Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F26D10_6
         (462 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17540012|ref|NP_503067.1| c-type lectin precursor family memb...   291   2e-78
gi|39585244|emb|CAE57487.1| Hypothetical protein CBG00456 [Caeno...   182   3e-45
gi|31746676|gb|AAP68953.1| Hypothetical protein C25B8.4b [Caenor...    73   2e-12
gi|17550620|ref|NP_509113.1| c-type lectin precursor family memb...    73   2e-12
gi|7496467|pir||T34115 hypothetical protein C25B8.4 - Caenorhabd...    73   2e-12
gi|32564893|ref|NP_495283.2| c-type lectin family member (26.1 k...    72   4e-12
gi|7505690|pir||T16605 hypothetical protein K10B2.3 - Caenorhabd...    72   4e-12
gi|17505709|ref|NP_492682.1| c-type lectin precursor family memb...    71   9e-12
gi|39586720|emb|CAE65762.1| Hypothetical protein CBG10851 [Caeno...    70   2e-11
gi|39585676|emb|CAE59878.1| Hypothetical protein CBG03358 [Caeno...    69   3e-11
gi|32564895|ref|NP_872010.1| c-type lectin family member (2G657)...    67   1e-10
gi|17511115|ref|NP_492448.1| c-type lectin family member (1J702)...    67   1e-10
gi|31746677|gb|AAP68954.1| Hypothetical protein C25B8.4c [Caenor...    59   3e-08
gi|39589808|emb|CAE67043.1| Hypothetical protein CBG12450 [Caeno...    59   3e-08
gi|14518283|gb|AAK64493.1| C-type lectin CTL-2 precursor [Necato...    51   7e-06
gi|39590313|emb|CAE66052.1| Hypothetical protein CBG11253 [Caeno...    42   0.003
gi|39590314|emb|CAE66053.1| Hypothetical protein CBG11254 [Caeno...    42   0.006
gi|47214702|emb|CAG01055.1| unnamed protein product [Tetraodon n...    41   0.007
gi|24137227|gb|AAN47097.1| dendritic cell-associated C-type lect...    41   0.007
gi|40556136|ref|NP_955221.1| CNPV198 C-type lectin-like protein ...    41   0.009
gi|283849|pir||B42972 coagulation factor X activating enzyme (EC...    40   0.012
gi|47940527|gb|AAH71746.1| Unknown (protein for MGC:88224) [Homo...    40   0.012
gi|25050261|ref|XP_194289.1| similar to C-type lectin, superfami...    40   0.012
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica]        40   0.016
gi|37675377|ref|NP_922940.1| C-type lectin, superfamily member 1...    40   0.016
gi|15986706|gb|AAL11714.1| beta-glucan receptor isoform D [Homo ...    40   0.016
gi|13386214|ref|NP_081494.1| RIKEN cDNA 1810046I24; DCAR alpha; ...    40   0.016
gi|34858498|ref|XP_342766.1| similar to NATURAL KILLER CELL SURF...    40   0.016
gi|26331490|dbj|BAC29475.1| unnamed protein product [Mus musculus]     40   0.021
gi|5123468|gb|AAD40224.2| natural killer cell protein group 2-C2...    40   0.021
gi|6754468|ref|NP_034783.1| killer cell lectin-like receptor sub...    40   0.021
gi|4583163|gb|AAD24969.1| natural killer cell receptor NKG2A [Mu...    40   0.021
gi|13384604|ref|NP_072092.2| C-type lectin, superfamily member 1...    39   0.028
gi|39590308|emb|CAE66047.1| Hypothetical protein CBG11247 [Caeno...    39   0.028
gi|42490740|ref|NP_612210.3| myeloid inhibitory C-type lectin-li...    39   0.036
gi|42490742|ref|NP_963917.1| myeloid inhibitory C-type lectin-li...    39   0.036
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ...    39   0.036
gi|47217441|emb|CAG10210.1| unnamed protein product [Tetraodon n...    39   0.047
gi|39841061|ref|NP_950199.1| similar to C lectin-related protein...    39   0.047
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus]                       38   0.062
gi|26334345|dbj|BAC30890.1| unnamed protein product [Mus musculus]     38   0.062
gi|39645101|gb|AAH63424.1| Unknown (protein for MGC:70602) [Homo...    38   0.062
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo...    38   0.062
gi|50795453|ref|XP_423779.1| PREDICTED: similar to FLJ45910 prot...    38   0.062
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro...    38   0.062
gi|27370068|ref|NP_766320.1| RIKEN cDNA 9830005G06 [Mus musculus...    38   0.062
gi|12831201|gb|AAK08513.1| natural killer cell receptor protein ...    38   0.062
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h...    38   0.062
gi|8347179|gb|AAF74541.1| NKG2-F2 [Macaca mulatta]                     38   0.080
gi|29244122|ref|NP_808354.1| hypothetical protein D230024O04 [Mu...    38   0.080
gi|15420804|gb|AAK97464.1| NKG2-F3 [Macaca mulatta]                    38   0.080
gi|7705338|ref|NP_057268.1| C-type lectin, superfamily member 6 ...    37   0.10
gi|25392205|pir||JC7608 type II lectin-like immunoreceptor - hum...    37   0.10
gi|46019638|emb|CAG25421.1| B-lec protein [Gallus gallus]              37   0.10
gi|47087179|ref|NP_998747.1| B-lec protein [Gallus gallus] >gnl|...    37   0.10
gi|37577119|ref|NP_919432.1| C-type lectin, superfamily member 6...    37   0.10
gi|11493654|gb|AAG35593.1| C-type lectin DDB27 short form [Homo ...    37   0.10
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n...    37   0.10
gi|6754466|ref|NP_034782.1| killer cell lectin-like receptor sub...    37   0.10
gi|18028293|gb|AAL56016.1| Fc-epsilon receptor III [Homo sapiens]      37   0.10
gi|37577115|ref|NP_919429.1| C-type lectin, superfamily member 6...    37   0.10
gi|37577117|ref|NP_919430.1| C-type lectin, superfamily member 6...    37   0.10
gi|4115907|gb|AAD03419.1| natural killer cell receptor NKG2A [Mu...    37   0.10
gi|5114112|gb|AAD40222.1| natural killer cell protein group 2-A2...    37   0.10
gi|7512207|pir||T28141 C type lectin, B locus - chicken >gnl|BL_...    37   0.10
gi|27691552|ref|XP_221781.1| similar to SIGNR2 [Rattus norvegicus]     37   0.10
gi|41151103|ref|XP_371143.1| similar to Asialoglycoprotein recep...    37   0.14
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n...    37   0.14
gi|34013700|gb|AAQ56013.1| lectin protein type II [Hippocampus c...    37   0.14
gi|37723174|gb|AAR02097.1| macrophage C-type lectin [Rattus norv...    37   0.14
gi|46811255|gb|AAT01921.1| C-type lectin domain [Pseudopleuronec...    37   0.14
gi|46019636|emb|CAG25420.1| B-lec protein [Gallus gallus]              37   0.14
gi|13277906|gb|AAH03824.1| Cd72 protein [Mus musculus]                 37   0.14
gi|6680890|ref|NP_031680.1| CD72 antigen [Mus musculus] >gnl|BL_...    37   0.18
gi|31542313|ref|NP_525126.2| C-type lectin, superfamily member 8...    37   0.18
gi|17226268|gb|AAL37713.1| C-type lectin-like receptor CLEC-6 [H...    37   0.18
gi|34858421|ref|XP_342754.1| similar to C-type lectin [Rattus no...    37   0.18
gi|346652|pir||A46509 B cell differentiation antigen Lyb-2/CD72 ...    37   0.18
gi|12831199|gb|AAK08512.1| natural killer cell receptor protein ...    37   0.18
gi|34328454|ref|NP_085102.3| killer cell lectin-like receptor su...    37   0.18
gi|7677472|gb|AAF67178.1| dectin-2 beta isoform [Mus musculus]         37   0.18
gi|7657333|ref|NP_055173.1| C-type lectin, superfamily member 9;...    36   0.23
gi|27806503|ref|NP_776557.1| oxidised low density lipoprotein (l...    36   0.23
gi|128355|sp|P27811|NK11_MOUSE Natural killer cell surface prote...    36   0.23
gi|31981644|ref|NP_034867.2| killer cell lectin-like receptor su...    36   0.23
gi|41149813|ref|XP_208667.3| similar to HEEE9341 [Homo sapiens] ...    36   0.23
gi|9506841|ref|NP_062134.1| killer cell lectin-like receptor sub...    36   0.23
gi|46395880|sp|Q8HY11|209L_HYLSY CD209 antigen-like protein 1 >g...    36   0.23
gi|10946714|ref|NP_067353.1| killer cell lectin-like receptor su...    36   0.23
gi|20381202|gb|AAH27742.1| Clecsf12 protein [Mus musculus]             36   0.23
gi|7245413|pdb|1C3A|B Chain B, Crystal Structure Of Flavocetin-A...    36   0.23
gi|34858419|ref|XP_232393.2| similar to dendritic cell immunorec...    36   0.31
gi|37675375|ref|NP_922939.1| C-type lectin, superfamily member 1...    36   0.31
gi|37781604|gb|AAP41745.1| natural killer cell receptor family C...    36   0.31
gi|27545354|ref|NP_775414.1| killer cell lectin-like receptor su...    36   0.31
gi|8489015|gb|AAF75560.1| HDCGC13P [Homo sapiens]                      35   0.40
gi|34870126|ref|XP_221778.2| similar to DC-SIGN [Rattus norvegicus]    35   0.40
gi|40555946|ref|NP_955031.1| CNPV008 C-type lectin-like protein ...    35   0.40
gi|37181558|gb|AAQ88590.1| CLECSF11 [Homo sapiens]                     35   0.40
gi|18466806|ref|NP_569708.1| C-type lectin, superfamily member 7...    35   0.40
gi|45580692|ref|NP_987099.1| C-type lectin, superfamily member 7...    35   0.40
gi|46395879|sp|Q8HY10|209L_HYLCO CD209 antigen-like protein 1 >g...    35   0.40
gi|1072826|pir||S52861 coat protein - pea enation mosaic virus >...    35   0.40
gi|3643898|gb|AAC42975.1| coat protein [Pea enation mosaic virus]      35   0.40
gi|20178352|ref|NP_619738.1| coat protein [Pea enation mosaic vi...    35   0.40
gi|3643899|gb|AAC42976.1| unknown [Pea enation mosaic virus]           35   0.40
gi|20178354|ref|NP_620027.1| aphid transmission protein [Pea ena...    35   0.40
gi|34858513|ref|XP_342771.1| killer cell lectin-like receptor su...    35   0.40
gi|34870122|ref|XP_221790.2| similar to SIGNR4 [Rattus norvegicus]     35   0.40
gi|2921746|gb|AAC40050.1| natural killer cell protein group 2-A ...    35   0.40
gi|45382191|ref|NP_990760.1| 17.5 [Gallus gallus] >gnl|BL_ORD_ID...    35   0.52
gi|11344854|gb|AAG34503.1| NKG2-A [Macaca mulatta]                     35   0.52
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica]        35   0.52
gi|37675379|ref|NP_922941.1| C-type lectin, superfamily member 1...    35   0.52
gi|23498706|emb|CAD28397.1| putative mannose-binding C-type lect...    35   0.52
gi|4502683|ref|NP_001773.1| CD72 antigen [Homo sapiens] >gnl|BL_...    35   0.52
gi|1078938|pir||JX0348 acrosomal major protein M3 - blue mussel ...    35   0.52
gi|1915927|emb|CAA70314.1| 21 kDa coat protein [Pea enation mosa...    35   0.52
gi|37675373|ref|NP_922938.1| C-type lectin, superfamily member 1...    35   0.52
gi|16660119|gb|AAL27539.1| DC-SIGN neck-less isoform [Mus musculus]    35   0.52
gi|37675383|ref|NP_922943.1| C-type lectin, superfamily member 1...    35   0.52
gi|1915928|emb|CAA70315.1| 54 kDa aphid transmission protein [Pe...    35   0.52
gi|13774945|gb|AAK39100.1| natural killer cell receptor protein ...    35   0.52
gi|4504883|ref|NP_002251.1| killer cell lectin-like receptor sub...    35   0.52
gi|20141529|sp|P26717|NKGC_HUMAN NKG2-C type II integral membran...    35   0.52
gi|9295441|gb|AAF86972.1| NK cell receptor C [Homo sapiens]            35   0.52
gi|6754728|ref|NP_034949.1| C-type lectin, superfamily member 8;...    35   0.68
gi|2773355|gb|AAB96779.1| excretory/secretory C-type lectin TES-...    35   0.68
gi|26354554|dbj|BAC40905.1| unnamed protein product [Mus musculus]     35   0.68
gi|15281075|gb|AAK91847.1| mDC-SIGN1A type II isoform [Homo sapi...    35   0.68
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic...    35   0.68
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (...    35   0.68
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr...    35   0.68
gi|7262384|ref|NP_015567.1| killer cell lectin-like receptor sub...    35   0.68
gi|4586556|dbj|BAA31253.2| proteoglycan core protein [Toxocara c...    35   0.68
gi|11967287|gb|AAG42041.1| agkicetin beta subunit precursor [Dei...    35   0.68
gi|46395881|sp|Q8HY12|209L_HYLLA CD209 antigen-like protein 1 >g...    35   0.68
gi|33667103|ref|NP_878910.1| C-type lectin, superfamily member 1...    35   0.68
gi|47523234|ref|NP_998970.1| lectin-like oxidized LDL receptor-1...    35   0.68
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma...    35   0.68
gi|23955480|gb|AAN40508.1| CD72c [Mus musculus]                        35   0.68
gi|20196239|dbj|BAB47156.2| skin mucus 31.7 kDa lectin AJL-2 [An...    35   0.68
gi|42716324|gb|AAS37670.1| dectin-1 [Mus musculus]                     35   0.68
gi|9910162|ref|NP_064332.1| C-type lectin, superfamily member 9 ...    35   0.68
gi|5453684|ref|NP_006335.1| C-type (calcium dependent, carbohydr...    35   0.68
gi|9910160|ref|NP_064392.1| C-type lectin, superfamily member 12...    35   0.68
gi|21902287|gb|AAM78498.1| natural killer cell lectin-like recep...    35   0.68
gi|181168|gb|AAA35726.1| proteoglycan core protein                     35   0.68
gi|21902289|gb|AAM78499.1| natural killer cell lectin-like recep...    35   0.68
gi|50756998|ref|XP_415356.1| PREDICTED: similar to C-type lectin...    35   0.68
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor...    34   0.89
gi|21902281|gb|AAM78495.1| natural killer cell lectin-like recep...    34   0.89
gi|34858417|ref|XP_342753.1| similar to RIKEN cDNA 3110037K17 [R...    34   0.89
gi|21902285|gb|AAM78497.1| natural killer cell lectin-like recep...    34   0.89
gi|21902277|gb|AAM78493.1| natural killer cell lectin-like recep...    34   0.89
gi|21902279|gb|AAM78494.1| natural killer cell lectin-like recep...    34   0.89
gi|21902283|gb|AAM78496.1| natural killer cell lectin-like recep...    34   0.89
gi|21902275|gb|AAM78492.1| natural killer cell lectin-like recep...    34   0.89
gi|21902273|gb|AAM78491.1| natural killer cell lectin-like recep...    34   0.89
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;...    34   0.89
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa]            34   0.89
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g...    34   0.89
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens]          34   0.89
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul...    34   0.89
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n...    34   0.89
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_...    34   0.89
gi|31978955|gb|AAP58453.1| dendritic cell immuno-activating rece...    34   0.89
gi|50803192|ref|XP_428659.1| PREDICTED: similar to C-type lectin...    34   0.89
gi|1915925|emb|CAA70313.1| 21 kDa coat protein [Pea enation mosa...    34   0.89
gi|9634922|ref|NP_039223.1| ORF FPV260 C-type lectin gene family...    34   0.89
gi|18777739|ref|NP_570975.1| Cd209e antigen [Mus musculus] >gnl|...    34   0.89
gi|21902293|gb|AAM78501.1| natural killer cell lectin-like recep...    34   0.89
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr...    34   1.2
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris]    34   1.2
gi|26334303|dbj|BAC30869.1| unnamed protein product [Mus musculus]     34   1.2
gi|17559406|ref|NP_506591.1| c-type lectin and CUB domain contai...    34   1.2
gi|18875404|ref|NP_573501.1| CD209a antigen [Mus musculus] >gnl|...    34   1.2
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA...    34   1.2
gi|25245527|gb|AAN72437.1| flavocetin-A beta chain [Trimeresurus...    34   1.2
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma...    34   1.2
gi|50766697|ref|XP_423011.1| PREDICTED: similar to amino acid fe...    34   1.2
gi|18777733|ref|NP_570973.1| CD209c antigen [Mus musculus] >gnl|...    34   1.2
gi|50765303|ref|XP_426855.1| PREDICTED: similar to C-type lectin...    34   1.2
gi|8347171|gb|AAF74537.1| NKG2-Ce [Macaca mulatta]                     33   1.5
gi|8347173|gb|AAF74538.1| NKG2-Ce [Macaca mulatta]                     33   1.5
gi|11344846|gb|AAG34499.1| NKG2-C [Macaca mulatta]                     33   1.5
gi|47218445|emb|CAG03717.1| unnamed protein product [Tetraodon n...    33   1.5
gi|8347167|gb|AAF74535.1| NKG2-C2 [Macaca mulatta]                     33   1.5
gi|8347165|gb|AAF74534.1| NKG2-C2 [Macaca mulatta]                     33   1.5
gi|11344848|gb|AAG34500.1| NKG2-C [Macaca mulatta]                     33   1.5
gi|40555954|ref|NP_955039.1| CNPV016 C-type lectin-like protein ...    33   1.5
gi|8347169|gb|AAF74536.1| NKG2-C [Macaca mulatta]                      33   1.5
gi|15420802|gb|AAK97463.1| NKG2-Ce2 [Macaca mulatta]                   33   1.5
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal...    33   1.5
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal...    33   1.5
gi|50730821|ref|XP_417032.1| PREDICTED: similar to antithrombin ...    33   1.5
gi|9634933|ref|NP_038971.1| ORF FPV008 C-type lectin gene family...    33   1.5
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio]                     33   1.5
gi|23397421|ref|NP_694877.1| RIKEN cDNA 3110037K17 [Mus musculus...    33   1.5
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE...    33   1.5
gi|20978530|sp|Q9MZK6|NKGC_MACMU NKG2-C type II integral membran...    33   1.5
gi|8347159|gb|AAF74531.1| NKG2-C [Macaca mulatta] >gnl|BL_ORD_ID...    33   1.5
gi|8347161|gb|AAF74532.1| NKG2-C [Macaca mulatta]                      33   1.5
gi|8347163|gb|AAF74533.1| NKG2-C [Macaca mulatta]                      33   1.5
gi|11344850|gb|AAG34501.1| NKG2-C [Macaca mulatta]                     33   1.5
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal...    33   1.5
gi|28628340|gb|AAO43607.1| serum lectin isoform 3 precursor [Sal...    33   1.5
gi|50766146|ref|XP_422990.1| PREDICTED: similar to amino acid fe...    33   1.5
gi|15383614|gb|AAK91863.1| sDC-SIGN2 type I isoform [Homo sapiens]     33   2.0
gi|7262386|ref|NP_031359.1| killer cell lectin-like receptor sub...    33   2.0
gi|9295429|gb|AAF86967.1| NK cell receptor C [Pan troglodytes]         33   2.0
gi|15420808|gb|AAK97466.1| NKG2-A [Macaca mulatta]                     33   2.0
gi|38503187|sp|Q9GME8|NKGC_PANTR NKG2-C type II integral membran...    33   2.0
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti...    33   2.0
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens]    33   2.0
gi|4586836|dbj|BAA76496.1| type II membrane protein similar to H...    33   2.0
gi|15081167|gb|AAK83803.1| NKG2E [Homo sapiens]                        33   2.0
gi|20978524|sp|Q95MI4|NKGE_PANTR NKG2-E type II integral membran...    33   2.0
gi|4504885|ref|NP_002252.1| killer cell lectin-like receptor sub...    33   2.0
gi|15383618|gb|AAK91865.1| sDC-SIGN2 type III isoform [Homo sapi...    33   2.0
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca...    33   2.0
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr...    33   2.0
gi|34146972|gb|AAB37037.2| Hypothetical protein F52E1.2 [Caenorh...    33   2.0
gi|46395875|sp|Q8HY02|C209_HYLSY CD209 antigen (Dendritic cell-s...    33   2.0
gi|206105|gb|AAA41836.1| proteoglycan                                  33   2.0
gi|15383612|gb|AAK91862.1| mDC-SIGN2 type VI isoform [Homo sapiens]    33   2.0
gi|8163745|gb|AAF73837.1| NKG2-B [Macaca mulatta]                      33   2.0
gi|817989|emb|CAA45971.1| natural killer cell receptor-P1 [Mus m...    33   2.0
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens]            33   2.0
gi|9295431|gb|AAF86968.1| NK cell receptor C [Pan troglodytes]         33   2.0
gi|938266|emb|CAA45976.1| natural killer cell receptor-P1 [Mus m...    33   2.0
gi|34979184|gb|AAQ83725.1| dendritic cell-associated lectin 2 [H...    33   2.0
gi|15081149|gb|AAK83794.1| NKG2E [Pan troglodytes]                     33   2.0
gi|12084797|gb|AAG13848.2| probable mannose binding C-type lecti...    33   2.0
gi|42542390|ref|NP_055072.3| CD209 antigen-like isoform 1; proba...    33   2.0
gi|37575445|gb|AAQ93687.1| mucrocetin beta chain [Protobothrops ...    33   2.0
gi|13383470|gb|AAK20998.1| L-SIGN [Homo sapiens]                       33   2.0
gi|24654876|ref|NP_611309.1| CG14500-PA [Drosophila melanogaster...    33   2.0
gi|47607497|ref|NP_999841.1| CD209 antigen-like isoform 2; proba...    33   2.0
gi|18158893|pdb|1K9J|A Chain A, Complex Of Dc-Signr And Glcnac2m...    33   2.0
gi|9295433|gb|AAF86969.1| NK cell receptor C [Pan troglodytes]         33   2.0
gi|34392369|dbj|BAC82506.1| C-type lectin B-lec homologous [Cotu...    33   2.0
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro...    33   2.0
gi|50513581|pdb|1SL6|A Chain A, Crystal Structure Of A Fragment ...    33   2.0
gi|8347181|gb|AAF74542.1| NKG2-FE [Macaca mulatta]                     33   2.6
gi|34870118|ref|XP_221808.2| similar to DC-SIGN [Rattus norvegicus]    33   2.6
gi|436943|gb|AAA03707.1| alpha-amylase                                 33   2.6
gi|8163749|gb|AAF73839.1| NKG2-Adtm- [Macaca mulatta]                  33   2.6
gi|15420806|gb|AAK97465.1| NKG2-A [Macaca mulatta]                     33   2.6
gi|4504881|ref|NP_002250.1| killer cell lectin-like receptor sub...    33   2.6
gi|8163743|gb|AAF73836.1| NKG2-A- [Macaca mulatta]                     33   2.6
gi|14915793|gb|AAK73811.1| natural killer cell receptor protein ...    33   2.6
gi|46395876|sp|Q8HY03|C209_HYLLA CD209 antigen (Dendritic cell-s...    33   2.6
gi|46395874|sp|Q8HY01|C209_HYLCO CD209 antigen (Dendritic cell-s...    33   2.6
gi|15076564|dbj|BAB62393.1| chB1 [Gallus gallus]                       33   2.6
gi|435555|gb|AAA03640.1| alpha-amylase                                 33   2.6
gi|4504879|ref|NP_002249.1| killer cell lectin-like receptor sub...    33   2.6
gi|46395872|sp|Q8HXZ8|C209_GORGO CD209 antigen (Dendritic cell-s...    33   2.6
gi|39653363|gb|AAR29349.1| ORF26 [Fowl adenovirus 1]                   33   2.6
gi|33694913|tpg|DAA01642.1| TPA: ORF26 [Fowl adenovirus 1]             33   2.6
gi|18157520|dbj|BAB83835.1| supported by GENSCAN and partially h...    33   2.6
gi|46396751|sp|P83515|STR2_STRCA Struthiocalcin-2 (SCA-2)              33   2.6
gi|435557|gb|AAA03641.1| alpha-amylase                                 33   2.6
gi|6678744|ref|NP_032552.1| killer cell lectin-like receptor sub...    33   2.6
gi|47214950|emb|CAG10772.1| unnamed protein product [Tetraodon n...    33   2.6
gi|438387|gb|AAA03715.1| alpha-amylase                                 33   2.6
gi|49455204|emb|CAF22244.1| NKp80 receptor [Macaca mulatta]            33   2.6
gi|47605899|sp|Q8MI05|KLR1_MACFA Killer cell lectin-like recepto...    33   2.6
gi|39655010|pdb|1V4L|B Chain B, Crystal Structure Of A Platelet ...    33   2.6
gi|34877265|ref|XP_225585.2| similar to macrophage mannose recep...    32   3.4
gi|17384256|emb|CAC83675.1| mucin 5 [Homo sapiens]                     32   3.4
gi|38089049|ref|XP_284386.2| RIKEN cDNA 1810029C22 [Mus musculus]      32   3.4
gi|50728376|ref|XP_416114.1| PREDICTED: similar to protein tyros...    32   3.4
gi|46048318|ref|NP_705726.2| C lectin-related protein A [Mus mus...    32   3.4
gi|13928898|ref|NP_113837.1| killer cell lectin-like receptor su...    32   3.4
gi|23498707|emb|CAD28398.1| putative mannose-binding C-type lect...    32   3.4
gi|46395942|sp|Q95LC6|C209_MACNE CD209 antigen (Dendritic cell-s...    32   3.4
gi|47564066|ref|NP_001001158.1| DEC-205/CD205 protein [Bos tauru...    32   3.4
gi|46395941|sp|Q95J96|C209_MACMU CD209 antigen (Dendritic cell-s...    32   3.4
gi|15420782|gb|AAK97458.1| dendritic cell-specific ICAM-3 grabbi...    32   3.4
gi|15420784|gb|AAK97459.1| dendritic cell-specific ICAM-3 grabbi...    32   3.4
gi|14579651|gb|AAK69351.1| akitonin precursor [Deinagkistrodon a...    32   3.4
gi|23321263|gb|AAN23126.1| agglucetin-beta 1 subunit precursor [...    32   3.4
gi|23498708|emb|CAD28399.1| putative mannose-binding C-type lect...    32   3.4
gi|46395871|sp|Q8HXZ7|C209_PANTR CD209 antigen (Dendritic cell-s...    32   3.4
gi|27356928|gb|AAL89544.1| putative CD209 protein [Pan troglodytes]    32   3.4
gi|27356930|gb|AAL89545.1| putative CD209 protein [Pan troglodytes]    32   3.4
gi|37813574|gb|AAR04559.1| L-SIGN variant [Homo sapiens]               32   3.4
gi|33341212|gb|AAQ15167.1| stejaggregin-A beta chain-1 [Trimeres...    32   3.4
gi|46395878|sp|Q8HY06|209L_GORGO CD209 antigen-like protein 1 >g...    32   3.4
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu...    32   3.4
gi|28374182|gb|AAH46292.1| Similar to RIKEN cDNA 1810029C22 gene...    32   3.4
gi|31127172|gb|AAH52782.1| Unknown (protein for IMAGE:3371321) [...    32   3.4
gi|38089051|ref|XP_284376.2| RIKEN cDNA 2310066I10 [Mus musculus]      32   3.4
gi|21492575|ref|NP_659695.1| EEV glycoprotein [Sheeppox virus]         32   3.4
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s...    32   3.4
gi|34013702|gb|AAQ56014.1| lectin protein type III [Hippocampus ...    32   3.4
gi|50757074|ref|XP_415370.1| PREDICTED: similar to MHC Rfp-Y cla...    32   3.4
gi|20978525|sp|Q95MI5|NKGA_PANTR NKG2-A/NKG2-B type II integral ...    32   4.4
gi|15081145|gb|AAK83792.1| NKG2A [Pan troglodytes]                     32   4.4
gi|18182678|gb|AAL65232.1| NKG2E [Homo sapiens]                        32   4.4
gi|15281091|gb|AAK91855.1| sDC-SIGN1B type I isoform [Homo sapiens]    32   4.4
gi|15281081|gb|AAK91850.1| sDC-SIGN1A type I isoform [Homo sapiens]    32   4.4
gi|15281085|gb|AAK91852.1| sDC-SIGN1A type III isoform [Homo sap...    32   4.4
gi|46395899|sp|Q8MIS5|209P_MACMU CD209 antigen-like protein 2 >g...    32   4.4
gi|46395660|sp|P60883|C209_CERAE CD209 antigen (Dendritic cell-s...    32   4.4
gi|34013698|gb|AAQ56012.1| lectin protein type I [Hippocampus co...    32   4.4
gi|18652791|gb|AAK74185.1| type II membrane protein CD209 [Macac...    32   4.4
gi|16118475|gb|AAL14438.1| dendritic cell-specific ICAM-3 grabbi...    32   4.4
gi|15281089|gb|AAK91854.1| mDC-SIGN1B type I isoform [Homo sapiens]    32   4.4
gi|10863957|ref|NP_066978.1| CD209 antigen; dendritic cell-speci...    32   4.4
gi|46395877|sp|Q8HY04|C209_PAPHA CD209 antigen (Dendritic cell-s...    32   4.4
gi|254095|gb|AAB22979.1| NK1.1 alloantigen; natural killer cell ...    32   4.4
gi|6678746|ref|NP_032553.1| killer cell lectin-like receptor sub...    32   4.4
gi|18158646|pdb|1KCG|A Chain A, Nkg2d In Complex With Ulbp3 >gnl...    32   4.4
gi|34098771|sp|Q9YI92|MMHB_AGKHA Mamushigin beta chain precursor...    32   4.4
gi|6715115|gb|AAF26287.1| agkisacutacin B chain [Deinagkistrodon...    32   4.4
gi|33391736|gb|AAQ17468.1| factor X activator light chain 1 prec...    32   4.4
gi|27901451|emb|CAD61337.1| C-type lectin [Gallus gallus]              32   4.4
gi|15081151|gb|AAK83795.1| NKG2E [Pan troglodytes] >gnl|BL_ORD_I...    32   4.4
gi|15281077|gb|AAK91848.1| mDC-SIGN1A type III isoform [Homo sap...    32   4.4
gi|15281093|gb|AAK91856.1| sDC-SIGN1B type II isoform [Homo sapi...    32   4.4
gi|9295443|gb|AAF86973.1| NK cell receptor D [Homo sapiens]            32   4.4
gi|6679052|ref|NP_031386.1| NKG2-D type II integral membrane pro...    32   4.4
gi|15281083|gb|AAK91851.1| sDC-SIGN1A TYPE II isoform [Homo sapi...    32   4.4
gi|34935132|ref|XP_233384.2| similar to B-cell differentiation a...    32   4.4
gi|34858502|ref|XP_342768.1| similar to osteoclast inhibitory le...    32   4.4
gi|15281095|gb|AAK91857.1| sDC-SIGN1B type III isoform [Homo sap...    32   4.4
gi|50513580|pdb|1SL5|A Chain A, Crystal Structure Of Dc-Sign Car...    32   4.4
gi|30749494|pdb|1MPU|A Chain A, Crystal Structure Of The Free Hu...    32   4.4
gi|34870124|ref|XP_344065.1| similar to SIGNR3 [Rattus norvegicus]     32   4.4
gi|14488773|pdb|1HYR|B Chain B, Crystal Structure Of Human Mica ...    32   4.4
gi|50798231|ref|XP_423996.1| PREDICTED: similar to C-type lectin...    32   4.4
gi|224435|prf||1104300A insulin receptor precursor                     32   4.4
gi|13774951|gb|AAK39103.1| natural killer cell receptor protein ...    32   4.4
gi|33973|emb|CAA26096.1| unnamed protein product [Homo sapiens]        32   4.4
gi|38085270|ref|XP_355818.1| similar to NKR-P1F [Mus musculus]         32   4.4
gi|18158883|pdb|1K9I|A Chain A, Complex Of Dc-Sign And Glcnac2ma...    32   4.4
gi|50513579|pdb|1SL4|A Chain A, Crystal Structure Of Dc-Sign Car...    32   4.4
gi|20978528|sp|Q9MZJ3|NKGA_MACMU NKG2-A/NKG2-B type II integral ...    32   5.8
gi|39582561|emb|CAE63880.1| Hypothetical protein CBG08446 [Caeno...    32   5.8
gi|8163747|gb|AAF73838.1| NKG2-Adtm [Macaca mulatta]                   32   5.8
gi|13879298|gb|AAH06623.1| Clecsf6 protein [Mus musculus]              32   5.8
gi|477362|pir||A48925 mannose receptor precursor, macrophage - m...    32   5.8
gi|6678932|ref|NP_032651.1| mannose receptor, C type 1 [Mus musc...    32   5.8
gi|20429232|dbj|BAB91356.1| NKG2-A [Homo sapiens]                      32   5.8
gi|34854717|ref|XP_215737.2| similar to phospholipase A2 recepto...    32   5.8
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus]                     32   5.8
gi|1143285|gb|AAA87847.1| brevican core protein                        32   5.8
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_...    32   5.8
gi|50757054|ref|XP_415365.1| PREDICTED: similar to C-type lectin...    32   5.8
gi|27901450|emb|CAD61336.1| C-type lectin [Gallus gallus]              32   5.8
gi|13774947|gb|AAK39101.1| natural killer cell receptor protein ...    32   5.8
gi|11693134|ref|NP_071788.1| Gal/GalNAc-specific lectin; monogly...    32   5.8
gi|27356910|gb|AAL89542.1| putative CD209 protein [Pongo pygmaeus]     32   5.8
gi|7433076|pir||T04366 probable peroxidase (EC 1.11.1.7), cation...    32   5.8
gi|46395873|sp|Q8HY00|C209_PONPY CD209 antigen (Dendritic cell-s...    32   5.8
gi|6753442|ref|NP_036129.1| C-type (calcium dependent, carbohydr...    32   5.8
gi|8392926|ref|NP_058885.1| asialoglycoprotein receptor 2; rat h...    32   5.8
gi|40363429|dbj|BAD06213.1| pancreatitis-associated protein [Can...    32   5.8
gi|46396750|sp|P83514|STR1_STRCA Struthiocalcin-1 (SCA-1)              32   5.8
gi|11277029|pir||JC7135 agkisacutacin beta chain precursor - sha...    32   5.8
gi|37577107|ref|NP_005118.2| C-type lectin, superfamily member 2...    32   5.8
gi|50757017|ref|XP_415360.1| PREDICTED: similar to C-type lectin...    32   5.8
gi|1632816|emb|CAA65480.1| C-Type lectin [Homo sapiens]                32   5.8
gi|8347177|gb|AAF74540.1| NKG2-D [Macaca mulatta]                      32   5.8
gi|31789961|gb|AAP58738.1| C-type lectin receptor [Paralabidochr...    32   5.8
gi|20978529|sp|Q9MZJ7|NKGD_MACMU NKG2-D type II integral membran...    32   5.8
gi|21902299|gb|AAM78504.1| natural killer cell lectin-like recep...    32   5.8
gi|9295439|gb|AAF86971.1| NK cell receptor D [Pan troglodytes]         32   5.8
gi|938265|emb|CAA45972.1| natural killer cell receptor-P1 [Mus m...    32   5.8
gi|8163751|gb|AAF73840.1| NKG2-Bdtm [Macaca mulatta]                   32   5.8
gi|21902297|gb|AAM78503.1| natural killer cell lectin-like recep...    32   5.8
gi|4808979|gb|AAD30040.1| receptor protein-tyrosine kinase; HTK2...    32   5.8
gi|24286113|gb|AAN46677.1| IFN-alpha2b-inducing related protein ...    32   5.8
gi|50757014|ref|XP_415359.1| PREDICTED: similar to C-type lectin...    32   5.8
gi|9634905|ref|NP_039198.1| ORF FPV235 C-type lectin gene family...    32   5.8
gi|290002|gb|AAA49200.1| antifreeze protein >gnl|BL_ORD_ID|11388...    32   5.8
gi|7705574|ref|NP_057607.1| killer cell lectin-like receptor sub...    32   5.8
gi|27356854|gb|AAL89535.1| putative CD209L1 protein [Pan troglod...    32   5.8
gi|46395882|sp|Q8HYC0|209L_PANTR CD209 antigen-like protein 1 >g...    32   5.8
gi|26387827|dbj|BAC25626.1| unnamed protein product [Mus musculus]     32   5.8
gi|7188569|gb|AAF37805.1| lectin-like receptor F1, splice varian...    32   5.8
gi|18426818|ref|NP_569086.1| osteoclast inhibitory lectin [Rattu...    31   7.5
gi|20149720|ref|NP_619589.1| oxidized low density lipoprotein (l...    31   7.5
gi|37813344|gb|AAR04440.1| insulin receptor precursor [Oryctolag...    31   7.5
gi|10281669|ref|NP_037384.1| C-type lectin, superfamily member 5...    31   7.5
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ...    31   7.5
gi|45708678|gb|AAH27858.1| CLECSF14 protein [Homo sapiens]             31   7.5
gi|32566191|ref|NP_503091.2| c-type lectin family member (4S295)...    31   7.5
gi|33341190|gb|AAQ15156.1| factor IX/X binding protein beta chai...    31   7.5
gi|14915789|gb|AAK73809.1| natural killer cell receptor group D ...    31   7.5
gi|14915791|gb|AAK73810.1| natural killer cell receptor group D ...    31   7.5
gi|4337052|gb|AAD18056.1| fibrinogen clotting inhibitor B chain ...    31   7.5
gi|15150562|ref|NP_150557.1| LSDV123 putative EEV protein [lumpy...    31   7.5
gi|22595816|gb|AAN02848.1| putative EEV protein [lumpy skin dise...    31   7.5
gi|34858506|ref|XP_232399.2| similar to C-type lectin related f ...    31   7.5
gi|6049176|gb|AAF02491.1| type II transmembrane protein MDL-1 [H...    31   7.5
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le...    31   9.8
gi|39595893|emb|CAE67396.1| Hypothetical protein CBG12882 [Caeno...    31   9.8
gi|211655|gb|AAA48720.1| proteoglycan core protein                     31   9.8
gi|37360054|dbj|BAC98005.1| mKIAA0709 protein [Mus musculus]           31   9.8
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs...    31   9.8
gi|1142650|gb|AAB96837.1| C-type lectin [Gallus gallus]                31   9.8
gi|13528921|gb|AAH05254.1| C-type lectin, superfamily member 2 [...    31   9.8
gi|28571501|ref|NP_649461.2| CG1084-PA [Drosophila melanogaster]...    31   9.8
gi|6969829|gb|AAF34041.1| TA44R [Vaccinia virus (strain Tian Tan)]     31   9.8
gi|11066256|gb|AAG28522.1| halyxin B-chain precursor [Gloydius h...    31   9.8
gi|11281524|pir||T37420 EEV glycoprotein - vaccinia virus (strai...    31   9.8
gi|4505501|ref|NP_002534.1| oxidised low density lipoprotein (le...    31   9.8
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep...    31   9.8
gi|15214984|gb|AAH12621.1| KLRG1 protein [Homo sapiens]                31   9.8
gi|20385163|gb|AAM21196.1| C-type mannose-binding lectin [Oncorh...    31   9.8
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus]     31   9.8
gi|2654177|gb|AAC34731.1| mast cell function-associated antigen ...    31   9.8
gi|47717096|ref|NP_005801.3| killer cell lectin-like receptor su...    31   9.8
gi|20302733|gb|AAM18862.1| unknown [Branchiostoma floridae]            31   9.8
gi|45384248|ref|NP_990383.1| C-type lectin short form [Gallus ga...    31   9.8
gi|39585194|emb|CAE57437.1| Hypothetical protein CBG00399 [Caeno...    31   9.8
gi|50732401|ref|XP_418618.1| PREDICTED: similar to Macrophage ma...    31   9.8
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co...    31   9.8
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ...    31   9.8


>gi|17540012|ref|NP_503067.1| c-type lectin precursor family member
           (4S221) [Caenorhabditis elegans]
 gi|7499892|pir||T21396 hypothetical protein F26D10.12 -
           Caenorhabditis elegans
 gi|3924752|emb|CAB02321.1| Hypothetical protein F26D10.12
           [Caenorhabditis elegans]
          Length = 153

 Score =  291 bits (746), Expect = 2e-78
 Identities = 138/153 (90%), Positives = 138/153 (90%)
 Frame = +1

Query: 1   MSTVLGKLLILSVCLVGIFGNRIFGVKTCPKGWLQFEDNCYIRQPDFSSFRESVKNCEKR 180
           MSTVLGKLLILSVCLVGIFGNRIFGVKTCPKGWLQFEDNCYIRQPDFSSFRESVKNCEKR
Sbjct: 1   MSTVLGKLLILSVCLVGIFGNRIFGVKTCPKGWLQFEDNCYIRQPDFSSFRESVKNCEKR 60

Query: 181 GAKLFHFDDSFEFEAVRNLFPDYYFTWMQAXXXXXXXXXXXXXXXKMNGKNSAAKCIAFY 360
           GAKLFHFDDSFEFEAVRNLFPDYYFTWMQA               KMNGKNSAAKCIAFY
Sbjct: 61  GAKLFHFDDSFEFEAVRNLFPDYYFTWMQAEVEEELEWLYEPYEEKMNGKNSAAKCIAFY 120

Query: 361 SSPTKSYNYFYPCTSHFHSICEKSLQSFRQWMD 459
           SSPTKSYNYFYPCTSHFHSICEKSLQSFRQWMD
Sbjct: 121 SSPTKSYNYFYPCTSHFHSICEKSLQSFRQWMD 153




[DB home][top]