 1e-06
gi|119265|sp|P23241|ELAV_DROVI Elav protein (Embryonic lethal ab... 55 1e-06
gi|19347816|gb|AAL86321.1| putative poly(A)-binding protein [Ara... 55 2e-06
gi|28899709|ref|NP_799314.1| RNA-binding protein [Vibrio parahae... 55 2e-06
gi|30689921|ref|NP_195137.2| polyadenylate-binding protein 2 (PA... 55 2e-06
gi|1171978|sp|P42731|PAB2_ARATH Polyadenylate-binding protein 2 ... 55 2e-06
gi|15219287|ref|NP_173107.1| arginine/serine-rich protein, putat... 55 2e-06
gi|15027957|gb|AAK76509.1| putative arginine/serine-rich protein... 55 2e-06
gi|9843653|emb|CAC03600.1| splicing factor SC35 [Arabidopsis tha... 55 2e-06
gi|6677685|ref|NP_033059.1| RNA binding motif protein, X chromos... 55 2e-06
gi|15237641|ref|NP_201225.1| arginine/serine-rich splicing facto... 55 2e-06
gi|46389987|dbj|BAD16229.1| putative poly(A)-binding protein [Or... 55 2e-06
gi|39589424|emb|CAE74453.1| Hypothetical protein CBG22194 [Caeno... 55 2e-06
gi|17506843|ref|NP_492130.1| nuclear cap binding protein like (1... 55 2e-06
gi|42571507|ref|NP_973844.1| arginine/serine-rich protein, putat... 55 2e-06
gi|30524687|emb|CAC85245.1| salt tolerance protein 4 [Beta vulga... 55 2e-06
gi|17553656|ref|NP_499734.1| cleavage and Polyadenylation Factor... 55 2e-06
gi|18043352|gb|AAH20127.1| C330027G06Rik protein [Mus musculus] 55 2e-06
gi|20128863|ref|NP_569908.1| CG3056-PA [Drosophila melanogaster]... 54 3e-06
gi|45553910|ref|NP_996326.1| CG3056-PB [Drosophila melanogaster]... 54 3e-06
gi|9930616|gb|AAG02117.1| poly(A) binding protein [Arabidopsis t... 54 4e-06
gi|15219945|ref|NP_173690.1| polyadenylate-binding protein 3 (PA... 54 4e-06
gi|32420169|ref|XP_330528.1| hypothetical protein [Neurospora cr... 54 4e-06
gi|24583873|ref|NP_723737.1| CG31762-PB [Drosophila melanogaster... 54 4e-06
gi|17537143|ref|NP_496718.1| tia-1 family member (2N61) [Caenorh... 54 4e-06
gi|24583875|ref|NP_723738.1| CG31762-PC [Drosophila melanogaster... 54 4e-06
gi|30683481|ref|NP_565646.2| RNA recognition motif (RRM)-contain... 54 4e-06
gi|7439965|pir||T00768 polyadenylate-binding protein T22J18.7 - ... 54 4e-06
gi|24583877|ref|NP_723739.1| CG31762-PA [Drosophila melanogaster... 54 4e-06
gi|38079280|ref|XP_355557.1| similar to multi sex combs CG12058-... 54 4e-06
gi|21312912|ref|NP_080502.1| RIKEN cDNA 4932702K14 [Mus musculus... 54 4e-06
gi|31200451|ref|XP_309173.1| ENSANGP00000018775 [Anopheles gambi... 54 5e-06
gi|1082703|pir||S52491 polyadenylate binding protein II - human ... 54 5e-06
gi|46806500|dbj|BAD17624.1| putative heterogeneous nuclearribonu... 54 5e-06
gi|46806499|dbj|BAD17623.1| putative heterogeneous nuclearribonu... 54 5e-06
gi|20072518|gb|AAH26995.1| Cstf2t-pending protein [Mus musculus] 54 5e-06
gi|26330250|dbj|BAC28855.1| unnamed protein product [Mus musculu... 54 5e-06
gi|26341156|dbj|BAC34240.1| unnamed protein product [Mus musculus] 54 5e-06
gi|41386798|ref|NP_776993.1| poly(A) binding protein, cytoplasmi... 54 5e-06
gi|45238849|ref|NP_112241.2| poly(A) binding protein, cytoplasmi... 54 5e-06
gi|11610605|gb|AAG38953.1| testis-specific poly(A)-binding prote... 54 5e-06
gi|2231301|gb|AAB61993.1| testis-specific RNP-type RNA binding p... 54 5e-06
gi|26351239|dbj|BAC39256.1| unnamed protein product [Mus musculus] 54 5e-06
gi|34862808|ref|XP_219809.2| similar to Cstf2t-pending protein [... 54 5e-06
gi|8927581|gb|AAF82129.1| testes-specific heterogenous nuclear r... 54 5e-06
gi|20380061|gb|AAH28239.1| Cleavage stimulation factor, 3' pre-R... 54 5e-06
gi|13560783|gb|AAK30205.1| poly(A)-binding protein [Daucus carota] 54 5e-06
gi|14149675|ref|NP_056050.1| cleavage stimulation factor, 3' pre... 54 5e-06
gi|7439967|pir||T06979 polyadenylate-binding protein - wheat >gn... 54 5e-06
gi|13752575|ref|NP_112539.1| cleavage stimulation factor, 3' pre... 54 5e-06
gi|28201305|dbj|BAC56813.1| putative Heterogeneous nuclear ribon... 54 5e-06
gi|18411454|ref|NP_567192.1| RNA recognition motif (RRM)-contain... 54 5e-06
gi|46105484|ref|XP_380546.1| hypothetical protein FG00370.1 [Gib... 54 5e-06
gi|2148976|gb|AAB58464.1| bruno 54 5e-06
gi|50510589|dbj|BAD32280.1| mKIAA0689 protein [Mus musculus] 54 5e-06
gi|35215045|dbj|BAC92404.1| putative polyadenylate-binding prote... 53 6e-06
gi|47210814|emb|CAF92867.1| unnamed protein product [Tetraodon n... 53 6e-06
gi|6474847|dbj|BAA87307.1| Hypothetical protein YPR112c [Schizos... 53 6e-06
gi|21619877|gb|AAH33135.1| Similar to cleavage stimulation facto... 53 6e-06
gi|22478042|gb|AAH36719.1| Unknown (protein for MGC:36412) [Mus ... 53 6e-06
gi|12053297|emb|CAB66834.1| hypothetical protein [Homo sapiens] 53 6e-06
gi|50752243|ref|XP_422700.1| PREDICTED: similar to Nuclear cap b... 53 6e-06
gi|50745788|ref|XP_420243.1| PREDICTED: similar to CstF-64 [Gall... 53 6e-06
gi|27807239|ref|NP_777110.1| cleavage stimulation factor, 3' pre... 53 6e-06
gi|4557493|ref|NP_001316.1| cleavage stimulation factor subunit ... 53 6e-06
gi|632500|gb|AAB50269.1| polyadenylation factor 64 kDa subunit 53 6e-06
gi|27696830|gb|AAH43735.1| ElrD protein [Xenopus laevis] 53 6e-06
gi|34810648|pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal ... 53 6e-06
gi|9757907|dbj|BAB08354.1| unnamed protein product [Arabidopsis ... 53 6e-06
gi|27735464|gb|AAH41291.1| Cstf-64-prov protein [Xenopus laevis] 53 6e-06
gi|42522915|ref|NP_968295.1| putative RNA-binding protein [Bdell... 53 6e-06
gi|17508567|ref|NP_493029.1| cleavage stimulation factor 3' pre-... 53 6e-06
gi|47222076|emb|CAG12102.1| unnamed protein product [Tetraodon n... 53 6e-06
gi|34015145|gb|AAQ56342.1| putative poly(A)-binding protein [Ory... 53 6e-06
gi|47225344|emb|CAG09844.1| unnamed protein product [Tetraodon n... 53 6e-06
gi|19112391|ref|NP_595599.1| RNA binding protein; 5 rrm RNA reco... 53 6e-06
gi|26328597|dbj|BAC28037.1| unnamed protein product [Mus musculus] 53 6e-06
gi|18875338|ref|NP_573459.1| cleavage stimulation factor, 3' pre... 53 6e-06
gi|33585950|gb|AAH56021.1| ElrD protein [Xenopus laevis] 53 6e-06
gi|7446336|pir||T09704 probable arginine/serine-rich splicing fa... 53 6e-06
gi|41107668|gb|AAH65442.1| Zgc:77730 protein [Danio rerio] 53 6e-06
gi|5921787|sp|O93235|CIRP_XENLA Cold-inducible RNA-binding prote... 53 8e-06
gi|46227640|gb|EAK88575.1| cleavage stimulation factor subunit 2... 53 8e-06
gi|50260672|gb|EAL23325.1| hypothetical protein CNBA4410 [Crypto... 53 8e-06
gi|34870198|ref|XP_216471.2| similar to HUD3 [Rattus norvegicus] 53 8e-06
gi|29841102|gb|AAP06115.1| similar to NM_080743 serine-arginine ... 53 8e-06
gi|37588904|gb|AAH04145.2| TNRC4 protein [Homo sapiens] 53 8e-06
gi|50745700|ref|XP_420205.1| PREDICTED: similar to nuclear cap b... 53 8e-06
gi|33469616|gb|AAQ19851.1| putative RNA-binding protein [Caenorh... 53 8e-06
gi|24371807|ref|NP_715849.1| RNA-binding protein [Shewanella one... 53 8e-06
gi|27735413|gb|AAH41204.1| Cirbp-prov protein [Xenopus laevis] 53 8e-06
gi|37531112|ref|NP_919858.1| putative RNA-binding protein [Oryza... 53 8e-06
gi|41053728|ref|NP_957176.1| poly A binding protein, cytoplasmic... 53 8e-06
gi|12659074|gb|AAK01176.1| RNA-binding protein [Triticum aestivum] 53 8e-06
gi|7528270|gb|AAF63202.1| poly(A)-binding protein [Cucumis sativus] 52 1e-05
gi|7489207|pir||T03986 transformer-SR ribonucleoprotein - common... 52 1e-05
gi|21313088|ref|NP_080301.1| MADP-1 protein [Mus musculus] >gnl|... 52 1e-05
gi|14141216|gb|AAK54351.1| SRp46 splicing factor [Homo sapiens] 52 1e-05
gi|21314767|ref|NP_149105.2| MADP-1 protein; U11/U12 snRNP 31K [... 52 1e-05
gi|14211667|dbj|BAB56132.1| MADP-1 protein [Homo sapiens] >gnl|B... 52 1e-05
gi|34867757|ref|XP_343321.1| similar to MADP-1 protein [Rattus n... 52 1e-05
gi|33873902|gb|AAH10177.1| MADP-1 protein [Homo sapiens] 52 1e-05
gi|45544646|ref|NP_956311.1| cold inducible RNA binding protein ... 52 1e-05
gi|15055543|ref|NP_115285.1| Splicing factor, arginine/serine-ri... 52 1e-05
gi|34784708|gb|AAH57783.1| SRP46 protein [Homo sapiens] 52 1e-05
gi|21356139|ref|NP_650913.1| CG17838-PB [Drosophila melanogaster... 52 1e-05
gi|21593441|gb|AAM65408.1| putative spliceosome associated prote... 52 1e-05
gi|15224186|ref|NP_179441.1| pre-mRNA splicing factor, putative ... 52 1e-05
gi|14334958|gb|AAK59656.1| putative spliceosome associated prote... 52 1e-05
gi|25141355|ref|NP_492958.2| RNA binding protein bruno-like (1M1... 52 1e-05
gi|39580421|emb|CAE69303.1| Hypothetical protein CBG15358 [Caeno... 52 1e-05
gi|34870050|ref|XP_213689.2| similar to poly(A)-binding protein,... 52 1e-05
gi|19705459|ref|NP_599180.1| poly(A) binding protein, cytoplasmi... 52 1e-05
gi|129535|sp|P29341|PAB1_MOUSE Polyadenylate-binding protein 1 (... 52 1e-05
gi|31560656|ref|NP_032800.2| poly A binding protein, cytoplasmic... 52 1e-05
gi|34328409|ref|NP_780444.2| RIKEN cDNA 6330569O16 [Mus musculus... 52 1e-05
gi|26354649|dbj|BAC40951.1| unnamed protein product [Mus musculus] 52 1e-05
gi|50801542|ref|XP_428547.1| PREDICTED: similar to Polyadenylate... 52 1e-05
gi|15341327|gb|AAK95615.1| BRUNO-like 6 RNA-binding protein [Hom... 52 1e-05
gi|24432030|ref|NP_443072.2| bruno-like 6, RNA binding protein; ... 52 1e-05
gi|49523226|gb|AAH75294.1| Unknown (protein for MGC:88935) [Xeno... 52 1e-05
gi|34863785|ref|XP_236307.2| similar to bruno-like 6, RNA bindin... 52 1e-05
gi|19113271|ref|NP_596479.1| putative rna-binding protein [Schiz... 52 1e-05
gi|13435438|gb|AAH04587.1| Pabpc1 protein [Mus musculus] 52 1e-05
gi|11761319|dbj|BAB19129.1| cold-inducible RNA binding protein 2... 52 1e-05
gi|31206851|ref|XP_312392.1| ENSANGP00000012757 [Anopheles gambi... 52 1e-05
gi|23509278|ref|NP_701945.1| RNA binding protein, putative [Plas... 52 1e-05
gi|39580208|emb|CAE71715.1| Hypothetical protein CBG18692 [Caeno... 52 1e-05
gi|21672973|ref|NP_661038.1| RNA-binding protein [Chlorobium tep... 52 1e-05
gi|30687014|ref|NP_197382.3| SC35-like splicing factor, 28 kD (S... 52 1e-05
gi|26452521|dbj|BAC43345.1| putative Serine/arginine rich protei... 52 1e-05
gi|8850217|ref|NP_055284.2| testes-specific heterogenous nuclear... 52 1e-05
gi|49094362|ref|XP_408642.1| hypothetical protein AN4505.2 [Aspe... 52 2e-05
gi|34870953|ref|XP_216517.2| similar to poly(A)-binding protein,... 52 2e-05
gi|2133907|pir||I50511 ribonucleoprotein - zebra fish (fragment)... 52 2e-05
gi|25518109|pir||B86356 T16E15.6 protein - Arabidopsis thaliana ... 52 2e-05
gi|12746392|gb|AAK07474.1| CUG-BP and ETR-3 like factor 3 [Homo ... 52 2e-05
gi|15231200|ref|NP_190806.1| 33 kDa ribonucleoprotein, chloropla... 52 2e-05
gi|27369577|ref|NP_766022.1| CUG-BP and ETR-3 like factor 3 [Mus... 52 2e-05
gi|29788772|ref|NP_009116.2| trinucleotide repeat containing 4; ... 52 2e-05
gi|47225325|emb|CAG09825.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|31216005|ref|XP_316147.1| ENSANGP00000020466 [Anopheles gambi... 52 2e-05
gi|31202545|ref|XP_310221.1| ENSANGP00000005501 [Anopheles gambi... 52 2e-05
gi|38087156|ref|XP_133707.2| RIKEN cDNA 1700012H05 [Mus musculus... 52 2e-05
gi|18395106|ref|NP_564168.1| RNA recognition motif (RRM)-contain... 52 2e-05
gi|17508585|ref|NP_493022.1| small nucleic-acid-binding protein,... 52 2e-05
gi|4502847|ref|NP_001271.1| cold inducible RNA binding protein; ... 52 2e-05
gi|30585341|gb|AAP36943.1| Homo sapiens cold inducible RNA bindi... 52 2e-05
gi|46914957|emb|CAG21732.1| hypothetical RNA-binding protein [Ph... 52 2e-05
gi|35505506|gb|AAH57796.1| Testes-specific heterogenous nuclear ... 52 2e-05
gi|35505365|gb|AAH57553.1| Tnrc4 protein [Mus musculus] 52 2e-05
gi|34535789|dbj|BAC87434.1| unnamed protein product [Homo sapiens] 52 2e-05
gi|28557621|gb|AAO45216.1| RE27227p [Drosophila melanogaster] 51 2e-05
gi|23479626|gb|EAA16403.1| FCA gamma-related [Plasmodium yoelii ... 51 2e-05
gi|15231284|ref|NP_190834.1| RNA recognition motif (RRM)-contain... 51 2e-05
gi|28277433|gb|AAH45277.1| Hug protein [Danio rerio] 51 2e-05
gi|34913294|ref|NP_917994.1| putative serine/arginine-rich prote... 51 2e-05
gi|49117075|gb|AAH72902.1| Unknown (protein for MGC:80352) [Xeno... 51 2e-05
gi|18402769|ref|NP_564554.1| polyadenylate-binding protein, puta... 51 2e-05
gi|23490683|gb|EAA22401.1| ribonucleoprotein homolog F21B7.26 - ... 51 2e-05
gi|17137710|ref|NP_477453.1| CG7697-PA [Drosophila melanogaster]... 51 2e-05
gi|29654486|ref|NP_820178.1| nucleic acid binding domain protein... 51 2e-05
gi|39580202|emb|CAE71709.1| Hypothetical protein CBG18686 [Caeno... 51 2e-05
gi|31239757|ref|XP_320292.1| ENSANGP00000016629 [Anopheles gambi... 51 2e-05
gi|47271546|ref|NP_112409.2| cold inducible RNA-binding protein ... 51 2e-05
gi|6680946|ref|NP_031731.1| cold inducible RNA binding protein; ... 51 2e-05
gi|46229319|gb|EAK90168.1| U2 snRNP. Hsh49p, RRM domain containi... 51 2e-05
gi|23619509|ref|NP_705471.1| RNA binding protein, putative [Plas... 51 2e-05
gi|32399025|emb|CAD98265.1| splicing factor, probable [Cryptospo... 51 2e-05
gi|33146902|dbj|BAC79901.1| putative SC35-like splicing factor S... 51 2e-05
gi|24649072|ref|NP_651066.2| CG6937-PA [Drosophila melanogaster]... 51 2e-05
gi|27730131|ref|XP_217884.1| similar to RIKEN cDNA 4932702K14 [R... 51 2e-05
gi|17945733|gb|AAL48915.1| RE32504p [Drosophila melanogaster] 51 2e-05
gi|38636774|dbj|BAD03017.1| putative RNA recognition motif (RRM)... 51 2e-05
gi|4098580|gb|AAD00327.1| RBM1 [Macropus eugenii] 51 3e-05
gi|30353795|gb|AAH52100.1| Pabpc1-prov protein [Xenopus laevis] 51 3e-05
gi|64970|emb|CAA40721.1| polyA binding protein [Xenopus laevis] 51 3e-05
gi|585638|sp|P21187|PABP_DROME Polyadenylate-binding protein (Po... 51 3e-05
gi|12746396|gb|AAK07476.1| CUG-BP and ETR-3 like factor 5 [Homo ... 51 3e-05
gi|1705652|sp|P52299|CB20_XENLA Nuclear cap binding protein subu... 51 3e-05
gi|15239505|ref|NP_200911.1| RNA-binding protein, putative [Arab... 51 3e-05
gi|17064758|gb|AAL32533.1| ubiquitin / ribosomal protein CEP52 [... 51 3e-05
gi|24215251|ref|NP_712732.1| putative glycine-rich RNA binding p... 51 3e-05
gi|50750668|ref|XP_422088.1| PREDICTED: hypothetical protein XP_... 51 3e-05
gi|47219191|emb|CAG11209.1| unnamed protein product [Tetraodon n... 51 3e-05
gi|418855|pir||S30887 polyadenylate-binding protein - fruit fly ... 51 3e-05
gi|34783857|gb|AAH56844.1| MGC64376 protein [Xenopus laevis] 51 3e-05
gi|24762232|ref|NP_068757.2| bruno-like 5, RNA binding protein; ... 51 3e-05
gi|49073864|ref|XP_401109.1| hypothetical protein UM03494.1 [Ust... 51 3e-05
gi|22298986|ref|NP_682233.1| RNA binding protein [Thermosynechoc... 51 3e-05
gi|46391109|gb|AAS90636.1| unknown protein [Oryza sativa (japoni... 51 3e-05
gi|17508587|ref|NP_493023.1| small nucleic-acid-binding protein;... 51 3e-05
gi|45201218|ref|NP_986788.1| AGR122Cp [Eremothecium gossypii] >g... 51 3e-05
gi|17136378|ref|NP_476667.1| CG5119-PA [Drosophila melanogaster]... 51 3e-05
gi|50728210|ref|XP_416034.1| PREDICTED: similar to MADP-1 protei... 51 3e-05
gi|50307397|ref|XP_453677.1| unnamed protein product [Kluyveromy... 51 3e-05
gi|23346437|ref|NP_694693.1| splicing factor 3b, subunit 4; spli... 50 4e-05
gi|5032069|ref|NP_005841.1| splicing factor 3b, subunit 4; splic... 50 4e-05
gi|9843657|emb|CAC03602.1| SC35-like splicing factor SCL30, 30 k... 50 4e-05
gi|18410283|ref|NP_567021.1| SC35-like splicing factor, 30 kD (S... 50 4e-05
gi|45360881|ref|NP_989116.1| Spx-prov protein [Xenopus tropicali... 50 4e-05
gi|12230584|sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chl... 50 4e-05
gi|11358671|pir||T47685 probable RNA binding protein - Arabidops... 50 4e-05
gi|19112906|ref|NP_596114.1| RNA binding ribonucleoprotein [Schi... 50 4e-05
gi|49903766|gb|AAH77024.1| Unknown (protein for MGC:89821) [Xeno... 50 4e-05
gi|21355069|ref|NP_650473.1| CG5213-PA [Drosophila melanogaster]... 50 4e-05
gi|50604232|gb|AAH77458.1| Unknown (protein for MGC:82420) [Xeno... 50 4e-05
gi|34303937|ref|NP_689798.1| RNA binding motif protein, Y-linked... 50 4e-05
gi|631384|pir||B49418 spermatogenesis factor AZF (clone MK29) - ... 50 4e-05
gi|4379044|emb|CAA53660.1| YRRM2 [Homo sapiens] 50 4e-05
gi|20975278|dbj|BAB92956.1| cold inducible RNA-binding protein b... 50 4e-05
gi|48142250|ref|XP_397316.1| similar to CG12357-PA [Apis mellifera] 50 4e-05
gi|49619013|gb|AAT68091.1| KIAA0682-like [Danio rerio] 50 4e-05
gi|46446527|ref|YP_007892.1| probable nucleic acid-binding prote... 50 4e-05
gi|28374170|gb|AAH45264.1| Spx-prov protein [Xenopus laevis] 50 4e-05
gi|50794775|ref|XP_423721.1| PREDICTED: similar to Splicing fact... 50 4e-05
gi|34858075|ref|XP_238245.2| similar to Sf3b4 protein [Rattus no... 50 4e-05
gi|50786879|ref|XP_423502.1| PREDICTED: similar to cold inducibl... 50 4e-05
gi|15217573|ref|NP_177322.1| polyadenylate-binding protein 5 (PA... 50 4e-05
gi|20975276|dbj|BAB92955.1| cold inducible RNA-binding protein a... 50 4e-05
gi|166786|gb|AAA32832.1| poly(A)-binding protein 50 4e-05
gi|34193906|gb|AAH56532.1| Splicing factor 3b, subunit 4 [Danio ... 50 4e-05
gi|18411885|ref|NP_565175.1| RNA recognition motif (RRM)-contain... 50 5e-05
gi|32405932|ref|XP_323579.1| hypothetical protein [Neurospora cr... 50 5e-05
gi|31201653|ref|XP_309774.1| ENSANGP00000012477 [Anopheles gambi... 50 5e-05
gi|42572157|ref|NP_974169.1| RNA recognition motif (RRM)-contain... 50 5e-05
gi|27364592|ref|NP_760120.1| RNA-binding proteins [Vibrio vulnif... 50 5e-05
gi|41147872|ref|XP_374607.1| similar to Splicing factor, arginin... 50 5e-05
gi|48104365|ref|XP_392940.1| similar to ENSANGP00000015053 [Apis... 50 5e-05
gi|681912|dbj|BAA06523.1| cp33 [Arabidopsis thaliana] 50 5e-05
gi|9964085|gb|AAG09816.1| cold-inducible RNA binding protein XCI... 50 5e-05
gi|50256481|gb|EAL19206.1| hypothetical protein CNBH3050 [Crypto... 50 5e-05
gi|45528450|ref|ZP_00179649.1| COG0724: RNA-binding proteins (RR... 50 5e-05
gi|42415867|gb|AAS15801.1| sex lethal [Drosophila melanogaster] ... 50 5e-05
gi|25405025|pir||H96811 protein F3F9.20 [imported] - Arabidopsis... 50 5e-05
gi|48095502|ref|XP_392307.1| similar to CG17838-PE [Apis mellifera] 50 5e-05
gi|42659784|ref|XP_372429.2| similar to FLJ10251 protein [Homo s... 50 5e-05
gi|38345560|emb|CAE03434.2| OSJNBa0032F06.17 [Oryza sativa (japo... 50 5e-05
gi|34419622|ref|NP_570951.2| poly(A) binding protein, cytoplasmi... 50 7e-05
gi|24582417|ref|NP_723245.1| CG11266-PC [Drosophila melanogaster... 50 7e-05
gi|48734702|gb|AAH71591.1| PABPC4 protein [Homo sapiens] 50 7e-05
gi|7673355|gb|AAF66823.1| poly(A)-binding protein [Nicotiana tab... 50 7e-05
gi|13096978|gb|AAH03283.1| Poly(A) binding protein, cytoplasmic ... 50 7e-05
gi|50508361|dbj|BAD30314.1| putative apoptosis-related RNA bindi... 50 7e-05
gi|47682782|gb|AAH70262.1| RNA binding motif protein 7 [Homo sap... 50 7e-05
gi|452936|gb|AAB28794.1| 60 kda non-pathogenic specific antigen ... 50 7e-05
gi|34897348|ref|NP_910020.1| putative small nuclear ribonucleopr... 50 7e-05
gi|41388837|gb|AAH65540.1| PABPC4 protein [Homo sapiens] 50 7e-05
gi|33354192|dbj|BAC81150.1| putative CUG triplet repeat RNA-bind... 50 7e-05
gi|22507391|ref|NP_683717.1| poly(A) binding protein, cytoplasmi... 50 7e-05
gi|32407122|ref|XP_324156.1| hypothetical protein [Neurospora cr... 50 7e-05
gi|4504715|ref|NP_003810.1| poly A binding protein, cytoplasmic ... 50 7e-05
gi|40714682|gb|AAR88588.1| putative RNA binding protein [Oryza s... 50 7e-05
gi|41151765|ref|XP_372292.1| similar to RNA binding motif protei... 50 7e-05
gi|4826974|ref|NP_005049.1| RNA binding motif protein, Y-linked,... 50 7e-05
gi|88405|pir||PS0381 polyadenylate-binding protein II - human (f... 50 7e-05
gi|47124558|gb|AAH70298.1| Unknown (protein for MGC:88295) [Homo... 50 7e-05
gi|1033165|gb|AAC16917.1| Y-chromosome RNA recognition motif pro... 50 7e-05
gi|31074955|gb|AAP42141.1| RNA-binding protein 5 [Trypanosoma cr... 50 7e-05
gi|39580201|emb|CAE71708.1| Hypothetical protein CBG18685 [Caeno... 50 7e-05
gi|24216457|ref|NP_713938.1| RNA-binding protein [Leptospira int... 50 7e-05
gi|33146621|dbj|BAC79909.1| putative splicing factor, arginine/s... 50 7e-05
gi|6324895|ref|NP_014964.1| U2-snRNP associated splicing factor ... 50 7e-05
gi|5007080|gb|AAD37807.1| poly(A)-binding protein [Oryza sativa] 50 7e-05
gi|15238220|ref|NP_196080.1| RNA recognition motif (RRM)-contain... 50 7e-05
gi|37522494|ref|NP_925871.1| RNA-binding protein [Gloeobacter vi... 50 7e-05
gi|49671136|gb|AAH75189.1| Unknown (protein for MGC:82154) [Xeno... 50 7e-05
gi|19920866|ref|NP_609095.1| CG11266-PB [Drosophila melanogaster... 50 7e-05
gi|34899186|ref|NP_910939.1| CUG triplet repeat RNA-binding prot... 50 7e-05
gi|47220043|emb|CAG12191.1| unnamed protein product [Tetraodon n... 49 9e-05
gi|50545625|ref|XP_500351.1| hypothetical protein [Yarrowia lipo... 49 9e-05
gi|31233646|ref|XP_318916.1| ENSANGP00000015053 [Anopheles gambi... 49 9e-05
gi|15219486|ref|NP_177494.1| RNA recognition motif (RRM)-contain... 49 9e-05
gi|13279134|gb|AAH04289.1| RBM19 protein [Homo sapiens] >gnl|BL_... 49 9e-05
gi|7705365|ref|NP_057280.1| RNA binding motif protein 19 [Homo s... 49 9e-05
gi|13124658|sp|Q9Y4C8|K682_HUMAN Probable RNA-binding protein KI... 49 9e-05
gi|6321013|ref|NP_011092.1| Poly(A) binding protein, cytoplasmic... 49 9e-05
gi|6755298|ref|NP_035383.1| RNA binding motif protein, Y chromos... 49 9e-05
gi|40788328|dbj|BAA31657.2| KIAA0682 protein [Homo sapiens] 49 9e-05
gi|172092|gb|AAA34838.1| polyadenylate-binding protein 49 9e-05
gi|19111886|ref|NP_595094.1| RNA-binding protein [Schizosaccharo... 49 9e-05
gi|1843458|gb|AAB81555.1| Rbm 49 9e-05
gi|41055454|ref|NP_956710.1| hypothetical protein MGC64175 [Dani... 49 9e-05
gi|38707995|ref|NP_944597.1| nil per os [Danio rerio] >gnl|BL_OR... 49 9e-05
gi|48894880|ref|ZP_00327989.1| COG0724: RNA-binding proteins (RR... 49 9e-05
gi|23123859|ref|ZP_00105894.1| COG0724: RNA-binding proteins (RR... 49 9e-05
gi|23125104|ref|ZP_00107052.1| COG0724: RNA-binding proteins (RR... 49 9e-05
gi|50551975|ref|XP_503462.1| hypothetical protein [Yarrowia lipo... 49 9e-05
gi|7767195|pdb|1D9A|A Chain A, Solution Structure Of The Second ... 49 9e-05
gi|45525449|ref|ZP_00176683.1| COG0724: RNA-binding proteins (RR... 49 9e-05
gi|9843655|emb|CAC03601.1| SC35-like splicing factor SCL28, 28 k... 49 9e-05
gi|29735276|ref|XP_294247.1| similar to Splicing factor, arginin... 49 9e-05
gi|50725127|dbj|BAD33744.1| putative MADP-1 protein [Oryza sativ... 49 9e-05
gi|17532857|ref|NP_493673.1| ELAV-Type RNA binding protein, musc... 49 1e-04
gi|4803739|dbj|BAA77512.1| cold-inducible RNA-binding protein [C... 49 1e-04
gi|30583899|gb|AAP36198.1| Homo sapiens nuclear cap binding prot... 49 1e-04
gi|49098356|ref|XP_410638.1| hypothetical protein AN6501.2 [Aspe... 49 1e-04
gi|15293081|gb|AAK93651.1| unknown protein [Arabidopsis thaliana] 49 1e-04
gi|11358835|pir||T50647 serine/arginine-rich protein [imported] ... 49 1e-04
gi|47219550|emb|CAG09904.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|6325079|ref|NP_015147.1| cap binding complex; Cbc2p [Saccharo... 49 1e-04
gi|34867444|ref|XP_221731.2| similar to RNA binding motif protei... 49 1e-04
gi|100903|pir||S23780 nucleic acid-binding protein - maize >gnl|... 49 1e-04
>gi|17533393|ref|NP_495778.1| eukaryotic Initiation Factor (eif-3.G)
[Caenorhabditis elegans]
gi|3024026|sp|Q19706|IF34_CAEEL Probable eukaryotic translation
initiation factor 3 subunit 4 (eIF-3 delta) (eIF3 p44)
(eIF-3 RNA-binding subunit) (eIF3g)
gi|7499631|pir||T21238 hypothetical protein F22B5.2 -
Caenorhabditis elegans
gi|3876226|emb|CAA90354.1| Hypothetical protein F22B5.2
[Caenorhabditis elegans]
Length = 256
Score = 499 bits (1285), Expect = e-140
Identities = 243/256 (94%), Positives = 243/256 (94%)
Frame = +1
Query: 1 MAPAPEVVSWAEAVEQDNAPHIQEGADGTRTETAFTEVDGVRWKVVTQFKVINKRVPKVV 180
MAPAPEVVSWAEAVEQDNAPHIQEGADGTRTETAFTEVDGVRWKVVTQFKVINKRVPKVV
Sbjct: 1 MAPAPEVVSWAEAVEQDNAPHIQEGADGTRTETAFTEVDGVRWKVVTQFKVINKRVPKVV 60
Query: 181 ADRKKWVKFGSCKGEPAGPQVATTYVAEEVDMQFTRNRAGEQILDVQEDKQTAKTTSREH 360
ADRKKWVKFGSCKGEPAGPQVATTYVAEEVDMQFTRNRAGEQILDVQEDKQTAKTTSREH
Sbjct: 61 ADRKKWVKFGSCKGEPAGPQVATTYVAEEVDMQFTRNRAGEQILDVQEDKQTAKTTSREH 120
Query: 361 CRHCKGNDHWSTHCPYKVMYQLXXXXXXXXXXXXXRMAMGMRPDGRQIDRNRSDENTCRV 540
CRHCKGNDHWSTHCPYKVMYQL RMAMGMRPDGRQIDRNRSDENTCRV
Sbjct: 121 CRHCKGNDHWSTHCPYKVMYQLDEEADADKDTEKDRMAMGMRPDGRQIDRNRSDENTCRV 180
Query: 541 TNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIAELNDI 720
TNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIAELNDI
Sbjct: 181 TNLPQEMNEDELRDLFGKIGRVIRIFIARDKVTGLPKGFAFVTFESRDDAARAIAELNDI 240
Query: 721 RMYHMVLKVEWTRPSN 768
RMYHMVLKVEWTRPSN
Sbjct: 241 RMYHMVLKVEWTRPSN 256