Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F25B4_8
(522 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17560132|ref|NP_504500.1| receptor II precursor (19.9 kD) (5G... 338 2e-92
gi|39593116|emb|CAE64585.1| Hypothetical protein CBG09340 [Caeno... 320 7e-87
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8... 66 4e-10
gi|39588321|emb|CAE72672.1| Hypothetical protein CBG19888 [Caeno... 60 3e-08
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica] 59 4e-08
gi|17542436|ref|NP_500843.1| core protein (4G419) [Caenorhabditi... 59 5e-08
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor... 58 8e-08
gi|13236929|gb|AAB28791.2| low affinity IgE Fc receptor isoform ... 58 1e-07
gi|18476520|gb|AAL58516.1| Fc epsilon receptor II subtype b vari... 58 1e-07
gi|18476522|gb|AAL58517.1| Fc epsilon receptor II subtype b vari... 58 1e-07
gi|7305051|ref|NP_038545.1| Fc receptor, IgE, low affinity II, a... 58 1e-07
gi|13236930|gb|AAB28792.2| low affinity IgE Fc receptor isoform ... 58 1e-07
gi|560482|emb|CAA45532.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m... 58 1e-07
gi|560484|emb|CAA45533.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m... 58 1e-07
gi|13236931|gb|AAB28793.2| low affinity IgE Fc receptor isoform ... 58 1e-07
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica] 57 2e-07
gi|19424220|ref|NP_598234.1| Fc receptor, IgE, low affinity II, ... 57 2e-07
gi|19070849|gb|AAL84004.1| CD23 [Rattus norvegicus] 57 2e-07
gi|47551243|ref|NP_999802.1| receptor for egg jelly 2 protein [S... 56 4e-07
gi|48476204|gb|AAT44377.1| REJ2CRD [Allocentrotus fragilis] 55 7e-07
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]... 54 2e-06
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus] 54 2e-06
gi|11320978|gb|AAG33986.1| Pkd1 [Rattus norvegicus] 54 2e-06
gi|34870520|ref|XP_340766.1| polycystin-1 [Rattus norvegicus] 54 2e-06
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe... 53 3e-06
gi|39579732|emb|CAE56482.1| Hypothetical protein CBG24196 [Caeno... 53 3e-06
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n... 53 4e-06
gi|8392926|ref|NP_058885.1| asialoglycoprotein receptor 2; rat h... 53 4e-06
gi|39581146|emb|CAE71003.1| Hypothetical protein CBG17839 [Caeno... 53 4e-06
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_... 52 5e-06
gi|38089047|ref|XP_110691.2| RIKEN cDNA 4930572L20 [Mus musculus... 52 5e-06
gi|34003|emb|CAA28465.1| unnamed protein product [Homo sapiens] 52 5e-06
gi|33667103|ref|NP_878910.1| C-type lectin, superfamily member 1... 52 5e-06
gi|6680734|ref|NP_031519.1| asialoglycoprotein receptor 2 [Mus m... 52 5e-06
gi|19263791|gb|AAH25069.1| 4930572L20Rik protein [Mus musculus] 52 5e-06
gi|5453684|ref|NP_006335.1| C-type (calcium dependent, carbohydr... 52 5e-06
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal... 52 5e-06
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal... 52 5e-06
gi|20149533|ref|NP_001993.2| Fc fragment of IgE, low affinity II... 52 6e-06
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal... 52 6e-06
gi|47219432|emb|CAG10796.1| unnamed protein product [Tetraodon n... 52 8e-06
gi|206649|gb|AAA42038.1| asialoglycoprotein receptor (RHL2) 51 1e-05
gi|45382743|ref|NP_990815.1| hepatic lectin [Gallus gallus] >gnl... 51 1e-05
gi|17554010|ref|NP_497267.1| predicted CDS, receptor II (3B447) ... 51 1e-05
gi|126136|sp|P08290|LECI_RAT Asialoglycoprotein receptor R2/3 (H... 51 1e-05
gi|18252678|gb|AAL66390.1| antithrombin 1 B chain [Deinagkistrod... 51 1e-05
gi|7305389|ref|NP_038658.1| polycystin-1 [Mus musculus] >gnl|BL_... 50 2e-05
gi|202988|gb|AAA40764.1| asialoglycoprotein receptor 50 2e-05
gi|28628340|gb|AAO43607.1| serum lectin isoform 3 precursor [Sal... 50 2e-05
gi|7705290|ref|NP_036635.1| asialoglycoprotein receptor 1 (hepat... 50 2e-05
gi|48476212|gb|AAT44381.1| REJ2CRD [Strongylocentrotus pallidus] 50 2e-05
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep... 50 3e-05
gi|20514243|gb|AAM22956.1| polycystin-1 [Canis familiaris] 50 3e-05
gi|48476196|gb|AAT44373.1| REJ1CRD1 [Strongylocentrotus francisc... 50 3e-05
gi|23321265|gb|AAN23127.1| agglucetin-beta 2 subunit precursor [... 50 3e-05
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n... 50 3e-05
gi|20196239|dbj|BAB47156.2| skin mucus 31.7 kDa lectin AJL-2 [An... 50 3e-05
gi|26340010|dbj|BAC33668.1| unnamed protein product [Mus musculus] 50 3e-05
gi|26000685|gb|AAN75192.1| C-type lectin [Carassius auratus] 49 4e-05
gi|50786686|ref|XP_423496.1| PREDICTED: similar to amino acid fe... 49 4e-05
gi|33328316|gb|AAQ09608.1| HBxAg-binding protein [Homo sapiens] 49 5e-05
gi|4502253|ref|NP_001172.1| asialoglycoprotein receptor 2 isofor... 49 5e-05
gi|47228554|emb|CAG05374.1| unnamed protein product [Tetraodon n... 49 5e-05
gi|47226366|emb|CAG09334.1| unnamed protein product [Tetraodon n... 49 5e-05
gi|18426875|ref|NP_550435.1| asialoglycoprotein receptor 2 isofo... 49 5e-05
gi|18426877|ref|NP_550436.1| asialoglycoprotein receptor 2 isofo... 49 5e-05
gi|28628338|gb|AAO43606.1| serum lectin isoform 2 precursor [Sal... 49 5e-05
gi|48476188|gb|AAT44369.1| REJ1CRD1 [Hemicentrotus pulcherrimus] 49 7e-05
gi|47564066|ref|NP_001001158.1| DEC-205/CD205 protein [Bos tauru... 49 7e-05
gi|31560464|ref|NP_058031.2| C-type lectin, superfamily member 1... 49 7e-05
gi|2497642|sp|P70194|KUCR_MOUSE C-type lectin 13 (Kupffer cell r... 49 7e-05
gi|48476206|gb|AAT44378.1| REJ2CRD [Hemicentrotus pulcherrimus] 49 7e-05
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID... 48 9e-05
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ... 48 9e-05
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [... 48 9e-05
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote... 48 9e-05
gi|31321927|gb|AAM45378.1| polycystin 1; polycystic kidney disea... 48 9e-05
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p... 48 9e-05
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus] 48 9e-05
gi|833853|gb|AAA67565.1| versican V2 core protein precursor 48 9e-05
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ... 48 9e-05
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi... 48 9e-05
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ... 48 9e-05
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [... 48 9e-05
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr... 48 9e-05
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens] 48 9e-05
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ... 48 9e-05
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens] 48 9e-05
gi|39594761|emb|CAE70629.1| Hypothetical protein CBG17315 [Caeno... 48 9e-05
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|... 48 9e-05
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B... 48 1e-04
gi|18157520|dbj|BAB83835.1| supported by GENSCAN and partially h... 48 1e-04
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus] 48 1e-04
gi|37782432|gb|AAP34462.1| LP2698 [Homo sapiens] 47 1e-04
gi|46195838|ref|NP_996866.1| yolk sac IgY receptor [Gallus gallu... 47 3e-04
gi|33341202|gb|AAQ15162.1| stejaggregin-B alpha chain-3 [Trimere... 47 3e-04
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens] 46 3e-04
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]... 46 3e-04
gi|31879371|dbj|BAC77707.1| EMS16 B chain [Echis multisquamatus] 46 3e-04
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ... 46 3e-04
gi|1091923|prf||2022211A asialoglycoprotein receptor 46 3e-04
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma... 46 3e-04
gi|7804476|dbj|BAA95671.1| C-type lectin [Cyprinus carpio] 46 3e-04
gi|33359213|ref|NP_000287.2| polycystin 1 precursor [Homo sapiens] 46 3e-04
gi|38348296|ref|NP_940894.1| liver and lymph node sinusoidal end... 46 3e-04
gi|50730821|ref|XP_417032.1| PREDICTED: similar to antithrombin ... 46 3e-04
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ... 46 3e-04
gi|21541951|sp|P83300|ACAL_ANSAN Ansocalcin 46 3e-04
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat... 46 4e-04
gi|6753126|ref|NP_033844.1| asialoglycoprotein receptor 1 [Mus m... 46 4e-04
gi|34098769|sp|Q9YGG9|MMHA_AGKHA Mamushigin alpha chain precurso... 46 4e-04
gi|3041697|sp|P34927|LECH_MOUSE Asialoglycoprotein receptor 1 (H... 46 4e-04
gi|2135939|pir||A38971 polycystic kidney disease protein 1 precu... 46 4e-04
gi|1586345|prf||2203412A polycystin 46 4e-04
gi|47230595|emb|CAF99788.1| unnamed protein product [Tetraodon n... 46 4e-04
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ... 46 4e-04
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE... 46 4e-04
gi|790819|gb|AAB59488.1| polycystic kidney disease-associated pr... 46 4e-04
gi|799335|gb|AAC50128.1| autosomal dominant polycystic kidney di... 46 4e-04
gi|45645177|sp|P98161|PKD1_HUMAN Polycystin 1 precursor (Autosom... 46 4e-04
gi|903758|gb|AAC41765.1| polycystic kidney disease 1 protein 46 4e-04
gi|31746685|gb|AAB54131.2| Hypothetical protein C09D1.2 [Caenorh... 46 4e-04
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio] 46 4e-04
gi|39586314|emb|CAE66725.1| Hypothetical protein CBG12071 [Caeno... 45 6e-04
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus] 45 6e-04
gi|38493056|pdb|1UKM|B Chain B, Crystal Structure Of Ems16, An A... 45 6e-04
gi|27370068|ref|NP_766320.1| RIKEN cDNA 9830005G06 [Mus musculus... 45 6e-04
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B... 45 7e-04
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus] 45 7e-04
gi|1143285|gb|AAA87847.1| brevican core protein 45 7e-04
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_... 45 7e-04
gi|45382191|ref|NP_990760.1| 17.5 [Gallus gallus] >gnl|BL_ORD_ID... 45 7e-04
gi|625317|pir||LNRC3 lectin BRA3-2 precursor - barnacle (Megabal... 45 7e-04
gi|1730116|sp|P07439|LEC3_MEGRO Lectin BRA-3 precursor >gnl|BL_O... 45 7e-04
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ... 45 0.001
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co... 45 0.001
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ... 45 0.001
gi|211655|gb|AAA48720.1| proteoglycan core protein 45 0.001
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g... 45 0.001
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens] 45 0.001
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_... 45 0.001
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul... 45 0.001
gi|6677705|ref|NP_033069.1| regenerating islet-derived 2; rat re... 45 0.001
gi|17565058|ref|NP_507829.1| versican precursor family member (3... 44 0.001
gi|20810586|gb|AAH29554.1| CLEC2 protein [Homo sapiens] 44 0.001
gi|48476198|gb|AAT44374.1| REJ1CRD2 [Strongylocentrotus francisc... 44 0.001
gi|33332305|gb|AAQ11364.1| crotocetin-1 [Crotalus durissus terri... 44 0.001
gi|7706061|ref|NP_057593.1| C-type lectin-like receptor-2 [Homo ... 44 0.001
gi|37182320|gb|AAQ88962.1| QDED721 [Homo sapiens] 44 0.001
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans] 44 0.001
gi|20385163|gb|AAM21196.1| C-type mannose-binding lectin [Oncorh... 44 0.001
gi|17559330|ref|NP_504977.1| c-type lectin precursor family memb... 44 0.001
gi|50776632|ref|XP_423269.1| PREDICTED: similar to amino acid fe... 44 0.001
gi|33341200|gb|AAQ15161.1| stejaggregin-B alpha chain-2 [Trimere... 44 0.001
gi|33341208|gb|AAQ15165.1| stejaggregin-B alpha chain-4 [Trimere... 44 0.001
gi|33341198|gb|AAQ15160.1| stejaggregin-B alpha chain-1 [Trimere... 44 0.001
gi|625318|pir||LNRC1 lectin BRA3-1 precursor - barnacle (Megabal... 44 0.002
gi|16758588|ref|NP_446205.1| C-type lectin, superfamily member 1... 44 0.002
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ... 44 0.002
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ... 44 0.002
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris] 44 0.002
gi|48476208|gb|AAT44379.1| REJ2CRD [Strongylocentrotus droebachi... 44 0.002
gi|17557916|ref|NP_507547.1| versican precursor family member (5... 44 0.002
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo... 44 0.002
gi|26334345|dbj|BAC30890.1| unnamed protein product [Mus musculus] 44 0.002
gi|27734229|sp|P81509|CHBB_CROHO CHH-B beta subunit 44 0.002
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno... 43 0.003
gi|477362|pir||A48925 mannose receptor precursor, macrophage - m... 43 0.003
gi|15420804|gb|AAK97464.1| NKG2-F3 [Macaca mulatta] 43 0.003
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h... 43 0.003
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (... 43 0.003
gi|47223875|emb|CAG06052.1| unnamed protein product [Tetraodon n... 43 0.003
gi|290002|gb|AAA49200.1| antifreeze protein >gnl|BL_ORD_ID|11388... 43 0.003
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ... 43 0.003
gi|33341216|gb|AAQ15169.1| stejaggregin-A beta chain-3 [Trimeres... 43 0.003
gi|6678932|ref|NP_032651.1| mannose receptor, C type 1 [Mus musc... 43 0.003
gi|47218860|emb|CAG02845.1| unnamed protein product [Tetraodon n... 43 0.004
gi|38422762|emb|CAB07697.2| Hypothetical protein Y48E1B.9 [Caeno... 43 0.004
gi|50728376|ref|XP_416114.1| PREDICTED: similar to protein tyros... 43 0.004
gi|48476190|gb|AAT44370.1| REJ1CRD2 [Hemicentrotus pulcherrimus] 43 0.004
gi|6729952|pdb|2AFP|A Chain A, The Solution Structure Of Type Ii... 43 0.004
gi|20562937|gb|AAM22786.1| ACF 1/2 A-chain [Deinagkistrodon acutus] 43 0.004
gi|8980619|dbj|BAA99281.1| anticoagulant protein A [Deinagkistro... 43 0.004
gi|17537259|ref|NP_496854.1| agkisacutacin like (2N882) [Caenorh... 43 0.004
gi|50732401|ref|XP_418618.1| PREDICTED: similar to Macrophage ma... 43 0.004
gi|113926|sp|P05140|ANP_HEMAM Type II antifreeze protein precurs... 43 0.004
gi|213876|gb|AAA49618.1| antifreeze protein 43 0.004
gi|19921688|ref|NP_610207.1| CG8343-PA [Drosophila melanogaster]... 43 0.004
gi|213874|gb|AAA49617.1| antifreeze polypeptide (AFP) precursor 43 0.004
gi|22024114|ref|NP_610685.2| CG7763-PA [Drosophila melanogaster]... 43 0.004
gi|47208698|emb|CAF89942.1| unnamed protein product [Tetraodon n... 43 0.004
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti... 42 0.005
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens] 42 0.005
gi|25090033|sp|O93426|CVXA_CRODU Convulxin alpha precursor (CVX ... 42 0.005
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens] 42 0.005
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s... 42 0.005
gi|27721871|ref|XP_236746.1| similar to tetranectin [Rattus norv... 42 0.005
gi|7657333|ref|NP_055173.1| C-type lectin, superfamily member 9;... 42 0.005
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu... 42 0.005
gi|48476214|gb|AAT44382.1| REJ3CRD [Allocentrotus fragilis] 42 0.005
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu... 42 0.005
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ... 42 0.005
gi|38493075|pdb|1UOS|A Chain A, The Crystal Structure Of The Sna... 42 0.005
gi|38422761|emb|CAE54926.1| Hypothetical protein Y48E1B.16 [Caen... 42 0.006
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo... 42 0.006
gi|46395874|sp|Q8HY01|C209_HYLCO CD209 antigen (Dendritic cell-s... 42 0.006
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 42 0.006
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro... 42 0.006
gi|7959947|gb|AAF71144.1| low-affinity IgE receptor; CD23 [Equus... 42 0.006
gi|46395876|sp|Q8HY03|C209_HYLLA CD209 antigen (Dendritic cell-s... 42 0.006
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le... 42 0.008
gi|14719570|pdb|1IOD|A Chain A, Crystal Structure Of The Complex... 42 0.008
gi|34870066|ref|XP_221788.2| similar to SIGNR1 alpha [Rattus nor... 42 0.008
gi|28981404|gb|AAH48780.1| Similar to phospholipase A2, group IB... 42 0.008
gi|46395899|sp|Q8MIS5|209P_MACMU CD209 antigen-like protein 2 >g... 42 0.008
gi|691755|dbj|BAA06445.1| phospholipase A2 receptor [Rattus sp.] 42 0.008
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor... 42 0.008
gi|13277206|emb|CAC34377.1| LECC2 protein [Aphrocallistes vastus] 42 0.008
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas... 42 0.008
gi|2851435|sp|P23806|IXA_TRIFL Coagulation factor IX/factor X-bi... 41 0.011
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an... 41 0.011
gi|48476186|gb|AAT44368.1| REJ1CRD2 [Allocentrotus fragilis] 41 0.011
gi|3212543|pdb|1IXX|A Chain A, Crystal Structure Of Coagulation ... 41 0.011
gi|1364010|pir||JC4329 coagulation factor IX-binding protein A c... 41 0.011
gi|2073144|dbj|BAA19862.1| Incilarin B [Incilaria fruhstorferi] 41 0.011
gi|33341214|gb|AAQ15168.1| stejaggregin-A beta chain-2 [Trimeres... 41 0.011
gi|25090912|sp|P82596|PLC_HALLA Perlucin 41 0.011
gi|33416211|gb|AAQ18640.1| factor IX binding protein A chain [Gl... 41 0.011
gi|12583677|dbj|BAB21452.1| factor XI/factor X binding protein A... 41 0.011
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh... 41 0.014
gi|15281085|gb|AAK91852.1| sDC-SIGN1A type III isoform [Homo sap... 41 0.014
gi|15281093|gb|AAK91856.1| sDC-SIGN1B type II isoform [Homo sapi... 41 0.014
gi|46395875|sp|Q8HY02|C209_HYLSY CD209 antigen (Dendritic cell-s... 41 0.014
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele... 41 0.014
gi|47551177|ref|NP_999773.1| sperm receptor for egg jelly [Stron... 41 0.014
gi|15281083|gb|AAK91851.1| sDC-SIGN1A TYPE II isoform [Homo sapi... 41 0.014
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna... 41 0.014
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b... 41 0.014
gi|27356910|gb|AAL89542.1| putative CD209 protein [Pongo pygmaeus] 41 0.014
gi|15281089|gb|AAK91854.1| mDC-SIGN1B type I isoform [Homo sapiens] 41 0.014
gi|46395873|sp|Q8HY00|C209_PONPY CD209 antigen (Dendritic cell-s... 41 0.014
gi|10863957|ref|NP_066978.1| CD209 antigen; dendritic cell-speci... 41 0.014
gi|15281091|gb|AAK91855.1| sDC-SIGN1B type I isoform [Homo sapiens] 41 0.014
gi|15281081|gb|AAK91850.1| sDC-SIGN1A type I isoform [Homo sapiens] 41 0.014
gi|50513579|pdb|1SL4|A Chain A, Crystal Structure Of Dc-Sign Car... 41 0.014
gi|15281077|gb|AAK91848.1| mDC-SIGN1A type III isoform [Homo sap... 41 0.014
gi|50513580|pdb|1SL5|A Chain A, Crystal Structure Of Dc-Sign Car... 41 0.014
gi|18158883|pdb|1K9I|A Chain A, Complex Of Dc-Sign And Glcnac2ma... 41 0.014
gi|7416083|dbj|BAA93691.1| C-type lectin expressed in mouthparts... 40 0.018
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma... 40 0.018
gi|15420806|gb|AAK97465.1| NKG2-A [Macaca mulatta] 40 0.018
gi|21070944|ref|NP_631926.1| killer cell lectin-like receptor su... 40 0.018
gi|50728260|ref|XP_416058.1| PREDICTED: similar to amino acid fe... 40 0.018
gi|31127172|gb|AAH52782.1| Unknown (protein for IMAGE:3371321) [... 40 0.018
gi|181168|gb|AAA35726.1| proteoglycan core protein 40 0.018
gi|28374182|gb|AAH46292.1| Similar to RIKEN cDNA 1810029C22 gene... 40 0.018
gi|27718901|ref|XP_235330.1| similar to collectin liver 1; colle... 40 0.018
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs... 40 0.018
gi|47226918|emb|CAG05810.1| unnamed protein product [Tetraodon n... 40 0.018
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic... 40 0.018
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (... 40 0.018
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr... 40 0.018
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr... 40 0.018
gi|38089049|ref|XP_284386.2| RIKEN cDNA 1810029C22 [Mus musculus] 40 0.018
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA... 40 0.018
gi|45382787|ref|NP_989997.1| tetranectin [Gallus gallus] >gnl|BL... 40 0.018
gi|8163743|gb|AAF73836.1| NKG2-A- [Macaca mulatta] 40 0.024
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb... 40 0.024
gi|23498707|emb|CAD28398.1| putative mannose-binding C-type lect... 40 0.024
gi|46395942|sp|Q95LC6|C209_MACNE CD209 antigen (Dendritic cell-s... 40 0.024
gi|4507557|ref|NP_003269.1| tetranectin (plasminogen binding pro... 40 0.024
gi|49355286|gb|AAT65188.1| asialoglycoprotein receptor major sub... 40 0.024
gi|3023231|sp|P81113|ABA3_TRIAB Alboaggregin A subunit 3 40 0.024
gi|2781225|pdb|1HTN| Human Tetranectin, A Trimeric Plasminogen ... 40 0.024
gi|47523054|ref|NP_999290.1| mannose-binding lectin [Sus scrofa]... 40 0.024
gi|46395941|sp|Q95J96|C209_MACMU CD209 antigen (Dendritic cell-s... 40 0.024
gi|15420784|gb|AAK97459.1| dendritic cell-specific ICAM-3 grabbi... 40 0.024
gi|6754466|ref|NP_034782.1| killer cell lectin-like receptor sub... 40 0.024
gi|3212622|pdb|1TN3| The C-Type Lectin Carbohydrate Recognition... 40 0.024
gi|5123468|gb|AAD40224.2| natural killer cell protein group 2-C2... 40 0.024
gi|23498708|emb|CAD28399.1| putative mannose-binding C-type lect... 40 0.024
gi|40889260|pdb|1OZ7|A Chain A, Crystal Structure Of Echicetin F... 40 0.024
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr... 40 0.031
gi|15218209|ref|NP_175641.1| protein kinase family protein / C-t... 40 0.031
gi|30580858|sp||Q28858_3 [Segment 3 of 3] Versican core protein ... 40 0.031
gi|46395877|sp|Q8HY04|C209_PAPHA CD209 antigen (Dendritic cell-s... 40 0.031
gi|46395660|sp|P60883|C209_CERAE CD209 antigen (Dendritic cell-s... 40 0.031
gi|18652791|gb|AAK74185.1| type II membrane protein CD209 [Macac... 40 0.031
gi|16118475|gb|AAL14438.1| dendritic cell-specific ICAM-3 grabbi... 40 0.031
gi|2144278|pir||S43922 versican - pig-tailed macaque (fragments) 40 0.031
gi|45580692|ref|NP_987099.1| C-type lectin, superfamily member 7... 40 0.031
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ... 40 0.031
gi|225342|prf||1301209A lectin 40 0.031
gi|37181558|gb|AAQ88590.1| CLECSF11 [Homo sapiens] 40 0.031
gi|18466806|ref|NP_569708.1| C-type lectin, superfamily member 7... 40 0.031
gi|6707084|gb|AAF25588.1| low-affinity IgE receptor [Bos taurus] 40 0.031
gi|17538770|ref|NP_502375.1| predicted CDS, receptor for egg jel... 40 0.031
gi|17570059|ref|NP_509919.1| asialoglycoprotein receptor family ... 40 0.031
gi|1514645|emb|CAA42701.1| cartilage aggregating proteoglycan [S... 39 0.040
gi|11344854|gb|AAG34503.1| NKG2-A [Macaca mulatta] 39 0.040
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca... 39 0.040
gi|34870060|ref|XP_341024.1| similar to CD209 antigen; dendritic... 39 0.040
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro... 39 0.040
gi|17224999|gb|AAL37200.1| C lectin-related protein A [Mus muscu... 39 0.040
gi|42716324|gb|AAS37670.1| dectin-1 [Mus musculus] 39 0.040
gi|9910160|ref|NP_064392.1| C-type lectin, superfamily member 12... 39 0.040
gi|47551233|ref|NP_999801.1| receptor for egg jelly 3 [Strongylo... 39 0.040
gi|34858417|ref|XP_342753.1| similar to RIKEN cDNA 3110037K17 [R... 39 0.040
gi|47215081|emb|CAG04535.1| unnamed protein product [Tetraodon n... 39 0.040
gi|8163749|gb|AAF73839.1| NKG2-Adtm- [Macaca mulatta] 39 0.040
gi|48097396|ref|XP_393774.1| similar to CG9134-PB [Apis mellifera] 39 0.040
gi|206105|gb|AAA41836.1| proteoglycan 39 0.040
gi|47778940|ref|NP_775806.2| C-type lectin, superfamily member 1... 39 0.053
gi|4583163|gb|AAD24969.1| natural killer cell receptor NKG2A [Mu... 39 0.053
gi|34870062|ref|XP_221810.2| similar to CD209 antigen; dendritic... 39 0.053
gi|4115907|gb|AAD03419.1| natural killer cell receptor NKG2A [Mu... 39 0.053
gi|50766697|ref|XP_423011.1| PREDICTED: similar to amino acid fe... 39 0.053
gi|34013698|gb|AAQ56012.1| lectin protein type I [Hippocampus co... 39 0.053
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno... 39 0.053
gi|20129313|ref|NP_609116.1| CG15818-PA [Drosophila melanogaster... 39 0.053
gi|5114112|gb|AAD40222.1| natural killer cell protein group 2-A2... 39 0.053
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 39 0.069
gi|38603528|dbj|BAD02476.1| mannose-binding lectin isoform 1 [Cy... 39 0.069
gi|26331710|dbj|BAC29585.1| unnamed protein product [Mus musculus] 39 0.069
gi|15420782|gb|AAK97458.1| dendritic cell-specific ICAM-3 grabbi... 39 0.069
gi|46395871|sp|Q8HXZ7|C209_PANTR CD209 antigen (Dendritic cell-s... 39 0.069
gi|48476222|gb|AAT44386.1| REJ3CRD [Strongylocentrotus pallidus] 39 0.069
gi|27356928|gb|AAL89544.1| putative CD209 protein [Pan troglodytes] 39 0.069
gi|27356930|gb|AAL89545.1| putative CD209 protein [Pan troglodytes] 39 0.069
gi|11277030|pir||S78774 perlucin - Haliotis laevigata 39 0.069
gi|38089051|ref|XP_284376.2| RIKEN cDNA 2310066I10 [Mus musculus] 38 0.090
gi|50762093|ref|XP_424932.1| PREDICTED: similar to embryonic bla... 38 0.090
gi|50765129|ref|XP_422961.1| PREDICTED: similar to amino acid fe... 38 0.090
gi|27806503|ref|NP_776557.1| oxidised low density lipoprotein (l... 38 0.090
gi|6755821|ref|NP_035736.1| tetranectin (plasminogen binding pro... 38 0.090
gi|20381202|gb|AAH27742.1| Clecsf12 protein [Mus musculus] 38 0.090
gi|23272041|gb|AAH35043.1| Tetranectin (plasminogen binding prot... 38 0.090
gi|665485|gb|AAA96811.1| tetranectin 38 0.090
gi|47217439|emb|CAG10208.1| unnamed protein product [Tetraodon n... 38 0.090
gi|8163745|gb|AAF73837.1| NKG2-B [Macaca mulatta] 38 0.090
gi|25050261|ref|XP_194289.1| similar to C-type lectin, superfami... 38 0.090
gi|5764609|gb|AAD51335.1| CD23 homolog [Ancylostoma ceylanicum] 38 0.090
gi|48476210|gb|AAT44380.1| REJ2CRD [Strongylocentrotus francisca... 38 0.090
gi|47220817|emb|CAG00024.1| unnamed protein product [Tetraodon n... 38 0.090
gi|46395872|sp|Q8HXZ8|C209_GORGO CD209 antigen (Dendritic cell-s... 38 0.090
gi|34979184|gb|AAQ83725.1| dendritic cell-associated lectin 2 [H... 38 0.090
gi|37183194|gb|AAQ89397.1| COLEC10 [Homo sapiens] 38 0.12
gi|7262384|ref|NP_015567.1| killer cell lectin-like receptor sub... 38 0.12
gi|4337052|gb|AAD18056.1| fibrinogen clotting inhibitor B chain ... 38 0.12
gi|21553093|ref|NP_660119.1| macrophage galactose N-acetyl-galac... 38 0.12
gi|50744990|ref|XP_426207.1| PREDICTED: similar to collectin sub... 38 0.12
gi|17561188|ref|NP_507258.1| predicted CDS, c-type lectin family... 38 0.12
gi|5381157|dbj|BAA82266.1| Cockroach lectin-like protein CL3 [Pe... 38 0.12
gi|15928688|gb|AAH14811.1| Macrophage galactose N-acetyl-galacto... 37 0.15
gi|33341184|gb|AAQ15153.1| factor IX/X binding protein alpha cha... 37 0.15
gi|47551241|ref|NP_999805.1| C-type lectin domain protein; SpC-l... 37 0.15
gi|6754688|ref|NP_034926.1| macrophage galactose N-acetyl-galact... 37 0.15
gi|18252680|gb|AAL66391.1| antithrombin 1 A chain [Deinagkistrod... 37 0.15
gi|50750537|ref|XP_422039.1| PREDICTED: similar to Lymphocyte an... 37 0.15
gi|26331490|dbj|BAC29475.1| unnamed protein product [Mus musculus] 37 0.15
gi|5381159|dbj|BAA82267.1| Chockroach lectin-like protein CL2 [P... 37 0.15
gi|27530341|dbj|BAC53954.1| collectin-L1 [Mus musculus] 37 0.15
gi|464483|sp|P35242|PSPA_MOUSE Pulmonary surfactant-associated p... 37 0.15
gi|27734138|ref|NP_775598.1| collectin liver 1; collectin-L1 [Mu... 37 0.15
gi|31543691|ref|NP_075623.2| surfactant associated protein A; su... 37 0.15
gi|444733|prf||1908183A surfactant-associated protein SP-A 37 0.15
gi|2073142|dbj|BAA19861.1| Incilarin A [Incilaria fruhstorferi] 37 0.15
gi|38174325|gb|AAH61096.1| Unknown (protein for MGC:74214) [Mus ... 37 0.15
gi|47230430|emb|CAF99623.1| unnamed protein product [Tetraodon n... 37 0.15
gi|48476218|gb|AAT44384.1| REJ3CRD [Strongylocentrotus droebachi... 37 0.15
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n... 37 0.15
gi|9910162|ref|NP_064332.1| C-type lectin, superfamily member 9 ... 37 0.15
gi|9506841|ref|NP_062134.1| killer cell lectin-like receptor sub... 37 0.15
gi|6754468|ref|NP_034783.1| killer cell lectin-like receptor sub... 37 0.15
gi|7416081|dbj|BAA93690.1| haustellum specific protein A [Sarcop... 37 0.15
gi|33391736|gb|AAQ17468.1| factor X activator light chain 1 prec... 37 0.15
gi|18641360|ref|NP_569057.1| collectin sub-family member 12 isof... 37 0.20
gi|25392184|pir||JC7595 scavenger receptor with C-type lectin ty... 37 0.20
gi|38174510|gb|AAH60789.1| Collectin sub-family member 12, isofo... 37 0.20
gi|2921746|gb|AAC40050.1| natural killer cell protein group 2-A ... 37 0.20
gi|34858513|ref|XP_342771.1| killer cell lectin-like receptor su... 37 0.20
gi|48476184|gb|AAT44367.1| REJ1CRD1 [Allocentrotus fragilis] 37 0.20
gi|23321261|gb|AAN23125.1| agglucetin-alpha 2 subunit precursor ... 37 0.20
gi|48476200|gb|AAT44375.1| REJ1CRD1 [Strongylocentrotus pallidus] 37 0.20
gi|794066|emb|CAA89024.1| cL1C2.1 (exons 30-41) [Homo sapiens] 37 0.20
gi|4586876|dbj|BAA36753.1| huntingtin [Homo sapiens] 37 0.20
gi|17553354|ref|NP_497168.1| predicted CDS, C type lectin (3A790... 37 0.20
gi|4753163|ref|NP_002102.2| huntingtin [Homo sapiens] >gnl|BL_OR... 37 0.20
gi|1082473|pir||A46068 Huntington disease-associated protein - h... 37 0.20
gi|50800509|ref|XP_428473.1| PREDICTED: similar to amino acid fe... 37 0.20
gi|39585604|emb|CAE65364.1| Hypothetical protein CBG10309 [Caeno... 37 0.20
gi|47225543|emb|CAG12026.1| unnamed protein product [Tetraodon n... 37 0.20
gi|3378108|gb|AAC28441.1| secreted lectin homolog; HeEL-1 [Helio... 37 0.20
gi|19584340|emb|CAD28466.1| hypothetical protein [Homo sapiens] 37 0.20
gi|39591273|emb|CAE73326.1| Hypothetical protein CBG20755 [Caeno... 37 0.20
gi|20978530|sp|Q9MZK6|NKGC_MACMU NKG2-C type II integral membran... 37 0.26
gi|8347161|gb|AAF74532.1| NKG2-C [Macaca mulatta] 37 0.26
gi|15420802|gb|AAK97463.1| NKG2-Ce2 [Macaca mulatta] 37 0.26
gi|34013702|gb|AAQ56014.1| lectin protein type III [Hippocampus ... 37 0.26
gi|13277204|emb|CAC34376.1| LECC1 protein [Aphrocallistes vastus] 37 0.26
gi|47214539|emb|CAG04559.1| unnamed protein product [Tetraodon n... 37 0.26
gi|8347171|gb|AAF74537.1| NKG2-Ce [Macaca mulatta] 37 0.26
gi|8347173|gb|AAF74538.1| NKG2-Ce [Macaca mulatta] 37 0.26
gi|37781604|gb|AAP41745.1| natural killer cell receptor family C... 37 0.26
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|... 37 0.26
gi|15081145|gb|AAK83792.1| NKG2A [Pan troglodytes] 36 0.34
gi|5453619|ref|NP_006429.1| collectin sub-family member 10; coll... 36 0.34
gi|11344848|gb|AAG34500.1| NKG2-C [Macaca mulatta] 36 0.34
gi|130308|sp|P21756|PLIB_TRIFL Phospholipase A2 inhibitor subuni... 36 0.34
gi|21357549|ref|NP_652636.1| CG7106-PA [Drosophila melanogaster]... 36 0.34
gi|38603530|dbj|BAD02477.1| mannose-binding lectin isoform 2 [Cy... 36 0.34
gi|24655071|ref|NP_728586.1| CG9134-PA [Drosophila melanogaster]... 36 0.34
gi|39593681|emb|CAE61973.1| Hypothetical protein CBG05976 [Caeno... 36 0.34
gi|47208253|emb|CAF93060.1| unnamed protein product [Tetraodon n... 36 0.34
gi|8347179|gb|AAF74541.1| NKG2-F2 [Macaca mulatta] 36 0.34
gi|39585606|emb|CAE65366.1| Hypothetical protein CBG10311 [Caeno... 36 0.34
gi|24655067|ref|NP_612091.1| CG9134-PB [Drosophila melanogaster]... 36 0.34
gi|691753|dbj|BAA06444.1| phospholipase A2 receptor [Homo sapiens] 36 0.34
gi|49118920|gb|AAH73015.1| Unknown (protein for MGC:82606) [Xeno... 36 0.34
gi|15281075|gb|AAK91847.1| mDC-SIGN1A type II isoform [Homo sapi... 36 0.45
gi|37619835|emb|CAB01145.2| Hypothetical protein F08H9.8 [Caenor... 36 0.45
gi|32565327|ref|NP_494426.2| c-type lectin and CUB domain contai... 36 0.45
gi|7497310|pir||T32326 hypothetical protein C41H7.7 - Caenorhabd... 36 0.45
gi|19424150|ref|NP_598196.1| NKR-P2, ortholog of human NKG2D [Ra... 36 0.45
gi|39585191|emb|CAE57434.1| Hypothetical protein CBG00395 [Caeno... 36 0.45
gi|17559404|ref|NP_506590.1| CUB domain and c-type lectin precur... 36 0.45
gi|50794058|ref|XP_423655.1| PREDICTED: similar to brevican isof... 36 0.45
gi|27901450|emb|CAD61336.1| C-type lectin [Gallus gallus] 36 0.45
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno... 36 0.45
gi|38083939|ref|XP_355753.1| similar to C-type lectin [Mus muscu... 36 0.45
gi|33332307|gb|AAQ11365.1| crotocetin [Crotalus durissus terrifi... 36 0.45
gi|27709624|ref|XP_231622.1| similar to CD69 antigen (p60, early... 36 0.45
gi|31212723|ref|XP_315346.1| ENSANGP00000020938 [Anopheles gambi... 36 0.45
gi|39590314|emb|CAE66053.1| Hypothetical protein CBG11254 [Caeno... 36 0.45
gi|41149813|ref|XP_208667.3| similar to HEEE9341 [Homo sapiens] ... 36 0.45
gi|6677921|ref|NP_033186.1| surfactant associated protein D [Mus... 36 0.45
gi|39590313|emb|CAE66052.1| Hypothetical protein CBG11253 [Caeno... 36 0.45
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;... 36 0.45
gi|31203403|ref|XP_310650.1| ENSANGP00000020762 [Anopheles gambi... 36 0.45
gi|24266774|gb|AAN52336.1| nematocyst outer wall antigen precurs... 36 0.45
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa] 35 0.58
gi|15420810|gb|AAK97467.1| NKG2-A [Macaca mulatta] 35 0.58
gi|20978528|sp|Q9MZJ3|NKGA_MACMU NKG2-A/NKG2-B type II integral ... 35 0.58
gi|6601484|gb|AAF18995.1| pulmonary surfactant protein A [Ovis a... 35 0.58
gi|6981470|ref|NP_036773.1| regenerating islet-derived 1; RATLIT... 35 0.58
gi|20562939|gb|AAM22787.1| C-type lectin [Deinagkistrodon acutus... 35 0.58
gi|206459|gb|AAA41972.1| prepulmonary surfactant-associated prot... 35 0.58
gi|34146972|gb|AAB37037.2| Hypothetical protein F52E1.2 [Caenorh... 35 0.58
gi|46048318|ref|NP_705726.2| C lectin-related protein A [Mus mus... 35 0.58
gi|7505170|pir||T16526 hypothetical protein K02F3.5 - Caenorhabd... 35 0.58
gi|7994666|sp|P82142|PLIA_AGKBL Phospholipase A2 inhibitor subun... 35 0.58
gi|130307|sp|P21755|PLIA_TRIFL Phospholipase A2 inhibitor subuni... 35 0.58
gi|34877265|ref|XP_225585.2| similar to macrophage mannose recep... 35 0.58
gi|46019638|emb|CAG25421.1| B-lec protein [Gallus gallus] 35 0.58
gi|47087179|ref|NP_998747.1| B-lec protein [Gallus gallus] >gnl|... 35 0.58
gi|27806705|ref|NP_776439.1| CD69 antigen (p60, early T-cell act... 35 0.58
gi|47208122|emb|CAF91040.1| unnamed protein product [Tetraodon n... 35 0.58
gi|50766146|ref|XP_422990.1| PREDICTED: similar to amino acid fe... 35 0.58
gi|49355289|gb|AAT65189.1| asialoglycoprotein receptor minor sub... 35 0.58
gi|33638231|gb|AAQ24216.1| coagulation factor IX-binding protein... 35 0.58
gi|17538888|ref|NP_503095.1| predicted CDS, c-type lectin family... 35 0.58
gi|6467181|dbj|BAA86972.1| phospholipase A2 inhibitor alfa [Agki... 35 0.58
gi|6467183|dbj|BAA86973.1| phospholipase A2 inhibitor alpha isof... 35 0.58
gi|7512207|pir||T28141 C type lectin, B locus - chicken >gnl|BL_... 35 0.58
gi|4504881|ref|NP_002250.1| killer cell lectin-like receptor sub... 35 0.76
gi|28881880|dbj|BAC65234.1| C-type lectin [Mus musculus] 35 0.76
gi|26387827|dbj|BAC25626.1| unnamed protein product [Mus musculus] 35 0.76
gi|32566191|ref|NP_503091.2| c-type lectin family member (4S295)... 35 0.76
gi|11693134|ref|NP_071788.1| Gal/GalNAc-specific lectin; monogly... 35 0.76
gi|50757074|ref|XP_415370.1| PREDICTED: similar to MHC Rfp-Y cla... 35 0.76
gi|50757054|ref|XP_415365.1| PREDICTED: similar to C-type lectin... 35 0.76
gi|9910412|ref|NP_064369.1| C-type lectin-like receptor 2 [Mus m... 35 0.76
gi|2688987|gb|AAC28245.1| NKG2D homolog [Mus musculus] 35 0.76
gi|14861840|ref|NP_149069.1| NKG2-D; natural killer cell group 2... 35 0.76
gi|23498706|emb|CAD28397.1| putative mannose-binding C-type lect... 35 0.76
gi|13399489|pdb|1HQ8|A Chain A, Crystal Structure Of The Murine ... 35 0.76
gi|283849|pir||B42972 coagulation factor X activating enzyme (EC... 35 0.76
gi|13879298|gb|AAH06623.1| Clecsf6 protein [Mus musculus] 35 0.76
gi|16923229|gb|AAL29936.1| lectin 2c [Girardia tigrina] 35 0.76
gi|27806549|ref|NP_776532.1| mannose-binding lectin (protein C) ... 35 0.76
gi|2773304|gb|AAB96767.1| aggrecan core protein [Equus caballus] 35 0.76
gi|13384604|ref|NP_072092.2| C-type lectin, superfamily member 1... 35 0.76
gi|7497641|pir||T20063 hypothetical protein C49C3.13 - Caenorhab... 35 0.76
gi|11066256|gb|AAG28522.1| halyxin B-chain precursor [Gloydius h... 35 0.76
gi|50757014|ref|XP_415359.1| PREDICTED: similar to C-type lectin... 35 0.76
gi|20978525|sp|Q95MI5|NKGA_PANTR NKG2-A/NKG2-B type II integral ... 35 0.99
gi|15420808|gb|AAK97466.1| NKG2-A [Macaca mulatta] 35 0.99
gi|17564474|ref|NP_507254.1| predicted CDS, c-type lectin family... 35 0.99
gi|50751073|ref|XP_422246.1| PREDICTED: similar to E-selectin pr... 35 0.99
gi|40548420|ref|NP_954705.1| collectin sub-family member 11 isof... 35 0.99
gi|39579377|emb|CAE56908.1| Hypothetical protein CBG24749 [Caeno... 35 0.99
gi|50771662|ref|XP_423145.1| PREDICTED: similar to E-selectin pr... 35 0.99
gi|33341210|gb|AAQ15166.1| stejaggregin-A alpha chain [Trimeresu... 35 0.99
gi|20271378|gb|AAM18623.1| C-type lectin domain protein [Heterod... 35 0.99
gi|47208881|emb|CAF98183.1| unnamed protein product [Tetraodon n... 35 0.99
gi|10946714|ref|NP_067353.1| killer cell lectin-like receptor su... 35 0.99
gi|3108091|gb|AAC15766.1| neurocan [Rattus norvegicus] 35 0.99
gi|17433151|sp|Q9YGL2|LDHB_ANGRO L-lactate dehydrogenase B chain... 35 0.99
gi|1942246|pdb|2KMB|1 Chain 1, Complex Of 3'-Neuac-Lewis-X With ... 35 0.99
gi|4090874|gb|AAD09286.1| putative lectin [Hyphantria cunea] 35 0.99
>gi|17560132|ref|NP_504500.1| receptor II precursor (19.9 kD)
(5G181) [Caenorhabditis elegans]
gi|7499790|pir||T25730 hypothetical protein F25B4.9 -
Caenorhabditis elegans
gi|1458284|gb|AAB37085.1| Hypothetical protein F25B4.9
[Caenorhabditis elegans]
Length = 173
Score = 338 bits (868), Expect = 2e-92
Identities = 156/173 (90%), Positives = 156/173 (90%)
Frame = +1
Query: 1 MVLALITLVVSAFLIPEVLADPCGDSNWRYFPQTNSCYKLIDENLPWTIAEFKCLFQGAH 180
MVLALITLVVSAFLIPEVLADPCGDSNWRYFPQTNSCYKLIDENLPWTIAEFKCLFQGAH
Sbjct: 1 MVLALITLVVSAFLIPEVLADPCGDSNWRYFPQTNSCYKLIDENLPWTIAEFKCLFQGAH 60
Query: 181 HVSIDSPEENQFVHELSRWSEIWTGAAFFGKDQHYVNSDGSRYGNFENWKDGRKPPMNRA 360
HVSIDSPEENQFVHELSRWSEIWTGAAFFGKDQHYVNSDGSRYGNFENWKDGRKPPMNRA
Sbjct: 61 HVSIDSPEENQFVHELSRWSEIWTGAAFFGKDQHYVNSDGSRYGNFENWKDGRKPPMNRA 120
Query: 361 RRCIKMDGNGEWFQSCCKKKTFTICEKKXXXXXXXXXXXXXXXXXFRFMRHRS 519
RRCIKMDGNGEWFQSCCKKKTFTICEKK FRFMRHRS
Sbjct: 121 RRCIKMDGNGEWFQSCCKKKTFTICEKKAAYSASSYSGSNNSVNGFRFMRHRS 173