Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F23F1_8
(699 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17533449|ref|NP_493645.1| transcription factor (2A335) [Caeno... 454 e-127
gi|7499752|pir||T32269 hypothetical protein F23F1.1 - Caenorhabd... 427 e-118
gi|39586889|emb|CAE62824.1| Hypothetical protein CBG07003 [Caeno... 201 9e-51
gi|15221912|ref|NP_175880.1| CCAAT-box binding transcription fac... 103 3e-21
gi|15242784|ref|NP_201152.1| CCAAT-box binding transcription fac... 100 3e-20
gi|15223986|ref|NP_172371.1| CCAAT-box binding transcription fac... 100 4e-20
gi|19113204|ref|NP_596412.1| ccaat-binding factor subunit php5p.... 100 4e-20
gi|23509596|ref|NP_702263.1| hypothetical protein [Plasmodium fa... 100 5e-20
gi|48094626|ref|XP_392156.1| similar to hypothetical protein MGC... 99 1e-19
gi|6289057|gb|AAF06791.1| heme activated protein [Arabidopsis th... 98 2e-19
gi|15228405|ref|NP_190428.1| CCAAT-box binding transcription fac... 97 3e-19
gi|46250701|dbj|BAD15084.1| CCAAT-box binding factor HAP5 homolo... 97 4e-19
gi|5257260|dbj|BAA81759.1| putative heme activated protein [Oryz... 97 4e-19
gi|24640233|ref|NP_572354.1| CG3075-PA [Drosophila melanogaster]... 96 5e-19
gi|15223482|ref|NP_176013.1| transcription factor, putative [Ara... 96 7e-19
gi|46437314|gb|EAK96663.1| hypothetical protein CaO19.9529 [Cand... 96 7e-19
gi|45188264|ref|NP_984487.1| ADR391Wp [Eremothecium gossypii] >g... 96 7e-19
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc... 96 9e-19
gi|50302457|ref|XP_451163.1| unnamed protein product [Kluyveromy... 96 9e-19
gi|46250703|dbj|BAD15085.1| CCAAT-box binding factor HAP5 homolo... 95 1e-18
gi|6324934|ref|NP_015003.1| Subunit of the heme-activated, gluco... 95 1e-18
gi|1094009|prf||2105237A CCAAT-binding factor 95 1e-18
gi|25372763|pir||E86221 hypothetical protein [imported] - Arabid... 95 2e-18
gi|49387561|dbj|BAD25492.1| putative heme activated protein [Ory... 95 2e-18
gi|3170227|gb|AAC82337.1| nuclear Y/CCAAT-box binding factor C s... 93 6e-18
gi|20137773|sp|Q13952|CBFC_HUMAN Nuclear transcription factor Y ... 93 6e-18
gi|50759806|ref|XP_417790.1| PREDICTED: similar to Nuclear trans... 93 6e-18
gi|7020370|dbj|BAA91100.1| unnamed protein product [Homo sapiens] 93 6e-18
gi|1669494|gb|AAC50816.1| transcription factor NF-YC subunit [Ho... 93 6e-18
gi|1843423|dbj|BAA12818.1| transactivator HSM-1 [Homo sapiens] 93 6e-18
gi|11496978|ref|NP_055038.2| nuclear transcription factor Y, gam... 93 6e-18
gi|31560663|ref|NP_032718.2| nuclear transcription factor-Y gamm... 93 6e-18
gi|6981270|ref|NP_036998.1| nuclear transcription factor-Y gamma... 93 6e-18
gi|31565379|gb|AAH53723.1| Nfyc protein [Mus musculus] 93 6e-18
gi|47216125|emb|CAG09999.1| unnamed protein product [Tetraodon n... 93 6e-18
gi|2143652|pir||I59348 CCAAT binding transcription factor CBF su... 93 6e-18
gi|45361255|ref|NP_989205.1| hypothetical protein MGC75886 [Xeno... 93 6e-18
gi|41054497|ref|NP_955933.1| nuclear transcription factor Y, gam... 93 6e-18
gi|50417736|gb|AAH77939.1| Unknown (protein for MGC:80900) [Xeno... 92 8e-18
gi|42761310|dbj|BAD11553.1| putative heme activated protein [Ory... 92 1e-17
gi|1754649|dbj|BAA14051.1| HSM-2 [Homo sapiens] 92 1e-17
gi|25404100|pir||B96603 transcription factor [imported] - Arabid... 91 2e-17
gi|2398533|emb|CAA74053.1| Transcription factor [Arabidopsis tha... 91 2e-17
gi|2564242|emb|CAA99055.1| CCAAT transcription binding factor, g... 91 2e-17
gi|50292433|ref|XP_448649.1| unnamed protein product [Candida gl... 91 3e-17
gi|31203413|ref|XP_310655.1| ENSANGP00000020024 [Anopheles gambi... 91 3e-17
gi|41351024|gb|AAH65645.1| Nuclear transcription factor Y, gamma... 90 4e-17
gi|23482967|gb|EAA18790.1| hypothetical protein [Plasmodium yoel... 89 9e-17
gi|20137751|sp|P70353|CBFC_MOUSE Nuclear transcription factor Y ... 89 9e-17
gi|50257362|gb|EAL20071.1| hypothetical protein CNBF3970 [Crypto... 88 1e-16
gi|21554704|gb|AAM63665.1| transcription factor, putative [Arabi... 88 2e-16
gi|28948711|pdb|1N1J|B Chain B, Crystal Structure Of The Nf-YbNF... 88 2e-16
gi|2583171|gb|AAC15237.1| CCAAT-binding transcription factor sub... 87 2e-16
gi|32403178|ref|XP_322202.1| hypothetical protein ( (AF026550) C... 87 2e-16
gi|50545836|ref|XP_500456.1| hypothetical protein [Yarrowia lipo... 87 3e-16
gi|14577940|gb|AAK68863.1| CCAAT-binding protein subunit HAP5 [H... 85 2e-15
gi|46111453|ref|XP_382784.1| hypothetical protein FG02608.1 [Gib... 85 2e-15
gi|15241171|ref|NP_199859.1| CCAAT-box binding transcription fac... 84 3e-15
gi|3059251|dbj|BAA25636.1| HAPE [Aspergillus oryzae] 83 6e-15
gi|38101916|gb|EAA48814.1| hypothetical protein MG00472.4 [Magna... 83 6e-15
gi|19173583|ref|NP_597386.1| CCAAT BOX BINDING FACTOR [Encephali... 82 8e-15
gi|49098338|ref|XP_410629.1| hypothetical protein AN6492.2 [Aspe... 82 8e-15
gi|2098795|gb|AAD12363.1| HapE [Emericella nidulans] 82 8e-15
gi|49070468|ref|XP_399523.1| hypothetical protein UM01908.1 [Ust... 81 2e-14
gi|32967225|gb|AAP92405.1| HapE [Aspergillus niger] 80 4e-14
gi|28828422|gb|AAL96724.2| similar to Plasmodium falciparum. Hyp... 78 2e-13
gi|15241083|ref|NP_198143.1| CCAAT-box binding transcription fac... 75 2e-12
gi|34913076|ref|NP_917885.1| P0672C09.19 [Oryza sativa (japonica... 68 2e-10
gi|2398531|emb|CAA74054.1| Transcription factor [Arabidopsis tha... 68 2e-10
gi|15241172|ref|NP_199860.1| CCAAT-box binding transcription fac... 67 5e-10
gi|42568173|ref|NP_198630.2| histone-like transcription factor (... 66 6e-10
gi|10177790|dbj|BAB11281.1| unnamed protein product [Arabidopsis... 66 6e-10
gi|34894028|ref|NP_908339.1| P0672D08.26 [Oryza sativa (japonica... 66 8e-10
gi|32488648|emb|CAE03441.1| OSJNBa0032F06.24 [Oryza sativa (japo... 65 1e-09
gi|42733946|gb|AAS38851.1| hypothetical protein [Dictyostelium d... 60 4e-08
gi|50257101|gb|EAL19816.1| hypothetical protein CNBG1090 [Crypto... 57 5e-07
gi|37531970|ref|NP_920287.1| putative transcription binding fact... 55 1e-06
gi|50413388|ref|XP_457255.1| unnamed protein product [Debaryomyc... 55 1e-06
gi|15241170|ref|NP_199858.1| CCAAT-box binding transcription fac... 55 1e-06
gi|8393116|ref|NP_059140.1| chromatin accessibility complex 1; h... 54 3e-06
gi|46226710|gb|EAK87689.1| CCAAT-binding factor chain HAP5 like ... 54 4e-06
gi|50543088|ref|XP_499710.1| hypothetical protein [Yarrowia lipo... 52 2e-05
gi|47225626|emb|CAG07969.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|18426973|ref|NP_006433.2| DR1-associated protein 1; negative ... 51 3e-05
gi|45387529|ref|NP_991104.1| Unknown (protein for MGC:77337); wu... 50 4e-05
gi|22653709|sp|Q9NR33|DPE4_HUMAN DNA polymerase epsilon p12 subu... 50 4e-05
gi|13385366|ref|NP_080158.1| polymerase (DNA-directed), epsilon ... 50 4e-05
gi|34856269|ref|XP_342711.1| similar to polymerase (DNA-directed... 50 4e-05
gi|38455394|ref|NP_063949.2| polymerase (DNA-directed), epsilon ... 50 4e-05
gi|50422853|ref|XP_460004.1| unnamed protein product [Debaryomyc... 50 4e-05
gi|21313424|ref|NP_077138.1| Dr1 associated protein 1 (negative ... 49 7e-05
gi|27661225|ref|XP_215177.1| similar to RIKEN cDNA 2310074H19 [R... 49 7e-05
gi|46121853|ref|XP_385480.1| hypothetical protein FG05304.1 [Gib... 47 4e-04
gi|34906254|ref|NP_914474.1| P0489A01.12 [Oryza sativa (japonica... 47 4e-04
gi|46442114|gb|EAL01406.1| hypothetical protein CaO19.10250 [Can... 47 5e-04
gi|49098040|ref|XP_410480.1| hypothetical protein AN6343.2 [Aspe... 47 5e-04
gi|19114638|ref|NP_593726.1| putative transcriptional repressor ... 46 6e-04
gi|6474879|dbj|BAA87312.1| Hypothetical nuclear protein [Schizos... 46 6e-04
gi|18481624|gb|AAL73487.1| repressor protein [Oryza sativa] 46 6e-04
gi|32411995|ref|XP_326478.1| hypothetical protein [Neurospora cr... 46 8e-04
gi|38106705|gb|EAA52977.1| hypothetical protein MG06105.4 [Magna... 45 0.001
gi|18390837|ref|NP_563803.1| histone-like transcription factor (... 45 0.001
gi|30682195|ref|NP_187854.2| transcription factor, putative [Ara... 45 0.001
gi|1244714|gb|AAB02192.1| Dr1-associated corepressor 45 0.001
gi|18481626|gb|AAL73488.1| repressor protein [Zea mays] 45 0.001
gi|31198889|ref|XP_308392.1| ENSANGP00000019118 [Anopheles gambi... 45 0.001
gi|32411559|ref|XP_326260.1| hypothetical protein [Neurospora cr... 44 0.002
gi|50552554|ref|XP_503687.1| hypothetical protein [Yarrowia lipo... 44 0.004
gi|24657218|ref|NP_611601.2| CG10318-PA [Drosophila melanogaster... 42 0.009
gi|10242351|gb|AAG15389.1| NC2alpha [Drosophila melanogaster] >g... 42 0.009
gi|12321975|gb|AAG51032.1| unknown protein; 69004-67516 [Arabido... 42 0.009
gi|49078064|ref|XP_402822.1| hypothetical protein UM05207.1 [Ust... 42 0.016
gi|45201252|ref|NP_986822.1| AGR156Cp [Eremothecium gossypii] >g... 42 0.016
gi|49068464|ref|XP_398521.1| hypothetical protein UM00906.1 [Ust... 40 0.045
gi|15239815|ref|NP_199139.1| transcription factor, putative [Ara... 40 0.059
gi|29248160|gb|EAA39701.1| GLP_741_38544_38200 [Giardia lamblia ... 40 0.059
gi|38110643|gb|EAA56331.1| hypothetical protein MG06302.4 [Magna... 39 0.077
gi|15826398|pdb|1JFI|A Chain A, Crystal Structure Of The Nc2-Tbp... 38 0.23
gi|50310289|ref|XP_455164.1| unnamed protein product [Kluyveromy... 37 0.38
gi|50305547|ref|XP_452733.1| unnamed protein product [Kluyveromy... 36 0.66
gi|50290385|ref|XP_447624.1| unnamed protein product [Candida gl... 36 0.86
gi|48859600|ref|ZP_00313532.1| COG1396: Predicted transcriptiona... 36 0.86
gi|6321007|ref|NP_011086.1| Homolog of DRAP1 (NC2alpha); encodes... 35 1.5
gi|39586946|emb|CAE62881.1| Hypothetical protein CBG07067 [Caeno... 35 1.5
gi|23486570|gb|EAA20836.1| von Willebrand factor type A domain, ... 35 1.9
gi|39579295|emb|CAE56242.1| Hypothetical protein CBG23881 [Caeno... 33 5.5
gi|50424041|ref|XP_460605.1| unnamed protein product [Debaryomyc... 33 5.5
gi|45201089|ref|NP_986659.1| AGL007Wp [Eremothecium gossypii] >g... 33 5.5
gi|4504013|ref|NP_000161.1| glycine dehydrogenase (decarboxylati... 33 5.5
gi|5441859|dbj|BAA82365.1| chymotrypsinogen 1 [Paralichthys oliv... 33 7.2
gi|50257880|gb|EAL20581.1| hypothetical protein CNBE5010 [Crypto... 33 7.2
gi|50304883|ref|XP_452397.1| unnamed protein product [Kluyveromy... 33 7.2
gi|30265150|ref|NP_847527.1| prophage LambdaBa03, transcriptiona... 32 9.5
gi|2130537|gb|AAC51323.1| transmembrane protein Jagged [Homo sap... 32 9.5
gi|49073538|ref|XP_400980.1| predicted protein [Ustilago maydis ... 32 9.5
gi|42784279|ref|NP_981526.1| carboxylesterase [Bacillus cereus A... 32 9.5
gi|15187327|gb|AAK28443.2| glycine decarboxylase P-protein [Homo... 32 9.5
gi|9506825|ref|NP_062020.1| jagged 1 [Rattus norvegicus] >gnl|BL... 32 9.5
gi|1083702|pir||A56136 jagged protein precursor - rat 32 9.5
gi|121082|sp|P23378|GCSP_HUMAN Glycine dehydrogenase [decarboxyl... 32 9.5
gi|49481488|ref|YP_039118.1| carboxylesterase [Bacillus thuringi... 32 9.5
gi|30023167|ref|NP_834798.1| Carboxylesterase [Bacillus cereus A... 32 9.5
gi|7305197|ref|NP_038850.1| jagged 1 [Mus musculus] >gnl|BL_ORD_... 32 9.5
gi|1438937|gb|AAB39007.1| transmembrane protein Jagged 1 [Homo s... 32 9.5
gi|2228793|gb|AAC51731.1| Jagged1 [Homo sapiens] 32 9.5
gi|4557679|ref|NP_000205.1| jagged 1 precursor; jagged1 (Alagill... 32 9.5
>gi|17533449|ref|NP_493645.1| transcription factor (2A335)
[Caenorhabditis elegans]
gi|14574127|gb|AAK68346.1| Hypothetical protein F23F1.1
[Caenorhabditis elegans]
Length = 232
Score = 454 bits (1169), Expect = e-127
Identities = 221/221 (100%), Positives = 221/221 (100%)
Frame = +1
Query: 1 MSQFPEVLDNNLLHAENNETAEYIQNDGTNQSEVFMEHPYTPNMHPINMPSIVEGAVHPY 180
MSQFPEVLDNNLLHAENNETAEYIQNDGTNQSEVFMEHPYTPNMHPINMPSIVEGAVHPY
Sbjct: 1 MSQFPEVLDNNLLHAENNETAEYIQNDGTNQSEVFMEHPYTPNMHPINMPSIVEGAVHPY 60
Query: 181 NNLIHHNDAIPPAKYASMRQMTEDFWREKKQKMTEISEEDMLNKSKNMSVPMARVKKIMR 360
NNLIHHNDAIPPAKYASMRQMTEDFWREKKQKMTEISEEDMLNKSKNMSVPMARVKKIMR
Sbjct: 61 NNLIHHNDAIPPAKYASMRQMTEDFWREKKQKMTEISEEDMLNKSKNMSVPMARVKKIMR 120
Query: 361 IDDDVRNFMIASDAPIFMAQAAEFFIEEMTAMGWQYVSEARRRILQKADIASAVQKSDQF 540
IDDDVRNFMIASDAPIFMAQAAEFFIEEMTAMGWQYVSEARRRILQKADIASAVQKSDQF
Sbjct: 121 IDDDVRNFMIASDAPIFMAQAAEFFIEEMTAMGWQYVSEARRRILQKADIASAVQKSDQF 180
Query: 541 DFLIDFLPPKTVPTTSTNGPGHMSEDSFQDPNMHSDFHQRT 663
DFLIDFLPPKTVPTTSTNGPGHMSEDSFQDPNMHSDFHQRT
Sbjct: 181 DFLIDFLPPKTVPTTSTNGPGHMSEDSFQDPNMHSDFHQRT 221