Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F26A1_9
         (696 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)...   396   e-109
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno...   199   3e-50
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno...   152   5e-36
gi|39580589|emb|CAE70485.1| Hypothetical protein CBG17082 [Caeno...   149   5e-35
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno...   132   5e-30
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno...   116   4e-25
gi|17542442|ref|NP_501639.1| putative protein (4K93) [Caenorhabd...   110   3e-23
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family...   100   2e-20
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb...    74   2e-12
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno...    72   1e-11
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k...    68   2e-10
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)...    68   2e-10
gi|39592428|emb|CAE63505.1| Hypothetical protein CBG07982 [Caeno...    65   1e-09
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno...    65   2e-09
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb...    64   3e-09
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb...    64   3e-09
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno...    64   3e-09
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno...    64   4e-09
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur...    63   5e-09
gi|39592447|emb|CAE63524.1| Hypothetical protein CBG08003 [Caeno...    63   6e-09
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ...    62   8e-09
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno...    62   8e-09
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab...    62   8e-09
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor...    62   8e-09
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno...    62   1e-08
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family...    62   1e-08
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k...    62   1e-08
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno...    62   1e-08
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno...    61   2e-08
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur...    61   2e-08
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb...    60   5e-08
gi|39580257|emb|CAE69649.1| Hypothetical protein CBG15894 [Caeno...    60   5e-08
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno...    60   5e-08
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)...    59   7e-08
gi|39592446|emb|CAE63523.1| Hypothetical protein CBG08002 [Caeno...    59   1e-07
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa...    59   1e-07
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb...    59   1e-07
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family...    59   1e-07
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi...    58   2e-07
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno...    58   2e-07
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur...    58   2e-07
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno...    58   2e-07
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae...    57   3e-07
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family...    57   4e-07
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb...    57   5e-07
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb...    56   6e-07
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)...    56   6e-07
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb...    56   6e-07
gi|39579641|emb|CAE56640.1| Hypothetical protein CBG24401 [Caeno...    55   1e-06
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6...    55   1e-06
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno...    55   1e-06
gi|17566546|ref|NP_507913.1| c-type lectin precursor family memb...    55   2e-06
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)...    55   2e-06
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno...    55   2e-06
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ...    54   4e-06
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ...    53   7e-06
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family...    52   9e-06
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)...    52   1e-05
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno...    52   1e-05
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno...    52   1e-05
gi|17559100|ref|NP_505753.1| putative protein family member (5L2...    52   1e-05
gi|17560214|ref|NP_507154.1| predicted CDS, c-type lectin precur...    52   1e-05
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)...    51   2e-05
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno...    51   3e-05
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb...    51   3e-05
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur...    50   3e-05
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ...    50   3e-05
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)...    50   6e-05
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno...    49   7e-05
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb...    49   1e-04
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae...    49   1e-04
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam...    49   1e-04
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb...    49   1e-04
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno...    47   3e-04
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family...    47   4e-04
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb...    47   4e-04
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno...    47   5e-04
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb...    47   5e-04
gi|17539324|ref|NP_503089.1| putative protein family member, wit...    47   5e-04
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family...    47   5e-04
gi|17506689|ref|NP_493310.1| putative protein family member (1N7...    45   0.001
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam...    44   0.002
gi|17544382|ref|NP_502990.1| predicted CDS, c-type lectin family...    44   0.003
gi|34146972|gb|AAB37037.2| Hypothetical protein F52E1.2 [Caenorh...    43   0.005
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno...    43   0.007
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno...    42   0.012
gi|17511041|ref|NP_492870.1| putative secreted or extracellular ...    42   0.015
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno...    42   0.015
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)...    41   0.020
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or...    41   0.020
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno...    41   0.020
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno...    40   0.034
gi|17562684|ref|NP_507837.1| putative protein family member (5U2...    40   0.045
gi|17508069|ref|NP_493489.1| c-type lectin family member (1O843)...    40   0.059
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)...    39   0.10
gi|17568961|ref|NP_508518.1| conglutinin like family member (35....    39   0.10
gi|39587013|emb|CAE62948.1| Hypothetical protein CBG07161 [Caeno...    39   0.13
gi|17558310|ref|NP_506808.1| c-type lectin precursor family memb...    39   0.13
gi|17507421|ref|NP_493450.1| putative protein family member (1O6...    38   0.17
gi|17510429|ref|NP_493430.1| predicted CDS, c-type lectin family...    38   0.22
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family...    38   0.22
gi|4585307|gb|AAD25372.1| attractin [Mus musculus]                     38   0.22
gi|26006173|dbj|BAC41429.1| mKIAA0548 protein [Mus musculus]           37   0.29
gi|6753146|ref|NP_033860.1| attractin [Mus musculus] >gnl|BL_ORD...    37   0.29
gi|13431313|sp|Q9WU60|ATRN_MOUSE Attractin precursor (Mahogany p...    37   0.29
gi|32697984|emb|CAB02800.2| Hypothetical protein C29F3.4 [Caenor...    37   0.38
gi|17565950|ref|NP_507582.1| predicted CDS, putative protein fam...    37   0.38
gi|17510431|ref|NP_493431.1| putative endoplasmic reticulum prot...    37   0.38
gi|39597674|emb|CAE68365.1| Hypothetical protein CBG14118 [Caeno...    37   0.50
gi|17561852|ref|NP_506804.1| predicted CDS, c-type lectin family...    36   0.65
gi|17561226|ref|NP_505170.1| IgE receptor precursor (5I887) [Cae...    36   0.65
gi|39590313|emb|CAE66052.1| Hypothetical protein CBG11253 [Caeno...    36   0.65
gi|17562694|ref|NP_507835.1| putative protein (5U249) [Caenorhab...    36   0.85
gi|39580256|emb|CAE69648.1| Hypothetical protein CBG15893 [Caeno...    36   0.85
gi|16930101|dbj|BAB72012.1| attractin [Mesocricetus auratus]           36   0.85
gi|39583048|emb|CAE71827.1| Hypothetical protein CBG18868 [Caeno...    36   0.85
gi|48783657|ref|ZP_00280109.1| COG2301: Citrate lyase beta subun...    35   1.4
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno...    35   1.4
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd...    35   1.4
gi|7497627|pir||T20046 hypothetical protein C49A1.9 - Caenorhabd...    35   1.9
gi|12275312|dbj|BAB21018.1| attractin [Rattus norvegicus]              35   1.9
gi|31075306|gb|AAP43902.1| chondrolectin variant CHODLdeltaE [Ho...    35   1.9
gi|46365262|ref|ZP_00227763.1| COG1501: Alpha-glucosidases, fami...    35   1.9
gi|17506151|ref|NP_493484.1| predicted CDS, putative protein fam...    35   1.9
gi|13786196|ref|NP_112641.1| attractin [Rattus norvegicus] >gnl|...    35   1.9
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno...    34   2.5
gi|7507622|pir||T16840 hypothetical protein T10E10.4 - Caenorhab...    34   2.5
gi|17569759|ref|NP_509058.1| tenascin XB XB1 (XG934) [Caenorhabd...    34   2.5
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|...    34   3.2
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p...    34   3.2
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens]        34   3.2
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens]        34   3.2
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [...    34   3.2
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [...    34   3.2
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote...    34   3.2
gi|833853|gb|AAA67565.1| versican V2 core protein precursor            34   3.2
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi...    34   3.2
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n...    34   3.2
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ...    34   3.2
gi|39585823|emb|CAE61236.1| Hypothetical protein CBG05036 [Caeno...    33   4.2
gi|17539326|ref|NP_503090.1| versican family member, possibly N-...    33   4.2
gi|34870064|ref|XP_221789.2| similar to DC-SIGN [Rattus norvegicus]    33   4.2
gi|42716324|gb|AAS37670.1| dectin-1 [Mus musculus]                     33   4.2
gi|20381202|gb|AAH27742.1| Clecsf12 protein [Mus musculus]             33   4.2
gi|9910160|ref|NP_064392.1| C-type lectin, superfamily member 12...    33   4.2
gi|32564282|ref|NP_493725.2| c-type lectin and CUB domain contai...    33   5.5
gi|47216228|emb|CAG01262.1| unnamed protein product [Tetraodon n...    33   5.5
gi|29349705|ref|NP_813208.1| putative outer membrane protein, pr...    33   5.5
gi|7495300|pir||T32032 hypothetical protein C03H5.1 - Caenorhabd...    33   5.5
gi|27803388|gb|AAO19649.1| CD94-1/NKR-P1-related receptor [Botry...    33   7.2
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe...    33   7.2
gi|39582517|emb|CAE65604.1| Hypothetical protein CBG10625 [Caeno...    33   7.2
gi|10434231|dbj|BAB14181.1| unnamed protein product [Homo sapien...    32   9.4
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family...    32   9.4
gi|20127636|ref|NP_079220.2| chondrolectin precursor; transmembr...    32   9.4
gi|31075310|gb|AAP43904.1| chondrolectin variant CHODLFdeltaE [H...    32   9.4
gi|47227138|emb|CAG00500.1| unnamed protein product [Tetraodon n...    32   9.4
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n...    32   9.4
gi|17538882|ref|NP_503093.1| predicted CDS, c-type lectin family...    32   9.4


>gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)
           [Caenorhabditis elegans]
 gi|7499861|pir||T16160 hypothetical protein F26A1.12 -
           Caenorhabditis elegans
 gi|860689|gb|AAA68253.1| Hypothetical protein F26A1.12
           [Caenorhabditis elegans]
          Length = 231

 Score =  396 bits (1018), Expect = e-109
 Identities = 192/231 (83%), Positives = 192/231 (83%)
 Frame = -1

Query: 696 MRSMKVFISIGVVLSVVNCIFFXXXXXXXXXXXXXXXXGRGHHHKHGXXXXXXXXXXXXX 517
           MRSMKVFISIGVVLSVVNCIFF                GRGHHHKHG
Sbjct: 1   MRSMKVFISIGVVLSVVNCIFFDHGDSSDGSYSDSSGEGRGHHHKHGPRPPRPNRPPRPP 60

Query: 516 XXXXXXXXXXPSCPGGWSLIHRRRGPWCIQVFNGAAGLEGSNNACRAQGAVLSSVENAQE 337
                     PSCPGGWSLIHRRRGPWCIQVFNGAAGLEGSNNACRAQGAVLSSVENAQE
Sbjct: 61  PATPPPTTPAPSCPGGWSLIHRRRGPWCIQVFNGAAGLEGSNNACRAQGAVLSSVENAQE 120

Query: 336 RETIARLGLEKMLPTGWKYGTIRVGLRKNSQGAPWYNTDGSTDANNLEGVLWSPAEPRNG 157
           RETIARLGLEKMLPTGWKYGTIRVGLRKNSQGAPWYNTDGSTDANNLEGVLWSPAEPRNG
Sbjct: 121 RETIARLGLEKMLPTGWKYGTIRVGLRKNSQGAPWYNTDGSTDANNLEGVLWSPAEPRNG 180

Query: 156 NWGGVQLNCATMWLWGGIFEGGRIHGQFFTNICLANNPNDRYRGYVCGKPA 4
           NWGGVQLNCATMWLWGGIFEGGRIHGQFFTNICLANNPNDRYRGYVCGKPA
Sbjct: 181 NWGGVQLNCATMWLWGGIFEGGRIHGQFFTNICLANNPNDRYRGYVCGKPA 231




[DB home][top]