Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F26H11_1
(365 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25154114|ref|NP_496992.2| drosophila Enhancer of zeste/polyco... 245 1e-64
gi|29427556|sp|O17514|MES2_CAEEL Polycomb protein mes-2 (Materna... 245 1e-64
gi|7506342|pir||T21436 hypothetical protein R06A4.7 - Caenorhabd... 245 1e-64
gi|39582720|emb|CAE65926.1| Hypothetical protein CBG11099 [Caeno... 133 7e-31
gi|404864|gb|AAC46462.1| E(z) 107 7e-23
gi|24662251|ref|NP_524021.2| CG6502-PA [Drosophila melanogaster]... 107 7e-23
gi|31196943|ref|XP_307419.1| ENSANGP00000012923 [Anopheles gambi... 106 1e-22
gi|34855618|ref|XP_342681.1| similar to enhancer of zeste 2 isof... 105 2e-22
gi|50733454|ref|XP_418879.1| PREDICTED: similar to Enhancer of z... 105 2e-22
gi|41393513|gb|AAS02036.1| unknown [Homo sapiens] 105 2e-22
gi|41393512|gb|AAS02035.1| unknown [Homo sapiens] 105 2e-22
gi|23510384|ref|NP_694543.1| enhancer of zeste 2 isoform b; enha... 105 2e-22
gi|1279913|gb|AAC50591.1| ENX-1 [Homo sapiens] 105 2e-22
gi|21361095|ref|NP_004447.2| enhancer of zeste 2 isoform a; enha... 105 2e-22
gi|3334180|sp|Q15910|EZH2_HUMAN Enhancer of zeste homolog 2 (ENX... 105 2e-22
gi|13277756|gb|AAH03772.1| Enhancer of zeste homolog 2 [Mus musc... 105 2e-22
gi|16605541|emb|CAC86146.1| EZH2 homolog [Tetraodon nigroviridis] 105 2e-22
gi|13560800|gb|AAK30208.1| enhancer of zeste [Xenopus laevis] 105 2e-22
gi|6679721|ref|NP_031997.1| enhancer of zeste homolog 2 [Mus mus... 103 1e-21
gi|7512409|pir||G02838 enhancer-of-zeste homolog 2 - human >gnl|... 102 1e-21
gi|34873768|ref|XP_220986.2| similar to Enx-2 [Rattus norvegicus] 100 9e-21
gi|50760817|ref|XP_418145.1| PREDICTED: similar to enhancer of z... 100 9e-21
gi|1638875|gb|AAC50778.1| enhancer of zeste homolog 1 [Homo sapi... 100 9e-21
gi|6679719|ref|NP_031996.1| enhancer of zeste homolog 1 [Mus mus... 100 9e-21
gi|3334179|sp|P70351|EZH1_MOUSE Enhancer of zeste homolog 1 (ENX... 100 9e-21
gi|5852360|gb|AAD54021.1| Ezh1 protein [Mus musculus] 100 9e-21
gi|19923202|ref|NP_001982.2| enhancer of zeste homolog 1 [Homo s... 100 9e-21
gi|40788238|dbj|BAA20842.2| KIAA0388 [Homo sapiens] 100 9e-21
gi|29565495|emb|CAD18871.3| enhancer of zeste protein [Oryza sat... 97 6e-20
gi|22535907|gb|AAN01115.1| SET domain-containing protein [Oryza ... 97 8e-20
gi|33112287|sp|Q8S4P4|EZ3_MAIZE Polycomb protein EZ3 (Enhancer o... 97 1e-19
gi|33112288|sp|Q8S4P5|EZ2_MAIZE Polycomb protein EZ2 (Enhancer o... 97 1e-19
gi|1903019|emb|CAA71599.1| curly leaf [Arabidopsis thaliana] 97 1e-19
gi|15227824|ref|NP_179919.1| curly leaf protein (CURLY LEAF) / p... 97 1e-19
gi|34898688|ref|NP_910690.1| putative curly leaf protein [Oryza ... 96 2e-19
gi|11862963|dbj|BAB19344.1| putative curly leaf protein [Oryza s... 96 2e-19
gi|34393752|dbj|BAC84952.1| PHCLF3 [Petunia x hybrida] 95 4e-19
gi|47218821|emb|CAG02806.1| unnamed protein product [Tetraodon n... 93 1e-18
gi|34393750|dbj|BAC84951.1| PHCLF2 [Petunia x hybrida] 90 9e-18
gi|33112289|sp|Q8S4P6|EZ1_MAIZE Polycomb protein EZ1 (Enhancer o... 89 2e-17
gi|7486845|pir||T01503 hypothetical protein T10M13.3 - Arabidops... 89 3e-17
gi|18411808|ref|NP_567221.1| zeste-like protein 1 (EZA1) [Arabid... 89 3e-17
gi|19173296|ref|NP_597099.1| similarity to ENHANCER OF ZESTE PRO... 88 4e-17
gi|34393748|dbj|BAC84950.1| PHCLF1 [Petunia x hybrida] 85 4e-16
gi|18378985|ref|NP_563658.1| maternal embryogenesis control prot... 84 9e-16
gi|39588036|emb|CAE57267.1| Hypothetical protein CBG00165 [Caeno... 74 5e-13
gi|39579475|emb|CAE56884.1| Hypothetical protein CBG24723 [Caeno... 74 5e-13
gi|27357052|gb|AAN86552.1| curly [Brassica rapa subsp. pekinensi... 68 4e-11
gi|31197981|ref|XP_307938.1| ENSANGP00000021856 [Anopheles gambi... 67 6e-11
gi|47197867|emb|CAF88456.1| unnamed protein product [Tetraodon n... 67 8e-11
gi|47201309|emb|CAF87541.1| unnamed protein product [Tetraodon n... 67 8e-11
gi|17552316|ref|NP_498041.1| SET (trithorax/polycomb) domain con... 65 2e-10
gi|41149776|ref|XP_037523.8| KIAA1076 protein [Homo sapiens] 65 2e-10
gi|29243934|ref|NP_808249.1| cDNA sequence BC035291 [Mus musculu... 65 2e-10
gi|26251880|gb|AAH40775.1| BC035291 protein [Mus musculus] 65 2e-10
gi|17552320|ref|NP_498039.1| SET (trithorax/polycomb) domain con... 65 2e-10
gi|28972602|dbj|BAC65717.1| mKIAA1076 protein [Mus musculus] 65 2e-10
gi|34872345|ref|XP_222179.2| hypothetical protein XP_222179 [Rat... 65 2e-10
gi|50756389|ref|XP_415143.1| PREDICTED: similar to KIAA1076 prot... 65 2e-10
gi|17552318|ref|NP_498040.1| SET (trithorax/polycomb) domain con... 65 2e-10
gi|25395700|pir||H88444 protein C26E6.12 [imported] - Caenorhabd... 65 2e-10
gi|27371314|gb|AAH41681.1| BC035291 protein [Mus musculus] 65 2e-10
gi|5689489|dbj|BAA83028.1| KIAA1076 protein [Homo sapiens] 65 2e-10
gi|39591024|emb|CAE58804.1| Hypothetical protein CBG02011 [Caeno... 65 3e-10
gi|50811620|ref|XP_422858.1| PREDICTED: similar to ash1 (absent,... 64 5e-10
gi|50425321|ref|XP_461254.1| unnamed protein product [Debaryomyc... 64 7e-10
gi|2934700|dbj|BAA25019.1| ENX-2 [Homo sapiens] 64 9e-10
gi|47223666|emb|CAF99275.1| unnamed protein product [Tetraodon n... 64 9e-10
gi|46440662|gb|EAK99965.1| hypothetical protein CaO19.13430 [Can... 63 2e-09
gi|30704948|gb|AAH52194.1| Ash1l protein [Mus musculus] 62 2e-09
gi|47078482|ref|NP_619620.2| absent, small, or homeotic discs 1;... 62 2e-09
gi|26328889|dbj|BAC28183.1| unnamed protein product [Mus musculus] 62 2e-09
gi|13442965|gb|AAK26242.1| putative chromatin remodeling factor ... 62 2e-09
gi|8922081|ref|NP_060959.1| ash1 (absent, small, or homeotic)-li... 62 2e-09
gi|50285531|ref|XP_445194.1| unnamed protein product [Candida gl... 62 2e-09
gi|22121720|gb|AAM89289.1| SET domain-containing protein SET102 ... 62 2e-09
gi|47217812|emb|CAG07226.1| unnamed protein product [Tetraodon n... 62 3e-09
gi|34857960|ref|XP_227409.2| similar to ash1 (absent, small, or ... 62 3e-09
gi|27552784|gb|AAH42890.1| BC010250 protein [Mus musculus] 61 6e-09
gi|20071601|gb|AAH27450.1| Similar to KIAA1076 protein [Homo sap... 61 6e-09
gi|30794258|ref|NP_821172.1| cDNA sequence BC010250 [Mus musculu... 61 6e-09
gi|6683126|dbj|BAA20797.2| KIAA0339 protein [Homo sapiens] 61 6e-09
gi|38111539|gb|EAA57106.1| hypothetical protein MG08075.4 [Magna... 61 6e-09
gi|34859323|ref|XP_219358.2| similar to KIAA0339 protein [Rattus... 61 6e-09
gi|16307411|gb|AAH10250.1| BC010250 protein [Mus musculus] 61 6e-09
gi|27500172|ref|XP_049380.2| KIAA0339 gene product [Homo sapiens] 61 6e-09
gi|49096944|ref|XP_409932.1| hypothetical protein AN5795.2 [Aspe... 61 6e-09
gi|50882048|ref|NP_910121.2| OSJNBa0042L16.7 [Oryza sativa (japo... 61 6e-09
gi|15488418|gb|AAL01110.1| ASH1-like protein 1 [Arabidopsis thal... 60 8e-09
gi|6321911|ref|NP_011987.1| Histone methyltransferase, subunit o... 60 8e-09
gi|30694058|ref|NP_199055.2| SET domain-containing protein (TXR7... 60 8e-09
gi|25406461|pir||E96795 unknown protein F28O16.8 [imported] - Ar... 60 8e-09
gi|22330671|ref|NP_177797.2| SET domain-containing protein (ASHH... 60 8e-09
gi|9759476|dbj|BAB10481.1| unnamed protein product [Arabidopsis ... 60 8e-09
gi|47123157|gb|AAH70805.1| MGC83876 protein [Xenopus laevis] 60 8e-09
gi|50293843|ref|XP_449333.1| unnamed protein product [Candida gl... 60 1e-08
gi|39591120|emb|CAE58900.1| Hypothetical protein CBG02150 [Caeno... 60 1e-08
gi|50546869|ref|XP_500904.1| hypothetical protein [Yarrowia lipo... 60 1e-08
gi|19075312|ref|NP_587812.1| set domain protein; transcriptional... 59 2e-08
gi|47219458|emb|CAG10822.1| unnamed protein product [Tetraodon n... 59 2e-08
gi|32412438|ref|XP_326699.1| hypothetical protein [Neurospora cr... 59 3e-08
gi|45185366|ref|NP_983083.1| ABR136Wp [Eremothecium gossypii] >g... 58 4e-08
gi|50312247|ref|XP_456155.1| unnamed protein product [Kluyveromy... 58 4e-08
gi|4507321|ref|NP_003164.1| suppressor of variegation 3-9 homolo... 58 4e-08
gi|34529091|dbj|BAC85636.1| unnamed protein product [Homo sapiens] 58 5e-08
gi|24641786|ref|NP_572888.2| CG1716-PA [Drosophila melanogaster]... 57 7e-08
gi|49130287|ref|XP_412962.1| hypothetical protein AN8825.2 [Aspe... 57 7e-08
gi|15150415|gb|AAK84931.1| SD01656p [Drosophila melanogaster] 57 7e-08
gi|50302715|ref|XP_451294.1| unnamed protein product [Kluyveromy... 57 7e-08
gi|34933418|ref|XP_217594.2| similar to position-effect variegat... 57 9e-08
gi|7339838|gb|AAF60970.1| position-effect variegation 3-9 homolo... 57 9e-08
gi|47225089|emb|CAF97504.1| unnamed protein product [Tetraodon n... 57 9e-08
gi|6755702|ref|NP_035644.1| suppressor of variegation 3-9 homolo... 57 9e-08
gi|3309543|gb|AAC41377.1| MLL [Takifugu rubripes] 57 9e-08
gi|50369694|gb|AAH76417.1| Unknown (protein for MGC:101027) [Dan... 57 1e-07
gi|28277052|gb|AAH44818.1| Mll protein [Mus musculus] 57 1e-07
gi|34305635|gb|AAQ63624.1| myeloid/lymphoid or mixed-lineage leu... 57 1e-07
gi|1490271|emb|CAA93625.1| ALL-1 protein [Homo sapiens] 57 1e-07
gi|48095179|ref|XP_392252.1| similar to ENSANGP00000002662 [Apis... 57 1e-07
gi|1708302|sp|P55200|HRX_MOUSE Zinc finger protein HRX (ALL-1) >... 57 1e-07
gi|38089806|ref|XP_110671.2| myeloid/lymphoid or mixed-lineage l... 57 1e-07
gi|627837|pir||A48205 All-1 protein +GTE form - mouse (fragment) 57 1e-07
gi|5174569|ref|NP_005924.1| myeloid/lymphoid or mixed-lineage le... 56 1e-07
gi|1170364|sp|Q03164|HRX_HUMAN Zinc finger protein HRX (ALL-1) (... 56 1e-07
gi|345890|pir||A44265 trithorax homolog HTX, version 2 - human 56 1e-07
gi|50760091|ref|XP_417896.1| PREDICTED: similar to ALL-1 protein... 56 2e-07
gi|4127850|emb|CAA09454.1| MLL protein [Gallus gallus] 56 2e-07
gi|39584174|emb|CAE61549.1| Hypothetical protein CBG05455 [Caeno... 55 3e-07
gi|31206447|ref|XP_312179.1| ENSANGP00000002662 [Anopheles gambi... 55 3e-07
gi|10720313|sp|Q24742|TRX_DROVI Trithorax protein >gnl|BL_ORD_ID... 55 3e-07
gi|50725771|dbj|BAD33302.1| SET domain-containing protein-like [... 55 3e-07
gi|34877323|ref|XP_344634.1| similar to Histone-lysine N-methylt... 55 3e-07
gi|47225575|emb|CAG12058.1| unnamed protein product [Tetraodon n... 55 4e-07
gi|47848462|dbj|BAD22318.1| trithorax-like [Oryza sativa (japoni... 55 4e-07
gi|46227222|gb|EAK88172.1| protein with 4 PHD domains plus a SET... 55 4e-07
gi|19115892|ref|NP_594980.1| hypothetical protein [Schizosacchar... 54 6e-07
gi|26353408|dbj|BAC40334.1| unnamed protein product [Mus musculus] 54 6e-07
gi|32417288|ref|XP_329122.1| hypothetical protein [Neurospora cr... 54 6e-07
gi|18417683|ref|NP_567859.1| SET domain-containing protein [Arab... 54 7e-07
gi|25407690|pir||C85361 hypothetical protein AT4g30860 [imported... 54 7e-07
gi|469801|emb|CAA83515.1| predicted trithorax protein [Drosophil... 54 1e-06
gi|17136558|ref|NP_476770.1| CG8651-PB [Drosophila melanogaster]... 54 1e-06
gi|7662046|ref|NP_055542.1| myeloid/lymphoid or mixed-lineage le... 54 1e-06
gi|5923931|gb|AAD56420.1| MLL2 protein [Homo sapiens] 54 1e-06
gi|13375930|ref|NP_078946.1| suppressor of variegation 3-9 homol... 54 1e-06
gi|38086227|ref|XP_194342.3| RIKEN cDNA 2610014H22 [Mus musculus] 54 1e-06
gi|40225368|gb|AAH09337.2| MLL4 protein [Homo sapiens] 54 1e-06
gi|45190479|ref|NP_984733.1| AEL128Cp [Eremothecium gossypii] >g... 54 1e-06
gi|12847486|dbj|BAB27589.1| unnamed protein product [Mus musculus] 54 1e-06
gi|26006129|dbj|BAC41407.1| mKIAA0304 protein [Mus musculus] 54 1e-06
gi|158818|gb|AAA29025.1| zinc-binding protein 54 1e-06
gi|85160|pir||A35085 trithorax protein - fruit fly (Drosophila m... 54 1e-06
gi|17136556|ref|NP_476769.1| CG8651-PD [Drosophila melanogaster]... 54 1e-06
gi|12644002|sp|P20659|TRX_DROME Trithorax protein >gnl|BL_ORD_ID... 54 1e-06
gi|33990004|gb|AAH56344.1| Unknown (protein for IMAGE:5704432) [... 54 1e-06
gi|21740272|emb|CAD39146.1| hypothetical protein [Homo sapiens] 54 1e-06
gi|20810421|gb|AAH29360.1| SUV39H2 protein [Homo sapiens] 54 1e-06
gi|27754617|gb|AAO22754.1| putative trithorax protein 1 [Arabido... 54 1e-06
gi|38565948|gb|AAH62210.1| Unknown (protein for IMAGE:5373081) [... 54 1e-06
gi|25091325|sp|Q9H5I1|SU92_HUMAN Histone-lysine N-methyltransfer... 54 1e-06
gi|15292119|gb|AAK93328.1| LD39445p [Drosophila melanogaster] 54 1e-06
gi|33873638|gb|AAH07353.2| MLL4 protein [Homo sapiens] 54 1e-06
gi|34855701|ref|XP_341830.1| similar to Trithorax homolog 2 (Mix... 54 1e-06
gi|30685011|ref|NP_850170.1| trithorax 1 (ATX-1) (TRX1) [Arabido... 54 1e-06
gi|6634011|dbj|BAA20763.2| KIAA0304 protein [Homo sapiens] 54 1e-06
gi|12659210|gb|AAK01237.1| trithorax-like protein 1 [Arabidopsis... 54 1e-06
gi|25408172|pir||B84723 probable SET-domain transcription regula... 54 1e-06
gi|39594154|emb|CAE70264.1| Hypothetical protein CBG16769 [Caeno... 53 1e-06
gi|25406869|pir||A86193 hypothetical protein [imported] - Arabid... 53 1e-06
gi|42567196|ref|NP_194520.3| PHD finger protein-related / SET do... 53 1e-06
gi|7511811|pir||S71490 ash1 protein - fruit fly (Drosophila mela... 53 1e-06
gi|49072006|ref|XP_400292.1| hypothetical protein UM02677.1 [Ust... 53 1e-06
gi|48103975|ref|XP_395687.1| similar to NSD1 [Apis mellifera] 53 1e-06
gi|17737643|ref|NP_524160.1| CG8887-PA [Drosophila melanogaster]... 53 1e-06
gi|1335892|gb|AAB01100.1| ASH1 53 1e-06
gi|42561734|ref|NP_172074.3| trithorax protein, putative / PHD f... 53 1e-06
gi|21432097|gb|AAH32960.1| Suv39h2 protein [Mus musculus] 53 2e-06
gi|50424361|ref|XP_460767.1| unnamed protein product [Debaryomyc... 53 2e-06
gi|31201009|ref|XP_309452.1| ENSANGP00000011220 [Anopheles gambi... 53 2e-06
gi|50797875|ref|XP_423976.1| PREDICTED: similar to Histone-lysin... 53 2e-06
gi|38110264|gb|EAA56010.1| hypothetical protein MG01661.4 [Magna... 53 2e-06
gi|12854173|dbj|BAB29948.1| unnamed protein product [Mus musculus] 53 2e-06
gi|16118405|gb|AAL12215.1| trithorax 4 [Arabidopsis thaliana] 53 2e-06
gi|25091323|sp|Q9EQQ0|SU92_MOUSE Histone-lysine N-methyltransfer... 53 2e-06
gi|31543790|ref|NP_073561.2| suppressor of variegation 3-9 homol... 53 2e-06
gi|24021802|gb|AAN41254.1| SET domain protein 110 [Zea mays] 52 2e-06
gi|46122361|ref|XP_385734.1| hypothetical protein FG05558.1 [Gib... 52 2e-06
gi|32394672|gb|AAN39003.1| SET1 protein [Griffithsia japonica] 52 2e-06
gi|23619170|ref|NP_705132.1| hypothetical protein [Plasmodium fa... 52 3e-06
gi|34904046|ref|NP_913370.1| P0489G09.11 [Oryza sativa (japonica... 52 3e-06
gi|24647050|ref|NP_524357.2| CG6476-PA [Drosophila melanogaster]... 52 3e-06
gi|1079141|pir||S47004 Su(var)3-9 protein - fruit fly (Drosophil... 52 3e-06
gi|38503415|sp|P45975|SUV9_DROME Histone-lysine N-methyltransfer... 52 3e-06
gi|9367746|emb|CAB97489.1| putative heterochromatin protein [Dro... 52 4e-06
gi|6322293|ref|NP_012367.1| Histone methyltransferase with a rol... 52 4e-06
gi|32403484|ref|XP_322355.1| hypothetical protein [Neurospora cr... 51 5e-06
gi|30696333|ref|NP_200155.2| PHD finger family protein / SET dom... 51 5e-06
gi|8843772|dbj|BAA97320.1| unnamed protein product [Arabidopsis ... 51 5e-06
gi|33305503|gb|AAQ02781.1| Mll protein [Xenopus laevis] 51 6e-06
gi|21392158|gb|AAM48433.1| RE61305p [Drosophila melanogaster] 50 8e-06
gi|48104732|ref|XP_395838.1| similar to HSPC069 [Apis mellifera] 50 8e-06
gi|39590586|emb|CAE64956.1| Hypothetical protein CBG09790 [Caeno... 50 8e-06
gi|47225482|emb|CAG11965.1| unnamed protein product [Tetraodon n... 50 8e-06
gi|24650756|ref|NP_733239.1| CG4976-PA [Drosophila melanogaster]... 50 8e-06
gi|17861882|gb|AAL39418.1| GM10003p [Drosophila melanogaster] 50 1e-05
gi|24639197|ref|NP_525040.2| CG3848-PC [Drosophila melanogaster]... 50 1e-05
gi|28571451|ref|NP_726773.2| CG3848-PD [Drosophila melanogaster]... 50 1e-05
gi|7511805|pir||T12687 ALR protein homolog - fruit fly (Drosophi... 50 1e-05
gi|21064853|gb|AAM29656.1| SD13650p [Drosophila melanogaster] 50 1e-05
gi|23612374|ref|NP_703954.1| SET-domain protein, putative [Plasm... 49 2e-05
gi|46361248|emb|CAG25109.1| SET-domain protein, putative; putati... 49 2e-05
gi|7512280|pir||T03455 ALR protein - human >gnl|BL_ORD_ID|127332... 49 2e-05
gi|34868150|ref|XP_343327.1| similar to myeloid/lymphoid or mixe... 49 2e-05
gi|3540281|gb|AAC34383.1| All-1 related protein [Takifugu rubripes] 49 2e-05
gi|47228685|emb|CAG07417.1| unnamed protein product [Tetraodon n... 49 2e-05
gi|4505197|ref|NP_003473.1| myeloid/lymphoid or mixed-lineage le... 49 2e-05
gi|37590100|gb|AAH58659.1| Mll2 protein [Mus musculus] 49 2e-05
gi|34782989|gb|AAH39197.1| Similar to ALR protein [Homo sapiens] 49 2e-05
gi|46108034|ref|XP_381075.1| hypothetical protein FG00899.1 [Gib... 49 2e-05
gi|31242315|ref|XP_321588.1| ENSANGP00000009609 [Anopheles gambi... 49 3e-05
gi|7486998|pir||T00458 hypothetical protein T14N5.15 - Arabidops... 49 3e-05
gi|22330695|ref|NP_177854.2| SET domain-containing protein [Arab... 49 3e-05
gi|6841376|gb|AAF29041.1| HSPC069 [Homo sapiens] 48 4e-05
gi|46126135|ref|XP_387621.1| hypothetical protein FG07445.1 [Gib... 48 4e-05
gi|30410777|ref|NP_036403.1| huntingtin interacting protein B is... 48 5e-05
gi|20521978|dbj|BAB21823.2| KIAA1732 protein [Homo sapiens] 48 5e-05
gi|50732237|ref|XP_418542.1| PREDICTED: similar to Myeloid/lymph... 48 5e-05
gi|38090181|ref|XP_135176.3| similar to huntingtin interacting p... 48 5e-05
gi|12697196|emb|CAC28349.1| huntingtin interacting protein 1 [Ho... 48 5e-05
gi|30410779|ref|NP_054878.3| huntingtin interacting protein B is... 48 5e-05
gi|34866378|ref|XP_236648.2| similar to huntingtin interacting p... 48 5e-05
gi|9409730|emb|CAB98195.1| heterochromatin protein [Clytus arietis] 47 7e-05
gi|18406465|ref|NP_566010.1| SET domain-containing protein (ASHH... 47 7e-05
gi|9409731|emb|CAB98196.1| heterochromatin protein [Clytus arietis] 47 7e-05
gi|48098321|ref|XP_394039.1| similar to ENSANGP00000009609 [Apis... 47 7e-05
gi|46435920|gb|EAK95292.1| hypothetical protein CaO19.9324 [Cand... 47 7e-05
gi|50257086|gb|EAL19801.1| hypothetical protein CNBG0940 [Crypto... 47 7e-05
gi|7486484|pir||T00695 hypothetical protein At2g44150 [imported]... 47 7e-05
gi|8648963|emb|CAB94835.1| heterochromatin protein [Leptinotarsa... 47 9e-05
gi|50553372|ref|XP_504097.1| hypothetical protein [Yarrowia lipo... 47 9e-05
gi|38079560|ref|XP_355579.1| similar to myeloid/lymphoid or mixe... 47 1e-04
gi|10864041|ref|NP_067053.1| myeloid/lymphoid or mixed-lineage l... 47 1e-04
gi|5630077|gb|AAD45822.1| similar to ALR; similar to AAC51735 (P... 47 1e-04
gi|34364838|emb|CAE45854.1| hypothetical protein [Homo sapiens] 47 1e-04
gi|49071652|ref|XP_400115.1| hypothetical protein UM02500.1 [Ust... 47 1e-04
gi|14626492|gb|AAK70214.1| MLL3-like protein [Mus musculus] 47 1e-04
gi|37999865|sp|Q8BRH4|MLL3_MOUSE Myeloid/lymphoid or mixed-linea... 47 1e-04
gi|47228511|emb|CAG05331.1| unnamed protein product [Tetraodon n... 47 1e-04
gi|21739477|emb|CAD38780.1| hypothetical protein [Homo sapiens] 47 1e-04
gi|37360418|dbj|BAC98187.1| mKIAA1506 protein [Mus musculus] 47 1e-04
gi|24586653|ref|NP_733751.1| myeloid/lymphoid or mixed-lineage l... 47 1e-04
gi|37999866|sp|Q8NEZ4|MLL3_HUMAN Myeloid/lymphoid or mixed-linea... 47 1e-04
gi|46228588|gb|EAK89458.1| multidomain chromatinic protein with ... 46 2e-04
gi|50732165|ref|XP_418510.1| PREDICTED: similar to huntingtin in... 46 2e-04
gi|48137938|ref|XP_396833.1| similar to RIKEN cDNA 9230102N17 [A... 46 2e-04
gi|50258529|gb|EAL21216.1| hypothetical protein CNBD2720 [Crypto... 46 2e-04
gi|42407424|dbj|BAD10031.1| SET domain protein-like [Oryza sativ... 46 2e-04
gi|47226564|emb|CAG08580.1| unnamed protein product [Tetraodon n... 45 3e-04
gi|38101547|gb|EAA48494.1| hypothetical protein MG00152.4 [Magna... 45 3e-04
gi|23489726|gb|EAA21665.1| similar to KIAA0304 gene product-rela... 45 3e-04
gi|15232214|ref|NP_191555.1| SET domain-containing protein [Arab... 45 3e-04
gi|49067450|ref|XP_398015.1| hypothetical protein UM00400.1 [Ust... 45 3e-04
gi|39594156|emb|CAE70266.1| Hypothetical protein CBG16771 [Caeno... 45 4e-04
gi|26346432|dbj|BAC36867.1| unnamed protein product [Mus musculus] 44 6e-04
gi|47228227|emb|CAG07622.1| unnamed protein product [Tetraodon n... 44 6e-04
gi|13699811|ref|NP_075447.1| WHSC1L1 protein isoform long; Wolf-... 44 8e-04
gi|12697312|emb|CAC28350.1| putative chromatin modulator [Homo s... 44 8e-04
gi|12697314|emb|CAC28351.1| Putative Chromatin modulator [Homo s... 44 8e-04
gi|38089147|ref|XP_284391.2| similar to WHSC1L1 protein isoform ... 44 8e-04
gi|47216786|emb|CAG03790.1| unnamed protein product [Tetraodon n... 44 0.001
gi|42566815|ref|NP_193253.3| SET domain-containing protein [Arab... 43 0.001
gi|27477095|ref|NP_758859.1| nuclear receptor binding SET domain... 43 0.001
gi|7485168|pir||G71415 hypothetical protein - Arabidopsis thalia... 43 0.001
gi|10438794|dbj|BAB15346.1| unnamed protein product [Homo sapiens] 43 0.001
gi|16549858|dbj|BAB70868.1| unnamed protein product [Homo sapiens] 43 0.001
gi|6679138|ref|NP_032765.1| nuclear receptor-binding SET-domain ... 43 0.001
gi|47209269|emb|CAF93025.1| unnamed protein product [Tetraodon n... 43 0.001
gi|19923586|ref|NP_071900.2| nuclear receptor binding SET domain... 43 0.001
gi|15213542|gb|AAK92049.1| NSD1 [Homo sapiens] 43 0.001
gi|34873661|ref|XP_225168.2| similar to NSD1 protein [Rattus nor... 43 0.001
gi|34850028|gb|AAB52674.2| Hypothetical protein K09F5.5 [Caenorh... 43 0.002
gi|10434227|dbj|BAB14179.1| unnamed protein product [Homo sapiens] 43 0.002
gi|31218998|ref|XP_316738.1| ENSANGP00000016119 [Anopheles gambi... 43 0.002
gi|17568847|ref|NP_509306.1| SET-domain transcriptional regulato... 43 0.002
gi|6691805|emb|CAB65850.1| EG:BACR37P7.2 [Drosophila melanogaster] 43 0.002
gi|42572235|ref|NP_974212.1| SET domain-containing protein [Arab... 43 0.002
gi|18543183|ref|NP_569834.1| CG2995-PA [Drosophila melanogaster]... 43 0.002
gi|47221386|emb|CAF97304.1| unnamed protein product [Tetraodon n... 43 0.002
gi|9409737|emb|CAB98199.1| putative heterochromatin protein [Sco... 42 0.002
gi|28204960|gb|AAH46473.1| Whsc1 protein [Mus musculus] 42 0.002
gi|9409736|emb|CAB98198.1| SU(VAR)3-9; putative heterochromatin ... 42 0.002
gi|37360238|dbj|BAC98097.1| mKIAA1090 protein [Mus musculus] 42 0.002
gi|26347387|dbj|BAC37342.1| unnamed protein product [Mus musculus] 42 0.002
gi|40789042|dbj|BAA83042.2| KIAA1090 protein [Homo sapiens] 42 0.002
gi|19913361|ref|NP_579891.1| Wolf-Hirschhorn syndrome candidate ... 42 0.002
gi|19913348|ref|NP_579877.1| Wolf-Hirschhorn syndrome candidate ... 42 0.002
gi|34878518|ref|XP_223540.2| similar to Wolf-Hirschhorn syndrome... 42 0.002
gi|50747328|ref|XP_420839.1| PREDICTED: similar to Wolf-Hirschho... 42 0.002
gi|39594155|emb|CAE70265.1| Hypothetical protein CBG16770 [Caeno... 42 0.002
gi|31418293|gb|AAH53454.1| Whsc1 protein [Mus musculus] 42 0.002
gi|47227348|emb|CAF96897.1| unnamed protein product [Tetraodon n... 42 0.003
gi|17548075|ref|NP_521477.1| CONSERVED HYPOTHETICAL PROTEIN [Ral... 42 0.003
gi|15224059|ref|NP_179955.1| SET domain-containing protein [Arab... 42 0.003
gi|50806248|ref|XP_424390.1| PREDICTED: similar to putative chro... 42 0.004
gi|32414605|ref|XP_327782.1| hypothetical protein [Neurospora cr... 42 0.004
gi|47222897|emb|CAF99053.1| unnamed protein product [Tetraodon n... 42 0.004
gi|46320863|ref|ZP_00221246.1| COG2940: Proteins containing SET ... 41 0.005
gi|25395254|pir||B87754 protein C43E11.3 [imported] - Caenorhabd... 41 0.006
gi|32564092|ref|NP_871842.1| nuclear protein SET (1E831) [Caenor... 41 0.006
gi|39592978|emb|CAE62592.1| Hypothetical protein CBG06706 [Caeno... 41 0.006
gi|39589581|emb|CAE66816.1| Hypothetical protein CBG12181 [Caeno... 41 0.006
gi|25141373|ref|NP_491340.2| nuclear protein SET and WW/Rsp5/WWP... 41 0.006
gi|17555046|ref|NP_499819.1| myeloid lymphoid mixed-lineage like... 40 0.008
gi|10438579|dbj|BAB15281.1| unnamed protein product [Homo sapiens] 40 0.008
gi|46805056|dbj|BAD17037.1| SET domain-containing protein-like [... 40 0.011
gi|22121718|gb|AAM89288.1| SET domain-containing protein SET104 ... 40 0.011
gi|18410265|ref|NP_565056.1| SET domain-containing protein (SUVH... 40 0.014
gi|13517747|gb|AAK28968.1| SUVH3 [Arabidopsis thaliana] 40 0.014
gi|38345952|emb|CAE04343.2| OSJNBb0038F03.7 [Oryza sativa (japon... 40 0.014
gi|39587946|emb|CAE67965.1| Hypothetical protein CBG13569 [Caeno... 40 0.014
gi|24987818|pdb|1MVH|A Chain A, Structure Of The Set Domain Hist... 39 0.019
gi|19111978|ref|NP_595186.1| mating-type locus and centromeric s... 39 0.019
gi|49094880|ref|XP_408901.1| hypothetical protein AN4764.2 [Aspe... 39 0.019
gi|50730881|ref|XP_417061.1| PREDICTED: similar to SETDB2 protei... 39 0.019
gi|47219426|emb|CAG10790.1| unnamed protein product [Tetraodon n... 39 0.025
gi|47204574|emb|CAG00069.1| unnamed protein product [Tetraodon n... 39 0.025
gi|48140878|ref|XP_397164.1| similar to SET domain and mariner t... 39 0.025
gi|40217808|ref|NP_079033.3| euchromatic histone methyltransfera... 39 0.025
gi|25090571|sp|Q9H9B1|HMT1_HUMAN Histone-lysine N-methyltransfer... 39 0.025
gi|48771477|ref|ZP_00275819.1| COG2940: Proteins containing SET ... 39 0.025
gi|29246643|gb|EAA38232.1| GLP_72_12521_13417 [Giardia lamblia A... 39 0.025
gi|19584519|emb|CAD28534.1| hypothetical protein [Homo sapiens] 39 0.025
gi|14211561|dbj|BAB56104.1| GLP1 [Homo sapiens] 39 0.025
gi|38014011|gb|AAH11608.2| Eu-HMTase1 protein [Homo sapiens] 39 0.025
gi|33317792|gb|AAQ04808.1| Unknown [Homo sapiens] 39 0.025
gi|42563469|ref|NP_187025.2| SET domain-containing protein [Arab... 39 0.032
gi|50757470|ref|XP_415526.1| PREDICTED: similar to Histone-lysin... 39 0.032
gi|48716726|dbj|BAD23407.1| putative SET domain-containing prote... 39 0.032
gi|28261315|gb|AAO32935.1| SET domain protein SDG117 [Zea mays] 39 0.032
gi|49086538|ref|XP_405307.1| hypothetical protein AN1170.2 [Aspe... 38 0.042
gi|50255084|gb|EAL17823.1| hypothetical protein CNBL0850 [Crypto... 38 0.042
gi|21232195|ref|NP_638112.1| conserved hypothetical protein [Xan... 38 0.042
gi|11359019|pir||T43745 clr4 protein - fission yeast (Schizosacc... 38 0.055
gi|37572974|dbj|BAC98666.1| putative histone-lysine N-methyltran... 38 0.055
gi|37606199|emb|CAE49087.1| SI:bZ1O1.6 (novel protein similar to... 37 0.072
gi|46226705|gb|EAK87684.1| protein with a SET domain within carb... 37 0.072
gi|46312602|ref|ZP_00213197.1| COG2940: Proteins containing SET ... 37 0.072
gi|39591764|emb|CAE71342.1| Hypothetical protein CBG18244 [Caeno... 37 0.072
gi|37360586|dbj|BAC98271.1| mKIAA1876 protein [Mus musculus] 37 0.094
gi|39582734|emb|CAE65940.1| Hypothetical protein CBG11116 [Caeno... 37 0.094
gi|25412134|pir||C84616 similar to mammalian MHC III region prot... 37 0.094
gi|41053172|dbj|BAD08114.1| putative SET domain protein SDG117 [... 37 0.094
gi|30681803|ref|NP_850030.1| SET domain-containing protein (SUVH... 37 0.094
gi|17529178|gb|AAL38815.1| putative mammalian MHC III region pro... 37 0.094
gi|34852976|ref|XP_342380.1| similar to RIKEN cDNA 9230102N17 [R... 37 0.094
gi|34784556|gb|AAH56938.1| Ehmt1 protein [Mus musculus] 37 0.094
gi|31224801|ref|XP_317488.1| ENSANGP00000011816 [Anopheles gambi... 37 0.094
gi|27369762|ref|NP_766133.1| euchromatic histone methyltransfera... 37 0.094
gi|21243660|ref|NP_643242.1| conserved hypothetical protein [Xan... 37 0.094
gi|40789075|dbj|BAA06689.2| KIAA0067 [Homo sapiens] 37 0.12
gi|9256535|ref|NP_061365.1| SET domain, bifurcated 1 [Mus muscul... 37 0.12
gi|39104481|dbj|BAC65480.3| mKIAA0067 protein [Mus musculus] 37 0.12
gi|26353618|dbj|BAC40439.1| unnamed protein product [Mus musculus] 37 0.12
gi|13938122|gb|AAH07176.1| Setdb1 protein [Mus musculus] 37 0.12
gi|50754660|ref|XP_425171.1| PREDICTED: similar to SETMAR protei... 37 0.12
gi|40732537|gb|AAO73535.2| SET domain ERG-associated histone met... 37 0.12
gi|39581018|emb|CAE72499.1| Hypothetical protein CBG19678 [Caeno... 37 0.12
gi|34858051|ref|XP_227444.2| similar to ERG-associated protein E... 37 0.12
gi|25091210|sp|Q15047|SETB_HUMAN Histone-lysine N-methyltransfer... 37 0.12
gi|22219432|ref|NP_671493.1| HLA-B associated transcript 8 isofo... 36 0.16
gi|26346681|dbj|BAC36989.1| unnamed protein product [Mus musculus] 36 0.16
gi|47221608|emb|CAF97873.1| unnamed protein product [Tetraodon n... 36 0.16
gi|18426879|ref|NP_079532.4| HLA-B associated transcript 8 BAT8 ... 36 0.16
gi|18375637|ref|NP_006700.2| HLA-B associated transcript 8 BAT8 ... 36 0.16
gi|15917538|emb|CAC86666.1| NG36/G9a [Homo sapiens] 36 0.16
gi|4529889|gb|AAD21812.1| G9A [Homo sapiens] >gnl|BL_ORD_ID|6865... 36 0.16
gi|478844|pir||S30385 G9a protein - human >gnl|BL_ORD_ID|622893 ... 36 0.16
gi|22164772|ref|NP_665829.1| HLA-B associated transcript 8 isofo... 36 0.16
gi|47059112|ref|NP_997628.1| HLA-B associated transcript 8, rat ... 36 0.16
gi|48257231|gb|AAH20970.2| BAT8 protein [Homo sapiens] 36 0.16
gi|3986768|gb|AAC84164.1| G9A [Mus musculus] 36 0.16
gi|47940008|gb|AAH72374.1| MGC84516 protein [Xenopus laevis] 36 0.16
gi|37231570|gb|AAH58357.1| Bat8 protein [Mus musculus] 36 0.16
gi|48257161|gb|AAH02686.2| BAT8 protein [Homo sapiens] 36 0.16
gi|46255679|gb|AAH09351.1| BAT8 protein [Homo sapiens] 36 0.16
gi|19343794|gb|AAH25539.1| Bat8 protein [Mus musculus] 36 0.16
gi|50255483|gb|EAL18218.1| hypothetical protein CNBK2360 [Crypto... 36 0.21
gi|19387242|gb|AAL87154.1| putative SET-domain transcriptional r... 36 0.21
gi|13812237|ref|NP_113368.1| hypothetical protein [Guillardia th... 35 0.27
gi|47213886|emb|CAF93568.1| unnamed protein product [Tetraodon n... 35 0.27
gi|38076330|ref|XP_139089.3| similar to SETDB2 protein [Mus musc... 35 0.27
gi|47571537|ref|ZP_00241588.1| COG2940: Proteins containing SET ... 35 0.27
gi|34909174|ref|NP_915934.1| similar to SET1 [Oryza sativa (japo... 35 0.36
gi|29251473|gb|EAA42954.1| GLP_170_70561_71703 [Giardia lamblia ... 35 0.36
gi|16877671|gb|AAH17078.1| SETDB2 protein [Homo sapiens] 35 0.36
gi|22995768|ref|ZP_00040102.1| COG2940: Proteins containing SET ... 35 0.36
gi|39579769|emb|CAE56664.1| Hypothetical protein CBG24432 [Caeno... 35 0.36
gi|28703998|gb|AAH47434.1| SETDB2 protein [Homo sapiens] 35 0.36
gi|13994282|ref|NP_114121.1| CLLL8 protein; chromosome 13 open r... 35 0.36
gi|15838079|ref|NP_298767.1| hypothetical protein XF1478 [Xylell... 35 0.36
gi|17554480|ref|NP_498848.1| Methyl-CpG binding and nuclear prot... 35 0.46
gi|630594|pir||S44861 DNA topoisomerase II - Caenorhabditis elegans 35 0.46
gi|15485584|emb|CAC67503.1| SET-domain-containing protein [Nicot... 35 0.46
gi|15240758|ref|NP_196900.1| SET domain-containing protein (SUVH... 34 0.61
gi|27502110|gb|AAO17392.1| SET domain histone methyltransferase ... 34 0.61
gi|34874242|ref|XP_224248.2| similar to CLLL8 protein; chromosom... 34 0.61
gi|39582733|emb|CAE65939.1| Hypothetical protein CBG11115 [Caeno... 34 0.61
gi|23485928|gb|EAA20652.1| SET domain, putative [Plasmodium yoel... 34 0.79
gi|15226918|ref|NP_181061.1| SET domain-containing protein (SUVH... 34 0.79
gi|39591696|emb|CAE71274.1| Hypothetical protein CBG18157 [Caeno... 33 1.0
gi|25148423|ref|NP_741320.1| SET domain mariner transposase fusi... 33 1.0
gi|39578795|emb|CAE57121.1| Hypothetical protein CBG25032 [Caeno... 33 1.0
gi|39588129|emb|CAE68053.1| Hypothetical protein CBG13673 [Caeno... 33 1.0
gi|39584650|emb|CAE72403.1| Hypothetical protein CBG19562 [Caeno... 33 1.0
gi|34391525|gb|AAN61106.1| putative histone methylatransferase C... 33 1.0
gi|38103338|gb|EAA50044.1| hypothetical protein MG03803.4 [Magna... 33 1.0
gi|25148426|ref|NP_741321.1| SET domain mariner transposase fusi... 33 1.0
gi|13517749|gb|AAK28969.1| SUVH4 [Arabidopsis thaliana] 33 1.4
gi|50080305|gb|AAT69639.1| 'unknown protein, conatins SET domain... 33 1.4
gi|39598092|emb|CAE68784.1| Hypothetical protein CBG14728 [Caeno... 33 1.4
gi|48927670|gb|AAT47547.1| SET domain protein [Triticum aestivum] 33 1.4
gi|13517761|gb|AAK28975.1| SET1 [Oryza sativa] 33 1.4
gi|30409984|ref|NP_848478.1| SET domain and mariner transposase ... 33 1.8
gi|18394531|ref|NP_564036.1| SET domain-containing protein (SUVH... 33 1.8
gi|25518693|pir||G86312 hypothetical protein F2H15.1 - Arabidops... 33 1.8
gi|39581280|emb|CAE60026.1| Hypothetical protein CBG03532 [Caeno... 33 1.8
gi|7509513|pir||T26577 hypothetical protein Y2H9A.1 - Caenorhabd... 33 1.8
gi|17565204|ref|NP_506333.1| SET domain protein, Maternal Effect... 33 1.8
gi|27380898|ref|NP_772427.1| bll5787 [Bradyrhizobium japonicum U... 33 1.8
gi|39596282|emb|CAE69920.1| Hypothetical protein CBG16281 [Caeno... 32 2.3
gi|32452970|gb|AAP82636.1| Set (trithorax/polycomb) domain conta... 32 2.3
gi|25412245|pir||C84640 similar to mammalian MHC III region prot... 32 2.3
gi|17554790|ref|NP_498417.1| SET (trithorax/polycomb) domain con... 32 2.3
gi|48927668|gb|AAT47546.1| SET domain protein [Triticum aestivum] 32 2.3
gi|48854494|ref|ZP_00308656.1| COG2940: Proteins containing SET ... 32 2.3
gi|32417370|ref|XP_329163.1| hypothetical protein [Neurospora cr... 32 2.3
gi|30682537|ref|NP_180049.2| SET domain-containing protein (SUVH... 32 2.3
gi|3005702|gb|AAC09350.1| unknown [Homo sapiens] 32 3.0
gi|5730039|ref|NP_006506.1| SET domain and mariner transposase f... 32 3.0
gi|15225005|ref|NP_178647.1| SET domain-containing protein / YDG... 32 3.0
gi|15079636|gb|AAH11635.1| SETMAR protein [Homo sapiens] 32 3.0
gi|39936932|ref|NP_949208.1| Nuclear protein SET [Rhodopseudomon... 32 3.9
gi|23510027|ref|NP_702693.1| hypothetical protein [Plasmodium fa... 32 3.9
gi|24021800|gb|AAN41253.1| SET domain protein 113 [Zea mays] 32 3.9
gi|38078182|ref|XP_354930.1| similar to myeloid/lymphoid or mixe... 31 5.1
gi|28261313|gb|AAO32934.1| SET domain protein SDG111 [Zea mays] 31 5.1
gi|50261666|gb|AAT72417.1| CPB-3 [Caenorhabditis japonica] >gnl|... 31 5.1
gi|20977606|gb|AAM28230.1| SET domain protein 105 [Zea mays] 31 5.1
gi|38109303|gb|EAA55195.1| hypothetical protein MG06852.4 [Magna... 31 5.1
gi|15834735|ref|NP_296494.1| conserved hypothetical protein [Chl... 31 5.1
gi|29245501|gb|EAA37136.1| GLP_139_12114_8350 [Giardia lamblia A... 31 5.1
gi|50547403|ref|XP_501171.1| hypothetical protein [Yarrowia lipo... 31 6.7
gi|34907056|ref|NP_914875.1| putative SUVH4 [Oryza sativa (japon... 31 6.7
gi|39586267|emb|CAE66678.1| Hypothetical protein CBG12017 [Caeno... 31 6.7
gi|24575117|gb|AAL06688.1| unknown [Streptomyces globisporus] 31 6.7
gi|11357461|pir||T47966 hypothetical protein F15G16.130 - Arabid... 31 6.7
gi|33600645|ref|NP_888205.1| mismatch repair protein [Bordetella... 30 8.8
gi|23490719|gb|EAA22429.1| Papain family cysteine protease, puta... 30 8.8
gi|44888187|sp|Q7WLT5|MUTS_BORBR DNA mismatch repair protein mutS 30 8.8
gi|20977024|gb|AAM33245.1| mitotic phosphoprotein 36 [Xenopus la... 30 8.8
gi|39579481|emb|CAE56880.1| Hypothetical protein CBG24719 [Caeno... 30 8.8
gi|31208551|ref|XP_313242.1| ENSANGP00000016276 [Anopheles gambi... 30 8.8
gi|44888185|sp|Q7W880|MUTS_BORPA DNA mismatch repair protein mutS 30 8.8
gi|33596868|ref|NP_884511.1| mismatch repair protein [Bordetella... 30 8.8
gi|33592656|ref|NP_880300.1| mismatch repair protein [Bordetella... 30 8.8
gi|22121716|gb|AAM89287.1| SET domain-containing protein SET118 ... 30 8.8
>gi|25154114|ref|NP_496992.2| drosophila Enhancer of
zeste/polycombeotic homolog essential for viability of
the germline, Maternal Effect Sterile MES-2 (88.7 kD)
(mes-2) [Caenorhabditis elegans]
gi|2286221|gb|AAC27124.1| maternal-effect sterile 2 [Caenorhabditis
elegans]
Length = 773
Score = 245 bits (626), Expect = 1e-64
Identities = 120/120 (100%), Positives = 120/120 (100%)
Frame = +3
Query: 3 RISDDEAERRGAIYDRYQCSYIFNIETGGAIDSYKIGNLARFANHDSKNPTCYARTMVVA 182
RISDDEAERRGAIYDRYQCSYIFNIETGGAIDSYKIGNLARFANHDSKNPTCYARTMVVA
Sbjct: 654 RISDDEAERRGAIYDRYQCSYIFNIETGGAIDSYKIGNLARFANHDSKNPTCYARTMVVA 713
Query: 183 GEHRIGFYAKRRLEISEELTFDYSYSGEHQIAFRMVQTKERSEKPSRPKSQKLSKPMTSE 362
GEHRIGFYAKRRLEISEELTFDYSYSGEHQIAFRMVQTKERSEKPSRPKSQKLSKPMTSE
Sbjct: 714 GEHRIGFYAKRRLEISEELTFDYSYSGEHQIAFRMVQTKERSEKPSRPKSQKLSKPMTSE 773
>gi|29427556|sp|O17514|MES2_CAEEL Polycomb protein mes-2
(Maternal-effect sterile 2 protein) (E(z) homolog)
gi|14530433|emb|CAB04199.2| Hypothetical protein R06A4.7
[Caenorhabditis elegans]
gi|14530536|emb|CAB05589.2| C. elegans MES-2 protein (corresponding
sequence R06A4.7) [Caenorhabditis elegans]
Length = 773
Score = 245 bits (626), Expect = 1e-64
Identities = 120/120 (100%), Positives = 120/120 (100%)
Frame = +3
Query: 3 RISDDEAERRGAIYDRYQCSYIFNIETGGAIDSYKIGNLARFANHDSKNPTCYARTMVVA 182
RISDDEAERRGAIYDRYQCSYIFNIETGGAIDSYKIGNLARFANHDSKNPTCYARTMVVA
Sbjct: 654 RISDDEAERRGAIYDRYQCSYIFNIETGGAIDSYKIGNLARFANHDSKNPTCYARTMVVA 713
Query: 183 GEHRIGFYAKRRLEISEELTFDYSYSGEHQIAFRMVQTKERSEKPSRPKSQKLSKPMTSE 362
GEHRIGFYAKRRLEISEELTFDYSYSGEHQIAFRMVQTKERSEKPSRPKSQKLSKPMTSE
Sbjct: 714 GEHRIGFYAKRRLEISEELTFDYSYSGEHQIAFRMVQTKERSEKPSRPKSQKLSKPMTSE 773
>gi|7506342|pir||T21436 hypothetical protein R06A4.7 - Caenorhabditis
elegans
Length = 775
Score = 245 bits (626), Expect = 1e-64
Identities = 120/120 (100%), Positives = 120/120 (100%)
Frame = +3
Query: 3 RISDDEAERRGAIYDRYQCSYIFNIETGGAIDSYKIGNLARFANHDSKNPTCYARTMVVA 182
RISDDEAERRGAIYDRYQCSYIFNIETGGAIDSYKIGNLARFANHDSKNPTCYARTMVVA
Sbjct: 656 RISDDEAERRGAIYDRYQCSYIFNIETGGAIDSYKIGNLARFANHDSKNPTCYARTMVVA 715
Query: 183 GEHRIGFYAKRRLEISEELTFDYSYSGEHQIAFRMVQTKERSEKPSRPKSQKLSKPMTSE 362
GEHRIGFYAKRRLEISEELTFDYSYSGEHQIAFRMVQTKERSEKPSRPKSQKLSKPMTSE
Sbjct: 716 GEHRIGFYAKRRLEISEELTFDYSYSGEHQIAFRMVQTKERSEKPSRPKSQKLSKPMTSE 775