Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F23B2_7
(684 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539984|ref|NP_501594.1| RNA and export factor binding prote... 343 2e-93
gi|39586456|emb|CAE74115.1| Hypothetical protein CBG21776 [Caeno... 179 4e-44
gi|39586455|emb|CAE74114.1| Hypothetical protein CBG21775 [Caeno... 156 4e-37
gi|39593894|emb|CAE62187.1| Hypothetical protein CBG06234 [Caeno... 155 5e-37
gi|17541570|ref|NP_502301.1| RNA and export factor binding prote... 153 3e-36
gi|17538372|ref|NP_501588.1| RNA and export factor binding prote... 150 2e-35
gi|34875658|ref|XP_213542.2| similar to ALY [Rattus norvegicus] 66 7e-10
gi|38048103|gb|AAR09954.1| similar to Drosophila melanogaster al... 65 1e-09
gi|6755763|ref|NP_035698.1| THO complex 4; Tcra enhancer-binding... 65 1e-09
gi|7159943|emb|CAB76383.1| RNA and export factor binding protein... 65 2e-09
gi|48429165|sp|Q86V81|THO4_HUMAN THO complex subunit 4 (Tho4) (A... 64 3e-09
gi|21356157|ref|NP_651968.1| CG1101-PA [Drosophila melanogaster]... 63 6e-09
gi|49257659|gb|AAH74336.1| Unknown (protein for MGC:84169) [Xeno... 62 1e-08
gi|30697310|ref|NP_851229.1| RNA and export factor-binding prote... 62 1e-08
gi|50745403|ref|XP_420095.1| PREDICTED: similar to protein disul... 62 1e-08
gi|31200127|ref|XP_309011.1| ENSANGP00000020298 [Anopheles gambi... 62 1e-08
gi|42573738|ref|NP_974965.1| RNA and export factor-binding prote... 61 2e-08
gi|39586457|emb|CAE74116.1| Hypothetical protein CBG21777 [Caeno... 61 2e-08
gi|2896146|gb|AAD09608.1| transcriptional coactivator ALY [Homo ... 60 4e-08
gi|47219626|emb|CAG02671.1| unnamed protein product [Tetraodon n... 60 4e-08
gi|17572810|ref|NP_005773.1| transcriptional coactivator; bZIP e... 60 4e-08
gi|21901961|dbj|BAC05519.1| putative TCF coactivator [Ciona savi... 59 9e-08
gi|9757916|dbj|BAB08363.1| RNA and export factor binding protein... 58 2e-07
gi|48474967|sp|Q9JJW6|REF2_MOUSE RNA and export factor binding p... 57 3e-07
gi|21555029|gb|AAM63758.1| transcriptional coactivator-like prot... 57 3e-07
gi|47223958|emb|CAG06135.1| unnamed protein product [Tetraodon n... 57 4e-07
gi|30524924|ref|NP_062357.2| RNA and export factor binding prote... 56 6e-07
gi|42568662|ref|NP_200803.3| RNA and export factor-binding prote... 55 1e-06
gi|34810642|pdb|1NO8|A Chain A, Solution Structure Of The Nuclea... 51 2e-05
gi|38074214|ref|XP_136701.2| similar to ALY [Mus musculus] 51 2e-05
gi|33146678|dbj|BAC80073.1| putative RNA and export factor bindi... 49 9e-05
gi|34900544|ref|NP_911618.1| P0565A07.3 [Oryza sativa (japonica ... 49 9e-05
gi|49102399|ref|XP_411056.1| hypothetical protein AN6919.2 [Aspe... 48 2e-04
gi|38074225|ref|XP_204478.3| similar to RNA and export factor bi... 48 2e-04
gi|46982390|gb|AAT08172.1| Hin19 [Nicotiana tabacum] 48 2e-04
gi|48095136|ref|XP_392245.1| similar to ENSANGP00000020298 [Apis... 46 6e-04
gi|47194964|emb|CAF92225.1| unnamed protein product [Tetraodon n... 45 0.001
gi|30679669|ref|NP_195873.2| RNA and export factor-binding prote... 45 0.001
gi|11358209|pir||T48274 hypothetical protein T22P11.120 - Arabid... 45 0.001
gi|39588388|emb|CAE72739.1| Hypothetical protein CBG19980 [Caeno... 45 0.001
gi|38090702|ref|XP_282933.2| similar to ALY [Mus musculus] 44 0.004
gi|23612237|ref|NP_703817.1| RNA and export factor binding prote... 43 0.007
gi|38175495|dbj|BAD01191.1| putative transcriptional coactivator... 42 0.009
gi|47217953|emb|CAG02236.1| unnamed protein product [Tetraodon n... 42 0.011
gi|50755926|ref|XP_414942.1| PREDICTED: similar to Ataxin 2-bind... 42 0.015
gi|38090745|ref|XP_128231.2| similar to ALY [Mus musculus] 41 0.019
gi|23484833|gb|EAA20029.1| hypothetical protein [Plasmodium yoel... 41 0.025
gi|50555463|ref|XP_505140.1| hypothetical protein [Yarrowia lipo... 41 0.025
gi|47550845|ref|NP_999940.1| RNA-binding protein [Danio rerio] >... 40 0.043
gi|30524926|ref|NP_444334.2| RNA binding motif protein 9; fox-1 ... 40 0.043
gi|18461369|gb|AAL71905.1| hexaribonucleotide binding protein 2 ... 40 0.043
gi|29840825|sp|O43251|RBM9_HUMAN RNA-binding protein 9 (RNA bind... 40 0.043
gi|16549891|dbj|BAB70875.1| unnamed protein product [Homo sapiens] 40 0.043
gi|22538409|ref|NP_665900.1| ataxin 2-binding protein 1 isoform ... 40 0.043
gi|8671586|gb|AAF78291.1| ataxin 2-binding protein [Homo sapiens] 40 0.043
gi|18461363|gb|AAL71902.1| hexaribonucleotide binding protein 2 ... 40 0.043
gi|7657504|ref|NP_055124.1| RNA binding motif protein 9; hexarib... 40 0.043
gi|14495356|gb|AAK64287.1| putative RNA-binding protein fxh [Mus... 40 0.043
gi|22538405|ref|NP_665898.1| ataxin 2-binding protein 1 isoform ... 40 0.043
gi|34868593|ref|XP_220155.2| similar to hypothetical protein [Ra... 40 0.043
gi|47678649|emb|CAG30445.1| RBM9 [Homo sapiens] 40 0.043
gi|13874511|dbj|BAB46877.1| hypothetical protein [Macaca fascicu... 40 0.043
gi|6572238|emb|CAB63055.1| dJ41P2.2.2 (supported by GENSCAN) [Ho... 40 0.043
gi|12643820|sp|Q9NWB1|A2BP_HUMAN Ataxin 2-binding protein 1 >gnl... 40 0.043
gi|22538403|ref|NP_061193.2| ataxin 2-binding protein 1 isoform ... 40 0.043
gi|30524922|ref|NP_780596.1| RNA binding motif protein 9; fox-1 ... 40 0.043
gi|34866893|ref|XP_343282.1| similar to RNA-binding protein 9 (R... 40 0.043
gi|22538407|ref|NP_665899.1| ataxin 2-binding protein 1 isoform ... 40 0.043
gi|26336927|dbj|BAC32147.1| unnamed protein product [Mus musculus] 40 0.043
gi|30911059|gb|AAP41925.1| ataxin 2-binding protein variant 1 [H... 40 0.043
gi|6572237|emb|CAB63054.1| dJ41P2.2.1 (RNA binding motif protein... 40 0.043
gi|19584416|emb|CAD28499.1| hypothetical protein [Homo sapiens] 40 0.043
gi|19112507|ref|NP_595715.1| mlo3 protein [Schizosaccharomyces p... 40 0.057
gi|26347765|dbj|BAC37531.1| unnamed protein product [Mus musculus] 40 0.057
gi|38096987|ref|XP_358176.1| similar to ALY [Mus musculus] 39 0.074
gi|38093692|ref|XP_142537.2| similar to ALY [Mus musculus] 39 0.074
gi|50728804|ref|XP_416291.1| PREDICTED: similar to putative RNA-... 39 0.097
gi|34875578|ref|XP_213535.2| similar to ataxin 2-binding protein... 39 0.097
gi|34147248|ref|NP_899011.1| ataxin 2 binding protein 1 isoform ... 38 0.16
gi|20891681|ref|XP_147994.1| ataxin 2 binding protein 1 [Mus mus... 38 0.16
gi|37748130|gb|AAH59002.1| Ataxin 2 binding protein 1, isoform g... 38 0.16
gi|10946878|ref|NP_067452.1| ataxin 2 binding protein 1 isoform ... 38 0.16
gi|38109089|gb|EAA55011.1| hypothetical protein MG06668.4 [Magna... 38 0.16
gi|42661056|ref|XP_290734.4| similar to ataxin 2 binding protein... 38 0.22
gi|17538402|ref|NP_500722.1| RNA-binding region RNP-1 (23.2 kD) ... 38 0.22
gi|40644804|emb|CAE53910.1| putative DIP2 protein [Triticum aest... 37 0.48
gi|49111865|ref|XP_411843.1| hypothetical protein AN7706.2 [Aspe... 37 0.48
gi|38095701|ref|XP_142538.2| similar to ALY [Mus musculus] 36 0.63
gi|47211119|emb|CAF95305.1| unnamed protein product [Tetraodon n... 36 0.63
gi|34913270|ref|NP_917982.1| putative 29 kDa ribonucleoprotein A... 36 0.63
gi|47497761|dbj|BAD19861.1| putative initiation factor 3g [Oryza... 36 0.63
gi|46124955|ref|XP_387031.1| hypothetical protein FG06855.1 [Gib... 36 0.82
gi|48095342|ref|XP_392279.1| similar to CG32062-PD [Apis mellifera] 36 0.82
gi|25013120|gb|AAN71659.1| SD14463p [Drosophila melanogaster] 35 1.4
gi|38104394|gb|EAA50968.1| hypothetical protein MG04727.4 [Magna... 35 1.4
gi|50552081|ref|XP_503515.1| hypothetical protein [Yarrowia lipo... 35 1.4
gi|24646105|ref|NP_650120.1| CG6946-PA [Drosophila melanogaster]... 35 1.4
gi|6322636|ref|NP_012709.1| WD repeat protein required for ubiqu... 35 1.8
gi|12641792|emb|CAC27531.1| eukaryotic translation initiation fa... 35 1.8
gi|31216001|ref|XP_316146.1| ENSANGP00000020435 [Anopheles gambi... 34 2.4
gi|17543086|ref|NP_500400.1| predicted CDS, putative protein (4E... 34 2.4
gi|47221636|emb|CAF97901.1| unnamed protein product [Tetraodon n... 34 2.4
gi|21429720|gb|AAM50538.1| AT08247p [Drosophila melanogaster] 34 3.1
gi|24662235|ref|NP_729615.1| CG32062-PB [Drosophila melanogaster... 34 3.1
gi|33317983|gb|AAQ04865.1| neuraminidase [Influenza A virus (A/C... 34 3.1
gi|24662231|ref|NP_729614.1| CG32062-PD [Drosophila melanogaster... 34 3.1
gi|33589520|gb|AAQ22527.1| LD15974p [Drosophila melanogaster] 34 3.1
gi|23396444|sp|Q9TUI7|ABME_MONDO Apolipoprotein B mRNA editing e... 34 3.1
gi|7620733|gb|AAF64738.1| gag polyprotein [Lagopus lagopus] >gnl... 34 3.1
gi|50303937|ref|XP_451918.1| unnamed protein product [Kluyveromy... 33 4.1
gi|24372218|ref|NP_716260.1| putative 2'-5' RNA ligase [Shewanel... 33 4.1
gi|38074318|ref|XP_136604.2| similar to RNA and export factor bi... 33 5.3
gi|46443527|gb|EAL02808.1| hypothetical protein CaO19.9215 [Cand... 33 5.3
gi|7504435|pir||T16489 hypothetical protein F56F10.4 - Caenorhab... 33 5.3
gi|17568245|ref|NP_508169.1| lethal giant larvae (108.8 kD) (XB4... 33 5.3
gi|50400225|sp|Q9Z1T4|CNR2_RAT Connector enhancer of kinase supp... 33 6.9
gi|41393057|ref|NP_055742.2| connector enhancer of kinase suppre... 33 6.9
gi|32418516|ref|XP_329736.1| predicted protein [Neurospora crass... 33 6.9
gi|13489065|ref|NP_067718.1| maguin-2; maguin-1 [Rattus norvegic... 33 6.9
gi|18141080|gb|AAL60503.1| connector enhancer of KSR2B [Homo sap... 33 6.9
gi|24582088|ref|NP_608978.2| CG9092-PA [Drosophila melanogaster]... 32 9.0
gi|13383287|dbj|BAB39515.1| neuraminidase [Influenza A virus (A/... 32 9.0
gi|47220039|emb|CAG12187.1| unnamed protein product [Tetraodon n... 32 9.0
gi|32419897|ref|XP_330392.1| hypothetical protein [Neurospora cr... 32 9.0
gi|48095211|ref|XP_392259.1| similar to CG18259-PA [Apis mellifera] 32 9.0
gi|32035379|ref|ZP_00135363.1| COG0306: Phosphate/sulphate perme... 32 9.0
gi|46443655|gb|EAL02935.1| hypothetical protein CaO19.1646 [Cand... 32 9.0
gi|39935681|ref|NP_947957.1| putative nitrogenase iron protein (... 32 9.0
gi|50291605|ref|XP_448235.1| unnamed protein product [Candida gl... 32 9.0
gi|50754123|ref|XP_414254.1| PREDICTED: similar to Scm-like with... 32 9.0
>gi|17539984|ref|NP_501594.1| RNA and export factor binding protein,
ALY family (aly-2) [Caenorhabditis elegans]
gi|7499732|pir||T21298 hypothetical protein F23B2.6 -
Caenorhabditis elegans
gi|3876277|emb|CAB05180.1| Hypothetical protein F23B2.6
[Caenorhabditis elegans]
Length = 227
Score = 343 bits (880), Expect = 2e-93
Identities = 184/227 (81%), Positives = 184/227 (81%)
Frame = +1
Query: 1 MVKATAIDMSLSDIISTNRXXXXXXXXXXXXSAGGIRKRGNASNVXXXXXXXXXXXXXXX 180
MVKATAIDMSLSDIISTNR SAGGIRKRGNASNV
Sbjct: 1 MVKATAIDMSLSDIISTNRKNKKVVKKPIKKSAGGIRKRGNASNVGTPRRQSGGTSRGGG 60
Query: 181 XXXNTVRRSAGGSSNDNKQVRINISNLAETVISSDLQELFGAFNLHKVSVNFNENGGAAG 360
NTVRRSAGGSSNDNKQVRINISNLAETVISSDLQELFGAFNLHKVSVNFNENGGAAG
Sbjct: 61 RMGNTVRRSAGGSSNDNKQVRINISNLAETVISSDLQELFGAFNLHKVSVNFNENGGAAG 120
Query: 361 TGDITLKKYDADRLIQKFAGVALDGKVMHFAVIESSNFARKPEIRGTPNRRQSSGKPINR 540
TGDITLKKYDADRLIQKFAGVALDGKVMHFAVIESSNFARKPEIRGTPNRRQSSGKPINR
Sbjct: 121 TGDITLKKYDADRLIQKFAGVALDGKVMHFAVIESSNFARKPEIRGTPNRRQSSGKPINR 180
Query: 541 KVANPPRRQNXXXXXXXXXXXXXREQKPPKTAEQLDAELDAYMSRSA 681
KVANPPRRQN REQKPPKTAEQLDAELDAYMSRSA
Sbjct: 181 KVANPPRRQNAAKPPVKKGKKPAREQKPPKTAEQLDAELDAYMSRSA 227