Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F22B7_5
(963 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|39587366|emb|CAE75020.1| Hypothetical protein CBG22924 [Caeno... 551 e-156
gi|25144330|ref|NP_498903.2| TWiK family of potassium channels (... 551 e-156
gi|1078847|pir||S44635 f22b7.7 protein - Caenorhabditis elegans 542 e-153
gi|17555324|ref|NP_499790.1| twk-8 protein like family member (3... 205 1e-51
gi|39591758|emb|CAE71336.1| Hypothetical protein CBG18237 [Caeno... 204 2e-51
gi|25147096|ref|NP_508732.2| twk-8 protein like family member (X... 192 9e-48
gi|34850053|gb|AAK39218.3| Twik family of potassium channels pro... 192 9e-48
gi|39597860|emb|CAE68552.1| Hypothetical protein CBG14385 [Caeno... 191 2e-47
gi|25395539|pir||H88124 protein T12C9.3 [imported] - Caenorhabdi... 189 1e-46
gi|39587874|emb|CAE67892.1| Hypothetical protein CBG13488 [Caeno... 187 3e-46
gi|7497822|pir||T28933 hypothetical protein C52B9.6 - Caenorhabd... 182 1e-44
gi|7500584|pir||T21834 hypothetical protein F36A2.4 - Caenorhabd... 127 3e-28
gi|31441785|emb|CAB03071.3| C. elegans TWK-30 protein (correspon... 127 3e-28
gi|17507181|ref|NP_492381.1| fibronectin, type III and ion trans... 127 3e-28
gi|39589742|emb|CAE66977.1| Hypothetical protein CBG12373 [Caeno... 127 4e-28
gi|39590497|emb|CAE66237.1| Hypothetical protein CBG11481 [Caeno... 126 8e-28
gi|17564896|ref|NP_506416.1| TWiK family of potassium channels (... 125 1e-27
gi|39584578|emb|CAE74656.1| Hypothetical protein CBG22456 [Caeno... 124 2e-27
gi|32566087|ref|NP_502685.2| putative protein family member, wit... 124 2e-27
gi|7509540|pir||T26616 hypothetical protein Y37A1B.11 - Caenorha... 124 2e-27
gi|31211993|ref|XP_314981.1| ENSANGP00000021390 [Anopheles gambi... 115 1e-24
gi|25151930|ref|NP_741843.1| putative potassium channel subunit ... 115 2e-24
gi|25151936|ref|NP_741845.1| putative potassium channel subunit ... 115 2e-24
gi|25151933|ref|NP_741842.1| putative potassium channel subunit ... 115 2e-24
gi|25151939|ref|NP_741846.1| putative potassium channel subunit ... 115 2e-24
gi|21392667|gb|AAM51529.1| Hypothetical protein C44E12.3a [Caeno... 115 2e-24
gi|25151942|ref|NP_741844.1| putative potassium channel subunit ... 115 2e-24
gi|24641306|ref|NP_572720.1| CG1756-PA [Drosophila melanogaster]... 113 7e-24
gi|17536221|ref|NP_494786.1| twk-8 protein like family member (2... 111 2e-23
gi|49035146|gb|AAK18976.2| Twik family of potassium channels pro... 111 2e-23
gi|7500371|pir||T21683 hypothetical protein F32H5.2 - Caenorhabd... 107 4e-22
gi|17542648|ref|NP_501724.1| TWiK family of potassium channels (... 106 7e-22
gi|17536611|ref|NP_495961.1| TWiK family of potassium channels (... 106 7e-22
gi|39582439|emb|CAE74823.1| Hypothetical protein CBG22661 [Caeno... 106 7e-22
gi|39594882|emb|CAE70750.1| Hypothetical protein CBG17497 [Caeno... 105 2e-21
gi|25147267|ref|NP_741881.1| UNCoordinated locomotion UNC-110, M... 105 2e-21
gi|25147270|ref|NP_741880.1| UNCoordinated locomotion UNC-110, M... 105 2e-21
gi|39591002|emb|CAE58782.1| Hypothetical protein CBG01980 [Caeno... 104 3e-21
gi|25147273|ref|NP_508526.2| potassium channel subunit n2P16 fam... 102 1e-20
gi|17536609|ref|NP_495727.1| TWiK family of potassium channels (... 102 1e-20
gi|7503954|pir||T16426 hypothetical protein F52E4.4 - Caenorhabd... 102 1e-20
gi|38075345|ref|XP_141526.2| similar to Potassium channel subfam... 101 2e-20
gi|39587238|emb|CAE57706.1| Hypothetical protein CBG00713 [Caeno... 101 3e-20
gi|17570153|ref|NP_510305.1| TWiK family of potassium channels (... 100 5e-20
gi|39589137|emb|CAE57870.1| Hypothetical protein CBG00910 [Caeno... 100 5e-20
gi|50740491|ref|XP_419477.1| PREDICTED: similar to potassium cha... 100 5e-20
gi|39596343|emb|CAE69981.1| Hypothetical protein CBG16379 [Caeno... 100 5e-20
gi|39930507|ref|NP_570826.1| potassium channel, subfamily K, mem... 100 6e-20
gi|39597681|emb|CAE68372.1| Hypothetical protein CBG14128 [Caeno... 100 8e-20
gi|39596461|emb|CAE63080.1| Hypothetical protein CBG07369 [Caeno... 99 1e-19
gi|47229323|emb|CAG04075.1| unnamed protein product [Tetraodon n... 99 2e-19
gi|7507331|pir||T24626 hypothetical protein T06H11.1 - Caenorhab... 99 2e-19
gi|17570149|ref|NP_509516.1| TWiK family of potassium channels (... 98 2e-19
gi|39588079|emb|CAE57311.1| Hypothetical protein CBG00233 [Caeno... 98 2e-19
gi|7496375|pir||T15584 hypothetical protein C24A3.6 - Caenorhabd... 98 2e-19
gi|47225555|emb|CAG12038.1| unnamed protein product [Tetraodon n... 97 4e-19
gi|20870425|ref|XP_138942.1| RIKEN cDNA 4731413G05 [Mus musculus] 96 9e-19
gi|33300325|emb|CAE17863.1| Hypothetical protein K11H3.7 [Caenor... 96 9e-19
gi|34868980|ref|XP_223777.2| similar to dJ137F1.2 (novel member ... 96 9e-19
gi|25513799|pir||JC7703 TASK-5 protein - human 96 9e-19
gi|11641275|ref|NP_071753.1| potassium family, subfamily K, memb... 96 9e-19
gi|9988112|emb|CAC07336.1| dJ137F1.2 (novel member of the potass... 96 1e-18
gi|14149764|ref|NP_115491.1| potassium channel, subfamily K, mem... 96 1e-18
gi|39590727|emb|CAE65097.1| Hypothetical protein CBG09957 [Caeno... 96 1e-18
gi|32454070|gb|AAP82866.1| pancreatic potassium channel TALK-1b ... 96 2e-18
gi|10801598|dbj|BAB16710.1| TASK1 splice bvariant (TASK1b) [Ratt... 96 2e-18
gi|4103376|gb|AAD09338.1| putative potassium channel DP4 [Mus mu... 96 2e-18
gi|32454074|gb|AAP82868.1| pancreatic potassium channel TALK-1d ... 96 2e-18
gi|33859576|ref|NP_034738.1| potassium channel, subfamily K, mem... 96 2e-18
gi|15431283|ref|NP_203694.1| potassium channel, subfamily K, mem... 96 2e-18
gi|2465544|gb|AAC53367.1| TWIK-related acid-sensitive K+ channel... 95 2e-18
gi|31228794|ref|XP_318112.1| ENSANGP00000017590 [Anopheles gambi... 95 3e-18
gi|7503519|pir||T22269 hypothetical protein F46A9.3 - Caenorhabd... 94 6e-18
gi|39595158|emb|CAE60195.1| Hypothetical protein CBG03756 [Caeno... 94 6e-18
gi|47216202|emb|CAG01236.1| unnamed protein product [Tetraodon n... 94 6e-18
gi|32562837|ref|NP_492511.2| putative protein family member, wit... 94 6e-18
gi|10944275|emb|CAC14068.1| dJ781B1.1 (Two pore potassium channe... 93 8e-18
gi|4504849|ref|NP_002237.1| potassium channel, subfamily K, memb... 93 1e-17
gi|15419623|gb|AAK97094.1| tandem acid-sensitive potassium chann... 92 1e-17
gi|48124394|ref|XP_396556.1| similar to CG8713-PA [Apis mellifera] 92 1e-17
gi|7706135|ref|NP_057685.1| potassium channel, subfamily K, memb... 92 2e-17
gi|16758136|ref|NP_445857.1| potassium channel, subfamily K, mem... 91 3e-17
gi|39584817|emb|CAE67712.1| Hypothetical protein CBG13286 [Caeno... 91 4e-17
gi|13431425|sp|Q9JL58|CIW9_CAVPO Potassium channel subfamily K m... 91 5e-17
gi|25146228|ref|NP_506091.2| TWiK family of potassium channels (... 91 5e-17
gi|39594328|emb|CAE71906.1| Hypothetical protein CBG18967 [Caeno... 91 5e-17
gi|7506281|pir||T23907 hypothetical protein R04F11.4 - Caenorhab... 91 5e-17
gi|39592237|emb|CAE75458.1| Hypothetical protein CBG23453 [Caeno... 91 5e-17
gi|14583127|gb|AAK69764.1| potassium channel TASK-3 [Rattus norv... 90 7e-17
gi|24636274|sp|Q9ES08|CIW9_RAT Potassium channel subfamily K mem... 90 7e-17
gi|50758683|ref|XP_417369.1| PREDICTED: similar to Potassium cha... 90 7e-17
gi|32454072|gb|AAP82867.1| pancreatic potassium channel TALK-1c ... 90 9e-17
gi|11359804|pir||T43393 potassium channel chain n2P17m3 homolog ... 89 1e-16
gi|24656702|ref|NP_611547.1| CG15655-PA [Drosophila melanogaster... 88 3e-16
gi|31207013|ref|XP_312473.1| ENSANGP00000021888 [Anopheles gambi... 88 3e-16
gi|34855627|ref|XP_215230.2| hypothetical protein XP_215230 [Rat... 87 6e-16
gi|41055407|ref|NP_956927.1| hypothetical protein MGC63921 [Dani... 87 6e-16
gi|48094838|ref|XP_394281.1| similar to ENSANGP00000013427 [Apis... 86 1e-15
gi|16758650|ref|NP_446258.1| potassium channel, subfamily K, mem... 86 1e-15
gi|39584651|emb|CAE72404.1| Hypothetical protein CBG19563 [Caeno... 86 1e-15
gi|17560382|ref|NP_508031.1| putative protein family member, wit... 86 1e-15
gi|31043788|emb|CAB07375.2| Hypothetical protein F31D4.7 [Caenor... 86 1e-15
gi|39582763|emb|CAE74226.1| Hypothetical protein CBG21910 [Caeno... 86 2e-15
gi|48120923|ref|XP_396471.1| similar to ENSANGP00000021888 [Apis... 86 2e-15
gi|39590077|emb|CAE61075.1| Hypothetical protein CBG04825 [Caeno... 86 2e-15
gi|39585309|emb|CAE61631.1| Hypothetical protein CBG05561 [Caeno... 86 2e-15
gi|17564904|ref|NP_504663.1| predicted CDS, TWiK family of potas... 85 2e-15
gi|28704121|gb|AAH47247.1| Kcnk6-prov protein [Xenopus laevis] 85 2e-15
gi|47224316|emb|CAG09162.1| unnamed protein product [Tetraodon n... 85 2e-15
gi|48095690|ref|XP_394509.1| similar to CG9637-PA [Apis mellifera] 85 2e-15
gi|38086199|ref|XP_355877.1| similar to potassium channel, subfa... 85 3e-15
gi|31240391|ref|XP_320609.1| ENSANGP00000010680 [Anopheles gambi... 85 3e-15
gi|17570155|ref|NP_510654.1| predicted CDS, TWiK family of potas... 85 3e-15
gi|17536613|ref|NP_494333.1| TWiK family of potassium channels (... 85 3e-15
gi|47227295|emb|CAF96844.1| unnamed protein product [Tetraodon n... 85 3e-15
gi|7511511|pir||T32347 outward rectifier potassium channel homol... 85 3e-15
gi|4758624|ref|NP_004814.1| potassium channel, subfamily K, memb... 84 5e-15
gi|50740494|ref|XP_419478.1| PREDICTED: similar to potassium cha... 84 5e-15
gi|17550920|ref|NP_510284.1| TWiK family of potassium channels (... 84 5e-15
gi|7497246|pir||T19860 hypothetical protein C40C9.1 - Caenorhabd... 84 5e-15
gi|11496265|ref|NP_067517.1| potassium channel, subfamily K, mem... 84 6e-15
gi|29835154|gb|AAH51088.1| Kcnk5 protein [Mus musculus] 84 6e-15
gi|7505363|pir||T23373 hypothetical protein K06B4.12 - Caenorhab... 84 6e-15
gi|25146143|ref|NP_506906.2| potassium channel TWIK-1 family mem... 84 6e-15
gi|26331778|dbj|BAC29619.1| unnamed protein product [Mus musculus] 84 6e-15
gi|39594738|emb|CAE70606.1| Hypothetical protein CBG17283 [Caeno... 84 6e-15
gi|17530889|ref|NP_511112.1| CG1615-PB [Drosophila melanogaster]... 83 8e-15
gi|24645352|ref|NP_649891.1| CG9361-PA [Drosophila melanogaster]... 83 8e-15
gi|27807011|ref|NP_776983.1| potassium channel, subfamily K, mem... 83 8e-15
gi|39594463|emb|CAE72041.1| Hypothetical protein CBG19123 [Caeno... 83 1e-14
gi|17570457|ref|NP_509942.1| ion transport protein family member... 83 1e-14
gi|48102756|ref|XP_395425.1| similar to ENSANGP00000021246 [Apis... 82 1e-14
gi|4504851|ref|NP_003731.1| potassium channel, subfamily K, memb... 82 1e-14
gi|7509931|pir||T26953 hypothetical protein Y47D3B.5 - Caenorhab... 82 2e-14
gi|39596487|emb|CAE63106.1| Hypothetical protein CBG07401 [Caeno... 82 2e-14
gi|50748854|ref|XP_421431.1| PREDICTED: similar to potassium cha... 82 2e-14
gi|32565295|ref|NP_499470.2| putative protein family member, wit... 82 2e-14
gi|24647970|ref|NP_650726.1| CG10864-PA [Drosophila melanogaster... 81 3e-14
gi|39585409|emb|CAE61731.1| Hypothetical protein CBG05682 [Caeno... 81 4e-14
gi|17559912|ref|NP_504783.1| ion transport protein family member... 81 4e-14
gi|17559910|ref|NP_504782.1| ion transport protein family member... 81 4e-14
gi|19921794|ref|NP_610349.1| CG8713-PA [Drosophila melanogaster]... 81 4e-14
gi|32566714|ref|NP_872139.1| ion transport protein family member... 81 4e-14
gi|27503347|gb|AAH42262.1| MGC53410 protein [Xenopus laevis] 81 4e-14
gi|7499459|pir||T30037 hypothetical protein F20A1.7 - Caenorhabd... 81 4e-14
gi|39585390|emb|CAE61712.1| Hypothetical protein CBG05661 [Caeno... 80 5e-14
gi|50749036|ref|XP_426457.1| PREDICTED: similar to potassium cha... 80 7e-14
gi|13507377|gb|AAK28551.1| potassium channel TASK-4 [Homo sapiens] 80 7e-14
gi|19343981|gb|AAH25726.1| Potassium channel, subfamily K, membe... 80 7e-14
gi|17025230|ref|NP_113648.2| potassium channel, subfamily K, mem... 80 7e-14
gi|39580228|emb|CAE72984.1| Hypothetical protein CBG20326 [Caeno... 80 7e-14
gi|17565098|ref|NP_507480.1| potassium channel TWIK-1 family mem... 80 7e-14
gi|9988111|emb|CAC07335.1| dJ137F1.1 (novel member of the potass... 80 7e-14
gi|47229993|emb|CAG10407.1| unnamed protein product [Tetraodon n... 80 9e-14
gi|31204249|ref|XP_311073.1| ENSANGP00000017384 [Anopheles gambi... 80 9e-14
gi|39593815|emb|CAE62108.1| Hypothetical protein CBG06143 [Caeno... 80 9e-14
gi|47217179|emb|CAG11015.1| unnamed protein product [Tetraodon n... 79 2e-13
gi|47206503|emb|CAF90084.1| unnamed protein product [Tetraodon n... 79 2e-13
gi|19716292|gb|AAL95706.1| potassium channel TREK2 splice varian... 79 2e-13
gi|19716290|gb|AAL95705.1| potassium channel TREK2 splice varian... 79 2e-13
gi|20143944|ref|NP_612190.1| potassium channel, subfamily K, mem... 79 2e-13
gi|20143946|ref|NP_612191.1| potassium channel, subfamily K, mem... 79 2e-13
gi|50507821|emb|CAB07854.2| Hypothetical protein R12G8.2 [Caenor... 79 2e-13
gi|11359774|pir||T45032 hypothetical protein Y39B6B.f [imported]... 79 2e-13
gi|25151576|ref|NP_741678.1| potassium channel TWIK-1 (36.4 kD) ... 79 2e-13
gi|26331130|dbj|BAC29295.1| unnamed protein product [Mus musculus] 79 2e-13
gi|45505228|gb|AAS66991.1| potassium channel TREK-2 [Oryctolagus... 79 2e-13
gi|12831215|ref|NP_075584.1| potassium channel TREK-2 [Rattus no... 79 2e-13
gi|10863961|ref|NP_066984.1| potassium channel, subfamily K, mem... 79 2e-13
gi|17563162|ref|NP_507485.1| potassium channel family member (5S... 79 2e-13
gi|26349569|dbj|BAC38424.1| unnamed protein product [Mus musculus] 79 2e-13
gi|2213891|gb|AAB61602.1| rabKCNK1 [Oryctolagus cuniculus] 78 3e-13
gi|17542646|ref|NP_501578.1| TWiK family of potassium channels (... 78 3e-13
gi|34556101|emb|CAE46687.1| C. elegans TWK-8 protein (correspond... 78 3e-13
gi|50507748|emb|CAB01238.2| Hypothetical protein M04B2.5 [Caenor... 78 3e-13
gi|17542644|ref|NP_502170.1| TWiK family of potassium channels (... 78 3e-13
gi|39586438|emb|CAE74097.1| Hypothetical protein CBG21757 [Caeno... 77 4e-13
gi|24646638|ref|NP_650300.1| CG9637-PA [Drosophila melanogaster]... 77 4e-13
gi|39597677|emb|CAE68368.1| Hypothetical protein CBG14123 [Caeno... 77 6e-13
gi|19110352|gb|AAL82796.1| potassium channel TWIK-2 [Cavia porce... 77 6e-13
gi|39580013|emb|CAE56818.1| Hypothetical protein CBG24632 [Caeno... 77 6e-13
gi|15718767|ref|NP_201567.1| potassium channel, subfamily K, mem... 77 8e-13
gi|7576935|gb|AAF64062.1| tandem pore domain potassium channel T... 77 8e-13
gi|39594139|emb|CAE70249.1| Hypothetical protein CBG16741 [Caeno... 77 8e-13
gi|15718765|ref|NP_057695.2| potassium channel, subfamily K, mem... 77 8e-13
gi|34785960|gb|AAH58054.1| LOC402860 protein [Danio rerio] 76 1e-12
gi|17507109|ref|NP_491692.1| predicted CDS, twk-8 protein like f... 76 1e-12
gi|6680540|ref|NP_032457.1| potassium channel, subfamily K, memb... 76 1e-12
gi|39594957|emb|CAE70825.1| Hypothetical protein CBG17601 [Caeno... 75 2e-12
gi|13124054|sp|O95069|CIW2_HUMAN Potassium channel subfamily K m... 75 2e-12
gi|31198023|ref|XP_307959.1| ENSANGP00000013427 [Anopheles gambi... 75 2e-12
gi|14589851|ref|NP_055032.1| potassium channel, subfamily K, mem... 75 2e-12
gi|5712621|gb|AAD47569.1| TREK-1 potassium channel [Homo sapiens] 75 2e-12
gi|27807241|ref|NP_777111.1| potassium channel, subfamily K, mem... 75 2e-12
gi|19110344|gb|AAL82795.1| potassium channel TWIK-1 [Cavia porce... 75 2e-12
gi|38566067|gb|AAH62094.1| Kcnk2 protein [Mus musculus] 75 2e-12
gi|25282403|ref|NP_742038.1| potassium channel, subfamily K, mem... 75 2e-12
gi|39595411|emb|CAE60449.1| Hypothetical protein CBG04057 [Caeno... 75 2e-12
gi|6754432|ref|NP_034737.1| potassium channel, subfamily K, memb... 75 2e-12
gi|6680538|ref|NP_032456.1| potassium channel, subfamily K, memb... 75 2e-12
gi|50740290|ref|XP_419418.1| PREDICTED: similar to potassium cha... 75 3e-12
gi|39593400|emb|CAE64870.1| Hypothetical protein CBG09670 [Caeno... 74 4e-12
gi|4504847|ref|NP_002236.1| potassium channel, subfamily K, memb... 74 4e-12
gi|17536607|ref|NP_496452.1| TWiK family of potassium channels (... 74 5e-12
gi|50507717|emb|CAA91376.2| Hypothetical protein B0334.2 [Caenor... 74 5e-12
gi|47225271|emb|CAG09771.1| unnamed protein product [Tetraodon n... 74 5e-12
gi|17570151|ref|NP_508522.1| TWiK family of potassium channels (... 74 5e-12
gi|7505938|pir||T16629 hypothetical protein M02F4.5 - Caenorhabd... 74 5e-12
gi|11067417|ref|NP_067720.1| putative potassium channel TWIK [Ra... 74 5e-12
gi|13277636|gb|AAH03729.1| Potassium channel, subfamily K, membe... 74 5e-12
gi|34861038|ref|XP_346569.1| hypothetical protein XP_346568 [Rat... 73 8e-12
gi|50741362|ref|XP_419561.1| PREDICTED: similar to putative pota... 73 8e-12
gi|39597266|emb|CAE59494.1| Hypothetical protein CBG02879 [Caeno... 72 1e-11
gi|18034771|ref|NP_446256.2| potassium inwardly-rectifying chann... 72 1e-11
gi|47219414|emb|CAG01577.1| unnamed protein product [Tetraodon n... 72 2e-11
gi|17565094|ref|NP_507483.1| putative protein family member, wit... 72 2e-11
gi|48107867|ref|XP_396190.1| similar to ENSANGP00000017384 [Apis... 71 3e-11
gi|46434032|gb|EAK93454.1| hypothetical protein CaO19.4175 [Cand... 70 5e-11
gi|45594290|gb|AAS68516.1| 2P K ion channel TRESK [Rattus norveg... 69 2e-10
gi|11560129|ref|NP_071629.1| tandem pore domain potassium channe... 68 3e-10
gi|7496433|pir||T19429 hypothetical protein C24H11.8 - Caenorhab... 68 3e-10
gi|11177516|gb|AAG32314.1| tandem pore domain potassium channel ... 68 3e-10
gi|16306555|ref|NP_071337.2| potassium channel, subfamily K, mem... 68 3e-10
gi|32565622|ref|NP_499529.2| ion transport protein (3M891) [Caen... 68 3e-10
gi|38085211|ref|XP_285304.2| similar to TWIK-related spinal cord... 68 4e-10
gi|39584824|emb|CAE67719.1| Hypothetical protein CBG13294 [Caeno... 68 4e-10
gi|47224354|emb|CAG09200.1| unnamed protein product [Tetraodon n... 67 5e-10
gi|47217756|emb|CAG05978.1| unnamed protein product [Tetraodon n... 67 6e-10
gi|17570157|ref|NP_510655.1| TWiK family of potassium channels (... 67 6e-10
gi|38077857|ref|XP_139424.3| similar to potassium channel TASK3 ... 67 6e-10
gi|50732038|ref|XP_425942.1| PREDICTED: similar to Potassium cha... 67 6e-10
gi|32469495|ref|NP_862823.1| TWIK-related spinal cord K+ channel... 67 8e-10
gi|22122525|ref|NP_666149.1| potassium channel, subfamily K, mem... 66 1e-09
gi|7499553|pir||T21188 hypothetical protein F21C3.1 - Caenorhabd... 65 2e-09
gi|32563600|ref|NP_492054.2| TWiK family of potassium channels (... 65 2e-09
gi|47208750|emb|CAF94456.1| unnamed protein product [Tetraodon n... 65 2e-09
gi|31231315|ref|XP_318503.1| ENSANGP00000021246 [Anopheles gambi... 65 2e-09
gi|17555394|ref|NP_497973.1| TWiK family of potassium channels (... 65 3e-09
gi|7546841|gb|AAF63707.1| potassium channel TASK3 [Cavia porcellus] 64 5e-09
gi|48124383|ref|XP_393264.1| similar to ENSANGP00000017550 [Apis... 64 7e-09
gi|24655040|ref|NP_612084.1| CG9194-PA [Drosophila melanogaster]... 64 7e-09
gi|33636599|gb|AAQ23597.1| RE05370p [Drosophila melanogaster] 64 7e-09
gi|19921934|ref|NP_610516.1| CG1688-PA [Drosophila melanogaster]... 63 9e-09
gi|47221027|emb|CAG12721.1| unnamed protein product [Tetraodon n... 63 1e-08
gi|39592213|emb|CAE75434.1| Hypothetical protein CBG23427 [Caeno... 63 1e-08
gi|39595653|emb|CAE67155.1| Hypothetical protein CBG12580 [Caeno... 62 1e-08
gi|32566708|ref|NP_872137.1| putative protein family member, wit... 62 1e-08
gi|17506133|ref|NP_491810.1| potassium channel DP4 family member... 62 1e-08
gi|17564894|ref|NP_505731.1| TWiK family of potassium channels (... 62 3e-08
gi|17564898|ref|NP_506078.1| TWiK family of potassium channels (... 61 3e-08
gi|47222681|emb|CAG00115.1| unnamed protein product [Tetraodon n... 61 3e-08
gi|50507754|emb|CAH04700.1| Hypothetical protein F55C5.3b [Caeno... 61 3e-08
gi|19882235|ref|NP_084187.1| TREK2; outward rectifying potassium... 61 3e-08
gi|21707910|gb|AAH33577.1| KCNK4 protein [Homo sapiens] 61 4e-08
gi|24528452|gb|AAN62847.1| tandem pore domain potassium channel ... 60 6e-08
gi|11545761|ref|NP_071338.1| potassium channel, subfamily K, mem... 60 7e-08
gi|11560127|ref|NP_071628.1| potassium channel, subfamily K, mem... 60 1e-07
gi|40445393|ref|NP_954859.1| potassium channel, subfamily K, mem... 60 1e-07
gi|17564900|ref|NP_506103.1| TWiK family of potassium channels (... 59 1e-07
gi|31205787|ref|XP_311845.1| ENSANGP00000017550 [Anopheles gambi... 59 1e-07
gi|34899396|ref|NP_911044.1| putative outward-rectifying potassi... 58 4e-07
gi|39592250|emb|CAE75471.1| Hypothetical protein CBG23471 [Caeno... 57 6e-07
gi|48106734|ref|XP_396150.1| similar to ENSANGP00000021390 [Apis... 56 1e-06
gi|16118233|ref|NP_203134.1| potassium channel, subfamily K, mem... 55 2e-06
gi|16118231|ref|NP_203133.1| potassium channel, subfamily K, mem... 55 2e-06
gi|5031821|ref|NP_005705.1| potassium channel, subfamily K, memb... 55 2e-06
gi|28571421|ref|NP_572321.2| CG3367-PA [Drosophila melanogaster]... 55 2e-06
gi|24639778|ref|NP_726963.1| CG32770-PA [Drosophila melanogaster... 55 2e-06
gi|5821141|dbj|BAA35074.1| double-pore K channel 3 [Mus musculus] 55 3e-06
gi|6502965|gb|AAF14528.1| two pore domain potassium channel KCNK... 55 3e-06
gi|8132414|gb|AAF73282.1| two pore domain K+ channel subunit [Mu... 55 3e-06
gi|6649861|gb|AAF21603.1| neuromuscular two P domain potassium c... 55 3e-06
gi|4103374|gb|AAD09337.1| putative potassium channel DP3 [Mus mu... 55 3e-06
gi|4768615|gb|AAD29577.1| two pore domain K+ channel subunit [Mu... 54 4e-06
gi|15234351|ref|NP_192093.1| outward rectifying potassium channe... 54 4e-06
gi|19110360|gb|AAL82798.1| potassium channel KCNK7 [Cavia porcel... 54 4e-06
gi|13124112|sp|Q9Z2T1|CIW8_MOUSE Potassium channel subfamily K m... 54 4e-06
gi|15236780|ref|NP_193550.1| outward rectifying potassium channe... 54 5e-06
gi|15237430|ref|NP_199449.1| outward rectifying potassium channe... 54 7e-06
gi|6686780|emb|CAB64717.1| KCO2 protein [Arabidopsis thaliana] 54 7e-06
gi|50552031|ref|XP_503490.1| hypothetical protein [Yarrowia lipo... 54 7e-06
gi|15217783|ref|NP_171752.1| outward rectifying potassium channe... 53 9e-06
gi|50725050|dbj|BAD33183.1| putative outward-rectifying potassiu... 53 9e-06
gi|38605046|sp|Q9FWX6|KCO4_ARATH Putative outward-rectifying pot... 53 9e-06
gi|13276863|emb|CAC34339.1| K+ channel protein [Solanum tuberosum] 53 1e-05
gi|4151117|emb|CAA12225.1| K+ channel protein [Solanum tuberosum] 53 1e-05
gi|22535558|dbj|BAC10733.1| putative potassium channel [Oryza sa... 52 2e-05
gi|6322368|ref|NP_012442.1| Target Of K1 Killer Toxin; Tok1p [Sa... 52 2e-05
gi|1147595|emb|CAA64176.1| outward-rectifier potassium channel [... 52 2e-05
gi|38102438|gb|EAA49275.1| hypothetical protein MG00933.4 [Magna... 52 2e-05
gi|31228802|ref|XP_318113.1| ENSANGP00000003582 [Anopheles gambi... 52 2e-05
gi|34861469|ref|XP_219517.2| similar to mitogen activated protei... 52 2e-05
gi|7489262|pir||T07396 probable outward rectifying potassium cha... 52 2e-05
gi|50549977|ref|XP_502461.1| hypothetical protein [Yarrowia lipo... 52 3e-05
gi|50311387|ref|XP_455718.1| unnamed protein product [Kluyveromy... 52 3e-05
gi|10801600|dbj|BAB16711.1| TWIK-related acid-sensitive K+ chann... 52 3e-05
gi|47222588|emb|CAG02953.1| unnamed protein product [Tetraodon n... 52 3e-05
gi|20091059|ref|NP_617134.1| potassium channel protein [Methanos... 51 3e-05
gi|9719297|gb|AAF97727.1| Eucalyptus camaldulensis outward-recti... 49 2e-04
gi|21228960|ref|NP_634882.1| Potassium channel protein [Methanos... 48 3e-04
gi|13541819|ref|NP_111507.1| Kef-type K+ transport system, predi... 48 3e-04
gi|46134185|ref|XP_389408.1| hypothetical protein FG09232.1 [Gib... 48 4e-04
gi|47225033|emb|CAF97448.1| unnamed protein product [Tetraodon n... 48 4e-04
gi|28144878|gb|AAO32309.1| putative outward rectifying potassium... 48 4e-04
gi|48138893|ref|XP_396947.1| similar to ENSANGP00000017550 [Apis... 47 5e-04
gi|4323298|gb|AAD16279.1| pulvinus outward-rectifying channel fo... 47 5e-04
gi|17556454|ref|NP_497621.1| predicted CDS, open rectifier K+ ch... 47 6e-04
gi|45357590|ref|NP_987147.1| putative potassium channel protein ... 47 6e-04
gi|50292983|ref|XP_448924.1| unnamed protein product [Candida gl... 47 6e-04
gi|47566930|ref|ZP_00237647.1| potassium channel, putative [Baci... 47 6e-04
gi|42784081|ref|NP_981328.1| conserved hypothetical protein [Bac... 47 6e-04
gi|50590667|ref|ZP_00332025.1| COG1226: Kef-type K+ transport sy... 47 6e-04
gi|23821211|emb|CAD53325.1| potassium channel [Neurospora crassa] 47 8e-04
gi|48838131|ref|ZP_00295079.1| COG1226: Kef-type K+ transport sy... 47 8e-04
gi|24376318|ref|NP_720426.1| conserved hypothetical protein [She... 47 8e-04
gi|32405542|ref|XP_323384.1| hypothetical protein [Neurospora cr... 46 0.001
gi|21397377|ref|NP_653362.1| hypothetical protein predicted by G... 45 0.002
gi|2181186|emb|CAA65988.1| outward rectifying potassium channel ... 45 0.002
gi|15240552|ref|NP_200374.1| outward rectifying potassium channe... 45 0.002
gi|46113983|ref|ZP_00184200.2| COG1226: Kef-type K+ transport sy... 45 0.002
gi|50739068|ref|XP_426109.1| PREDICTED: similar to potassium cha... 45 0.002
gi|46139449|ref|XP_391415.1| hypothetical protein FG11239.1 [Gib... 45 0.002
gi|48854478|ref|ZP_00308640.1| COG1226: Kef-type K+ transport sy... 45 0.003
gi|50085477|ref|YP_046987.1| putative potassium channel protein ... 45 0.003
gi|34874570|ref|XP_237012.2| similar to voltage-gated potassium ... 44 0.004
gi|20094044|ref|NP_613891.1| Kef-type K+ transport systems, pred... 44 0.004
gi|14285403|sp|Q9NR82|CIQ5_HUMAN Potassium voltage-gated channel... 44 0.004
gi|8132997|gb|AAF73446.1| voltage-gated potassium channel KCNQ5 ... 44 0.004
gi|28373065|ref|NP_062816.2| potassium voltage-gated channel, KQ... 44 0.004
gi|9651967|gb|AAF91335.1| voltage-gated potassium channel [Homo ... 44 0.004
gi|29791782|gb|AAH50689.1| Unknown (protein for IMAGE:6137109) [... 44 0.004
gi|15668310|ref|NP_247106.1| potassium channel protein [Methanoc... 44 0.004
gi|15828892|ref|NP_326252.1| POTASSIUM CHANNEL PROTEIN [Mycoplas... 44 0.005
gi|47230729|emb|CAF99922.1| unnamed protein product [Tetraodon n... 44 0.005
gi|50747864|ref|XP_421022.1| PREDICTED: similar to Kcnq1 protein... 44 0.005
gi|37679357|ref|NP_933966.1| putative potassium channel protein ... 44 0.005
gi|27366380|ref|NP_761908.1| Probable potassium channel [Vibrio ... 44 0.005
gi|23099789|ref|NP_693255.1| potassium channel protein [Oceanoba... 44 0.005
gi|48892039|ref|ZP_00325472.1| COG0664: cAMP-binding proteins - ... 44 0.007
gi|23125946|ref|ZP_00107859.1| COG1226: Kef-type K+ transport sy... 44 0.007
gi|23121342|ref|ZP_00103672.1| COG1226: Kef-type K+ transport sy... 44 0.007
gi|50744806|ref|XP_419883.1| PREDICTED: similar to Potassium vol... 44 0.007
gi|41718792|ref|ZP_00147749.1| COG1226: Kef-type K+ transport sy... 43 0.009
gi|14285398|sp|Q9JK45|CIQ5_MOUSE Potassium voltage-gated channel... 43 0.009
gi|47228958|emb|CAG09473.1| unnamed protein product [Tetraodon n... 43 0.009
gi|20090882|ref|NP_616957.1| potassium channel protein [Methanos... 43 0.009
gi|38049363|ref|XP_355195.1| similar to Dendritic cell protein G... 43 0.009
gi|34863358|ref|XP_216678.2| similar to potassium voltage-gated ... 43 0.012
gi|29349894|ref|NP_813397.1| voltage-gated K+ channel protein [B... 43 0.012
gi|24380209|ref|NP_722164.1| hypothetical protein [Streptococcus... 43 0.012
gi|20070166|ref|NP_002227.2| potassium voltage-gated channel, su... 43 0.012
gi|7513252|pir||JC5919 potassium channel 1 - human >gnl|BL_ORD_I... 43 0.012
gi|41719288|ref|ZP_00148192.1| COG1226: Kef-type K+ transport sy... 43 0.012
gi|41462415|ref|NP_963289.1| potassium voltage-gated channel, su... 43 0.012
gi|46141646|ref|ZP_00204009.1| COG1226: Kef-type K+ transport sy... 43 0.012
gi|39597105|emb|CAE59332.1| Hypothetical protein CBG02674 [Caeno... 43 0.012
gi|21592756|gb|AAM64705.1| outward rectifying potassium channel ... 43 0.012
gi|50745141|ref|XP_426210.1| PREDICTED: similar to potassium vol... 42 0.016
gi|32479523|ref|NP_861462.1| potassium voltage-gated channel, KQ... 42 0.016
gi|17232125|ref|NP_488673.1| probable ion transporter [Nostoc sp... 42 0.016
gi|32479525|ref|NP_861463.1| potassium voltage-gated channel, KQ... 42 0.016
gi|5042386|emb|CAB44650.1| KvLQT1 [Homo sapiens] 42 0.016
gi|2961249|gb|AAC05705.1| slow delayed rectifier channel subunit... 42 0.016
gi|46912722|emb|CAG19512.1| Putative potassium channel [Photobac... 42 0.016
gi|28898897|ref|NP_798502.1| putative potassium channel [Vibrio ... 42 0.016
gi|2465515|gb|AAC51781.1| voltage gated potassium channel [Homo ... 42 0.016
gi|34499017|ref|NP_903232.1| probable ion transporter [Chromobac... 42 0.016
gi|14285392|sp|O97531|CIQ1_FELCA Potassium voltage-gated channel... 42 0.016
gi|15600964|ref|NP_232594.1| potassium channel protein, putative... 42 0.016
gi|31711384|gb|AAM94040.1| potassium channel protein KCNQ1 varia... 42 0.016
gi|32479527|ref|NP_000209.2| potassium voltage-gated channel, KQ... 42 0.016
gi|5042385|emb|CAB44649.1| KvLQT1 [Homo sapiens] 42 0.016
gi|3953684|dbj|BAA34739.1| gene responsible for long QT syndrome... 42 0.016
gi|45506627|ref|ZP_00158979.1| COG1226: Kef-type K+ transport sy... 42 0.021
gi|16760140|ref|NP_455757.1| possible membrane transport protein... 42 0.021
gi|16765085|ref|NP_460700.1| putative voltage-gated potassium ch... 42 0.021
gi|33090007|gb|AAP93874.1| potassium voltage-gated channel major... 42 0.021
gi|33115185|gb|AAH55304.1| Kcnq1 protein [Mus musculus] >gnl|BL_... 42 0.021
gi|6680546|ref|NP_032460.1| potassium voltage-gated channel, sub... 42 0.021
gi|15679517|ref|NP_276634.1| potassium channel related protein [... 42 0.021
gi|22073956|gb|AAK94669.1| truncated KvLQT1-like protein [Rattus... 42 0.021
gi|33862490|ref|NP_894050.1| possible potassium channel, VIC fam... 42 0.021
gi|14285391|sp|O73925|CIQ1_SQUAC Potassium voltage-gated channel... 42 0.021
gi|22779261|dbj|BAC15571.1| Q1-type potassium channel spliced va... 42 0.021
gi|32477506|ref|NP_870500.1| potassium channel [Pirellula sp. 1]... 42 0.021
gi|47224674|emb|CAG03658.1| unnamed protein product [Tetraodon n... 42 0.021
gi|49079900|ref|XP_403540.1| hypothetical protein UM05925.1 [Ust... 42 0.021
gi|14091762|ref|NP_114462.1| potassium voltage-gated channel, KQ... 42 0.021
gi|26638653|ref|NP_004691.2| potassium voltage-gated channel KQT... 42 0.027
gi|6166006|sp|P56696|CIQ4_HUMAN Potassium voltage-gated channel ... 42 0.027
gi|26638655|ref|NP_751895.1| potassium voltage-gated channel KQT... 42 0.027
gi|48861391|ref|ZP_00315293.1| COG1226: Kef-type K+ transport sy... 42 0.027
gi|34871140|ref|XP_233477.2| similar to potassium voltage-gated ... 42 0.027
gi|38078783|ref|XP_143960.4| potassium voltage-gated channel, su... 42 0.027
gi|48729526|ref|ZP_00263276.1| COG1226: Kef-type K+ transport sy... 42 0.027
gi|33864687|ref|NP_896246.1| possible potassium channel, VIC fam... 42 0.027
gi|26990995|ref|NP_746420.1| cation transporter, VIC family [Pse... 42 0.027
gi|46201458|ref|ZP_00054971.2| COG1226: Kef-type K+ transport sy... 42 0.027
gi|26333633|dbj|BAC30534.1| unnamed protein product [Mus musculus] 42 0.027
gi|34396038|gb|AAQ65221.1| K+-channel protein PAK2.4 [Paramecium... 42 0.027
gi|49083349|gb|AAT51009.1| PA1496 [synthetic construct] 41 0.035
gi|46187362|ref|ZP_00205309.1| COG1226: Kef-type K+ transport sy... 41 0.035
gi|15596693|ref|NP_250187.1| probable potassium channel [Pseudom... 41 0.035
gi|50876151|emb|CAG35991.1| related to voltage-gated potassium c... 41 0.035
gi|28870782|ref|NP_793401.1| ion transport protein, putative [Ps... 41 0.035
gi|15805856|ref|NP_294554.1| ion transporter, putative [Deinococ... 41 0.035
gi|21225475|ref|NP_631254.1| putative ion transport integral mem... 41 0.046
gi|29377477|ref|NP_816631.1| conserved hypothetical protein [Ent... 41 0.046
gi|47230743|emb|CAF99936.1| unnamed protein product [Tetraodon n... 41 0.046
gi|48768627|ref|ZP_00272976.1| COG1226: Kef-type K+ transport sy... 41 0.046
gi|47222729|emb|CAG01696.1| unnamed protein product [Tetraodon n... 41 0.046
gi|9971951|gb|AAG10509.1| 2P domain K+ channel TWIK-2 [Rattus no... 41 0.046
gi|17549943|ref|NP_508108.1| putative protein, with at least 3 t... 41 0.046
gi|23465246|ref|NP_695849.1| possible voltage-gated potassium ch... 40 0.060
gi|48094593|ref|XP_392151.1| similar to ENSANGP00000008384 [Apis... 40 0.060
gi|16801231|ref|NP_471499.1| similar to potassium channel subuni... 40 0.060
gi|46190713|ref|ZP_00121151.2| COG1226: Kef-type K+ transport sy... 40 0.060
gi|33240976|ref|NP_875918.1| Kef-type K+ transport system predic... 40 0.060
gi|15831004|ref|NP_309777.1| putative potassium channel protein ... 40 0.060
gi|11354242|pir||T45507 hypothetical protein kch [imported] - Es... 40 0.060
gi|16129211|ref|NP_415766.1| putative potassium channel protein;... 40 0.060
gi|902412|gb|AAB60095.1| putative potassium channel 40 0.060
gi|15801476|ref|NP_287493.1| putative potassium channel protein ... 40 0.060
gi|902394|gb|AAB60079.1| putative potassium channel 40 0.060
gi|902439|gb|AAB60119.1| putative potassium channel 40 0.060
gi|30062771|ref|NP_836942.1| putative potassium channel protein ... 40 0.060
gi|22971581|ref|ZP_00018526.1| hypothetical protein [Chloroflexu... 40 0.060
gi|34396040|gb|AAQ65222.1| K+-channel protein PAK3.1 [Paramecium... 40 0.060
gi|24112647|ref|NP_707157.1| putative potassium channel protein ... 40 0.060
gi|41689524|ref|ZP_00146057.1| COG1226: Kef-type K+ transport sy... 40 0.060
gi|26247580|ref|NP_753620.1| Putative potassium channel protein ... 40 0.060
gi|47212729|emb|CAF90757.1| unnamed protein product [Tetraodon n... 40 0.060
gi|48124397|ref|XP_396557.1| similar to ENSANGP00000003582 [Apis... 40 0.060
gi|17225492|gb|AAL37430.1| potassium voltage-gated channel [Sus ... 40 0.079
gi|16758912|ref|NP_446452.1| potassium voltage gated channel, Sh... 40 0.079
gi|34396036|gb|AAQ65220.1| K+-channel protein PAK2.3 [Paramecium... 40 0.079
gi|20090408|ref|NP_616483.1| hypothetical protein (multi-domain)... 40 0.079
gi|9967389|dbj|BAB12398.1| voltage-dependent potassium channel [... 40 0.079
gi|46908294|ref|YP_014683.1| ion transport protein, putative [Li... 40 0.079
gi|16804098|ref|NP_465583.1| similar to potassium channel subuni... 40 0.079
gi|47097473|ref|ZP_00235016.1| ion transport protein, putative [... 40 0.079
gi|1546839|gb|AAB08433.1| delayed rectifier potassium channel pr... 40 0.079
gi|48870188|ref|ZP_00322916.1| COG1226: Kef-type K+ transport sy... 40 0.079
gi|47205104|emb|CAF91896.1| unnamed protein product [Tetraodon n... 40 0.079
gi|38049342|ref|XP_136482.3| RIKEN cDNA 9630047L19 [Mus musculus] 40 0.079
gi|15669547|ref|NP_248360.1| potassium channel protein, putative... 40 0.079
gi|24418850|sp|Q63099|KCB2_RAT Potassium voltage-gated channel s... 40 0.079
gi|47215595|emb|CAG11626.1| unnamed protein product [Tetraodon n... 40 0.079
gi|47209870|emb|CAF90439.1| unnamed protein product [Tetraodon n... 40 0.079
gi|45383237|ref|NP_989793.1| shaker subfamily potassium channel ... 40 0.079
gi|15807327|ref|NP_296057.1| potassium channel, putative [Deinoc... 40 0.079
gi|1163141|gb|AAC59757.1| potassium channel alpha subunit Kv2.2 ... 40 0.079
gi|15643815|ref|NP_228863.1| potassium channel, putative [Thermo... 40 0.079
gi|24418473|sp|Q95L11|KCB2_RABIT Potassium voltage-gated channel... 40 0.079
gi|31295626|gb|AAP46292.1| voltage-gated potassium channel alpha... 40 0.079
gi|27436974|ref|NP_004761.2| potassium voltage-gated channel, Sh... 40 0.079
gi|38075778|ref|XP_358348.1| potassium voltage-gated channel KQT... 40 0.079
gi|17555416|ref|NP_497824.1| UNCoordinated locomotion UNC-103, H... 40 0.10
gi|45517076|ref|ZP_00168628.1| COG1226: Kef-type K+ transport sy... 40 0.10
gi|5031819|ref|NP_005540.1| potassium voltage-gated channel, sha... 40 0.10
gi|20875435|ref|XP_143471.1| similar to potassium voltage-gated ... 40 0.10
gi|34860120|ref|XP_227577.2| similar to potassium voltage-gated ... 40 0.10
gi|45517074|ref|ZP_00168626.1| COG1226: Kef-type K+ transport sy... 40 0.10
gi|20090386|ref|NP_616461.1| conserved hypothetical protein [Met... 40 0.10
gi|7496719|pir||T19579 hypothetical protein C30D11.1 - Caenorhab... 40 0.10
gi|15678533|ref|NP_275648.1| potassium channel related protein [... 40 0.10
gi|1098962|gb|AAA92054.1| cGMP-gated potassium channel 40 0.10
gi|14285397|sp|P70057|CIQ1_XENLA Potassium voltage-gated channel... 40 0.10
gi|50731321|ref|XP_425660.1| PREDICTED: similar to potassium cha... 40 0.10
gi|45517078|ref|ZP_00168630.1| COG1226: Kef-type K+ transport sy... 40 0.10
gi|50260195|gb|EAL22856.1| hypothetical protein CNBB0770 [Crypto... 40 0.10
gi|13021995|gb|AAK11603.1| Kv1.4 potassium channel [Xenopus laevis] 40 0.10
gi|13195252|gb|AAK15623.1| delayed rectifier potassium channel K... 40 0.10
gi|21397876|ref|NP_653861.1| KTN, KTN NAD-binding domain [Bacill... 39 0.13
gi|49478984|ref|YP_039385.1| potassium channel protein [Bacillus... 39 0.13
gi|31215061|ref|XP_315955.1| ENSANGP00000013550 [Anopheles gambi... 39 0.13
gi|2315214|emb|CAA74748.1| Kv2 voltage-gated potassium channel [... 39 0.13
gi|48141224|ref|XP_393546.1| similar to CG1066-PA [Apis mellifera] 39 0.13
gi|48852989|ref|ZP_00307170.1| COG1226: Kef-type K+ transport sy... 39 0.13
gi|34396034|gb|AAQ65219.1| K+-channel protein PAK2.2 [Paramecium... 39 0.13
gi|38176034|gb|AAK68392.2| Hypothetical protein R05G9.2 [Caenorh... 39 0.13
gi|17535453|ref|NP_495313.1| potassium channel DP4 (2G784) [Caen... 39 0.13
gi|21311753|gb|AAM46838.1| potassium channel alpha subunit Kv1.4... 39 0.18
gi|29832342|ref|NP_826976.1| putative ion transport integral mem... 39 0.18
gi|47228939|emb|CAG09454.1| unnamed protein product [Tetraodon n... 39 0.18
gi|47937676|gb|AAH72256.1| LOC432287 protein [Xenopus laevis] 39 0.18
gi|27805965|ref|NP_776796.1| potassium voltage-gated channel, sh... 39 0.18
gi|23473800|ref|ZP_00129095.1| COG1226: Kef-type K+ transport sy... 39 0.18
gi|3023498|sp|Q61423|CIK4_MOUSE Potassium voltage-gated channel ... 39 0.18
gi|3023496|sp|Q28527|CIK4_MUSPF Potassium voltage-gated channel ... 39 0.18
gi|6981116|ref|NP_037103.1| potassium voltage gated channel, sha... 39 0.18
gi|116431|sp|P15385|CIK4_RAT Potassium voltage-gated channel sub... 39 0.18
gi|31543026|ref|NP_067250.2| potassium voltage-gated channel, sh... 39 0.18
gi|32564066|ref|NP_496875.2| potassium channel, KvQLT family (kq... 39 0.18
gi|47211206|emb|CAF90163.1| unnamed protein product [Tetraodon n... 39 0.18
gi|19424136|ref|NP_598004.1| potassium channel, subfamily V, mem... 39 0.18
gi|1168949|sp|Q05037|CIK4_BOVIN Potassium voltage-gated channel ... 39 0.18
gi|22252948|gb|AAM94168.1| shaker-like potassium channel Kv1.4 [... 39 0.18
gi|21232712|ref|NP_638629.1| ion transporter [Xanthomonas campes... 39 0.18
gi|116430|sp|P22459|CIK4_HUMAN Potassium voltage-gated channel s... 39 0.18
>gi|39587366|emb|CAE75020.1| Hypothetical protein CBG22924
[Caenorhabditis briggsae]
Length = 320
Score = 551 bits (1421), Expect = e-156
Identities = 277/320 (86%), Positives = 277/320 (86%)
Frame = -1
Query: 963 MSDQLFVAFEKYFLTSNEVKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWC 784
MSDQLFVAFEKYFLTSNEVKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWC
Sbjct: 1 MSDQLFVAFEKYFLTSNEVKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWC 60
Query: 783 ILFSLLGIPLTLVTIADLGKFLSEHLVWLYGNYLKLKYLILSRHRKERREHVCEHCHSHG 604
ILFSLLGIPLTLVTIADLGKFLSEHLVWLYGNYLKLKYLILSRHRKERREHVCEHCHSHG
Sbjct: 61 ILFSLLGIPLTLVTIADLGKFLSEHLVWLYGNYLKLKYLILSRHRKERREHVCEHCHSHG 120
Query: 603 MGHDMNIEEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGFGDLM 424
MGHDMNIEEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGFGDLM
Sbjct: 121 MGHDMNIEEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGFGDLM 180
Query: 423 PRRDXXXXXXXXXXXXXLAITTMCIDLVGVQYIRKIHYFGRKIQDARXXXXXXXXXXXXX 244
PRRD LAITTMCIDLVGVQYIRKIHYFGRKIQDAR
Sbjct: 181 PRRDGYMYIILLYIILGLAITTMCIDLVGVQYIRKIHYFGRKIQDARSALAVVGGKVVLV 240
Query: 243 SELYANLMQKRARNMSREAFIVENLYVSKHIIPFIPTDIRCIRYXXXXXXXXXXXXXXXX 64
SELYANLMQKRARNMSREAFIVENLYVSKHIIPFIPTDIRCIRY
Sbjct: 241 SELYANLMQKRARNMSREAFIVENLYVSKHIIPFIPTDIRCIRYIDQTADAATVSTSSSA 300
Query: 63 XDMQSCRFCHSRYSLNRAFK 4
DMQSCRFCHSRYSLNRAFK
Sbjct: 301 MDMQSCRFCHSRYSLNRAFK 320
>gi|25144330|ref|NP_498903.2| TWiK family of potassium channels
(twk-8) [Caenorhabditis elegans]
gi|38258913|sp|P34410|TWK7_CAEEL TWiK family of potassium channels
protein 7
gi|20451237|gb|AAA65460.2| Twik family of potassium channels
protein 8 [Caenorhabditis elegans]
Length = 320
Score = 551 bits (1421), Expect = e-156
Identities = 277/320 (86%), Positives = 277/320 (86%)
Frame = -1
Query: 963 MSDQLFVAFEKYFLTSNEVKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWC 784
MSDQLFVAFEKYFLTSNEVKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWC
Sbjct: 1 MSDQLFVAFEKYFLTSNEVKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWC 60
Query: 783 ILFSLLGIPLTLVTIADLGKFLSEHLVWLYGNYLKLKYLILSRHRKERREHVCEHCHSHG 604
ILFSLLGIPLTLVTIADLGKFLSEHLVWLYGNYLKLKYLILSRHRKERREHVCEHCHSHG
Sbjct: 61 ILFSLLGIPLTLVTIADLGKFLSEHLVWLYGNYLKLKYLILSRHRKERREHVCEHCHSHG 120
Query: 603 MGHDMNIEEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGFGDLM 424
MGHDMNIEEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGFGDLM
Sbjct: 121 MGHDMNIEEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGFGDLM 180
Query: 423 PRRDXXXXXXXXXXXXXLAITTMCIDLVGVQYIRKIHYFGRKIQDARXXXXXXXXXXXXX 244
PRRD LAITTMCIDLVGVQYIRKIHYFGRKIQDAR
Sbjct: 181 PRRDGYMYIILLYIILGLAITTMCIDLVGVQYIRKIHYFGRKIQDARSALAVVGGKVVLV 240
Query: 243 SELYANLMQKRARNMSREAFIVENLYVSKHIIPFIPTDIRCIRYXXXXXXXXXXXXXXXX 64
SELYANLMQKRARNMSREAFIVENLYVSKHIIPFIPTDIRCIRY
Sbjct: 241 SELYANLMQKRARNMSREAFIVENLYVSKHIIPFIPTDIRCIRYIDQTADAATISTSSSA 300
Query: 63 XDMQSCRFCHSRYSLNRAFK 4
DMQSCRFCHSRYSLNRAFK
Sbjct: 301 IDMQSCRFCHSRYSLNRAFK 320