Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F28C10_1
(1179 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17567363|ref|NP_508114.1| protein kinase (XB152) [Caenorhabdi... 821 0.0
gi|39592575|emb|CAE63652.1| Hypothetical protein CBG08151 [Caeno... 343 3e-93
gi|15231959|ref|NP_187484.1| serine/threonine protein kinase (PK... 196 9e-49
gi|47086403|ref|NP_997980.1| v-akt murine thymoma viral oncogene... 196 1e-48
gi|33304069|gb|AAQ02542.1| ribosomal protein S6 kinase, 90kDa, p... 195 2e-48
gi|4759050|ref|NP_004577.1| ribosomal protein S6 kinase, 90kDa, ... 195 2e-48
gi|33354095|dbj|BAC81131.1| RPS6KA3 [Homo sapiens] >gnl|BL_ORD_I... 195 2e-48
gi|22507357|ref|NP_683747.1| ribosomal protein S6 kinase polypep... 195 2e-48
gi|6537166|gb|AAF15553.1| Rsk-2 [Xenopus laevis] 195 2e-48
gi|401774|gb|AAC82495.1| ribosomal protein S6 kinase 3 [Homo sap... 195 2e-48
gi|45384254|ref|NP_990386.1| serine/threonine protein kinase [Ga... 194 4e-48
gi|50730201|ref|XP_416804.1| PREDICTED: similar to ribosomal pro... 193 6e-48
gi|47086473|ref|NP_997951.1| ribosomal protein S6 kinase polypep... 193 7e-48
gi|37700244|ref|NP_937789.1| v-akt murine thymoma viral oncogene... 192 1e-47
gi|2129541|pir||S68463 protein kinase ATPK19 (EC 2.7.1.-) - Arab... 191 2e-47
gi|12539654|gb|AAG59601.1| Akt [Xenopus laevis] 191 2e-47
gi|21537155|gb|AAM61496.1| putative ribosomal-protein S6 kinase ... 191 2e-47
gi|47939913|gb|AAH72041.1| MGC78893 protein [Xenopus laevis] 191 2e-47
gi|125692|sp|P18652|K6AA_CHICK Ribosomal protein S6 kinase II al... 191 3e-47
gi|15231960|ref|NP_187485.1| serine/threonine protein kinase (PK... 191 3e-47
gi|47223805|emb|CAF98575.1| unnamed protein product [Tetraodon n... 190 5e-47
gi|12860267|dbj|BAB31901.1| unnamed protein product [Mus musculus] 190 5e-47
gi|47230027|emb|CAG10441.1| unnamed protein product [Tetraodon n... 190 6e-47
gi|41056055|ref|NP_956367.1| Unknown (protein for MGC:66139); wu... 190 6e-47
gi|20149547|ref|NP_002944.2| ribosomal protein S6 kinase, 90kDa,... 189 8e-47
gi|50745818|ref|XP_420257.1| PREDICTED: similar to Ribosomal pro... 189 1e-46
gi|401772|gb|AAC82496.1| ribosomal protein S6 kinase 2 [Homo sap... 189 1e-46
gi|34853790|ref|XP_341759.1| ribosomal protein S6 kinase, 90kD, ... 189 1e-46
gi|28300431|gb|AAO37581.1| RPS6KA2 [Mus musculus] 189 1e-46
gi|47230282|emb|CAG10696.1| unnamed protein product [Tetraodon n... 189 1e-46
gi|19923570|ref|NP_066958.2| ribosomal protein S6 kinase, 90kDa,... 189 1e-46
gi|6166243|sp|Q15349|K6A2_HUMAN Ribosomal protein S6 kinase alph... 189 1e-46
gi|6755374|ref|NP_035429.1| ribosomal protein S6 kinase, polypep... 189 1e-46
gi|13605770|gb|AAK32877.1| 90-kDa ribosomal protein S6 kinase [R... 189 1e-46
gi|29294760|gb|AAH49076.1| Rps6ka1 protein [Mus musculus] 189 1e-46
gi|25005142|gb|AAN71007.1| ribosomal protein S6 kinase [Mus musc... 189 1e-46
gi|33303975|gb|AAQ02495.1| ribosomal protein S6 kinase, 90kDa, p... 189 1e-46
gi|47226221|emb|CAG08368.1| unnamed protein product [Tetraodon n... 188 2e-46
gi|2117824|pir||I51901 ribosomal protein S6 kinase 2 (EC 2.7.1.-... 188 2e-46
gi|13592065|ref|NP_112369.1| S6 protein kinase (Rsk-1) [Rattus n... 188 2e-46
gi|4885549|ref|NP_005456.1| v-akt murine thymoma viral oncogene ... 188 2e-46
gi|11131397|sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-prot... 188 2e-46
gi|45433564|ref|NP_035915.2| thymoma viral proto-oncogene 3; PKB... 188 2e-46
gi|27066378|pdb|1O6K|A Chain A, Structure Of Activated Form Of P... 188 2e-46
gi|7512664|pir||T17287 protein kinase (EC 2.7.1.37) akt3 short s... 188 2e-46
gi|4502023|ref|NP_001617.1| v-akt murine thymoma viral oncogene ... 188 2e-46
gi|27066381|pdb|1O6L|A Chain A, Crystal Structure Of An Activate... 188 2e-46
gi|33304021|gb|AAQ02518.1| v-akt murine thymoma viral oncogene-l... 188 2e-46
gi|32307163|ref|NP_859029.1| v-akt murine thymoma viral oncogene... 188 2e-46
gi|13676454|dbj|BAB41150.1| hypothetical protein [Macaca fascicu... 188 2e-46
gi|28279352|gb|AAH46261.1| Akt2-prov protein [Xenopus laevis] 188 2e-46
gi|337491|gb|AAA36585.1| rac protein kinase-beta [Homo sapiens] 188 2e-46
gi|31615317|pdb|1GZK|A Chain A, Molecular Mechanism For The Regu... 188 2e-46
gi|50740731|ref|XP_419544.1| PREDICTED: similar to RAC-gamma ser... 188 2e-46
gi|50741701|ref|XP_419611.1| PREDICTED: similar to ribosomal pro... 188 2e-46
gi|31615318|pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain 188 2e-46
gi|37926827|pdb|1MRV|A Chain A, Crystal Structure Of An Inactive... 188 2e-46
gi|13928778|ref|NP_113763.1| thymoma viral proto-oncogene 3; v-a... 188 2e-46
gi|47085805|ref|NP_998241.1| zgc:55713 [Danio rerio] >gnl|BL_ORD... 187 3e-46
gi|8392888|ref|NP_058789.1| murine thymoma viral (v-akt) oncogen... 187 3e-46
gi|31216024|ref|XP_316151.1| ENSANGP00000020399 [Anopheles gambi... 187 3e-46
gi|37575481|gb|AAQ93804.1| ribosomal protein S6 kinase [Zea mays] 187 4e-46
gi|33243964|gb|AAH55331.1| Ribosomal protein S6 kinase, polypept... 187 4e-46
gi|26333955|dbj|BAC30695.1| unnamed protein product [Mus musculus] 187 4e-46
gi|4506739|ref|NP_003943.1| ribosomal protein S6 kinase, 70kDa, ... 187 5e-46
gi|538540|pir||A40831 gag-akt polyprotein - AKT8 murine leukemia... 187 5e-46
gi|32425471|gb|AAH06106.2| RPS6KB2 protein [Homo sapiens] 187 5e-46
gi|6680674|ref|NP_031460.1| thymoma viral proto-oncogene 2; RAC-... 187 5e-46
gi|15100164|ref|NP_150233.1| v-akt murine thymoma viral oncogene... 187 5e-46
gi|37588972|gb|AAH00094.2| RPS6KB2 protein [Homo sapiens] 187 5e-46
gi|6753034|ref|NP_033782.1| thymoma viral proto-oncogene 1 [Mus ... 187 5e-46
gi|12643872|sp|Q9UBS0|K6B2_HUMAN Ribosomal protein S6 kinase bet... 187 5e-46
gi|400112|sp|P31748|KAKT_MLVAT AKT kinase transforming protein 187 5e-46
gi|33303901|gb|AAQ02464.1| ribosomal protein S6 kinase, 70kDa, p... 187 5e-46
gi|33304209|gb|AAQ02612.1| ribosomal protein S6 kinase, 70kDa, p... 186 9e-46
gi|125695|sp|P23443|K6B1_HUMAN Ribosomal protein S6 kinase (S6K)... 186 9e-46
gi|125696|sp|P21425|K6B1_RAT Ribosomal protein S6 kinase I (S6K)... 186 9e-46
gi|45430051|ref|NP_991385.1| p70S6K [Bos taurus] >gnl|BL_ORD_ID|... 186 9e-46
gi|31418467|gb|AAH53365.1| Unknown (protein for MGC:61512) [Homo... 186 9e-46
gi|26328523|dbj|BAC28000.1| unnamed protein product [Mus musculus] 186 9e-46
gi|109371|pir||S12906 probable ribosomal protein S6 kinase (EC 2... 186 9e-46
gi|23512346|gb|AAH38491.1| Rps6kb1 protein [Mus musculus] 186 9e-46
gi|4506737|ref|NP_003152.1| ribosomal protein S6 kinase, 70kDa, ... 186 9e-46
gi|14010889|ref|NP_114191.1| S6 kinase [Rattus norvegicus] >gnl|... 186 9e-46
gi|48104993|ref|XP_395876.1| similar to p70 ribosomal protein S6... 186 1e-45
gi|26324816|dbj|BAC26162.1| unnamed protein product [Mus musculus] 185 2e-45
gi|50758354|ref|XP_415882.1| PREDICTED: similar to Ribosomal pro... 185 2e-45
gi|24658719|ref|NP_523941.2| CG10539-PA [Drosophila melanogaster... 185 2e-45
gi|1778160|gb|AAC47429.1| 70 kDa S6 kinase [Drosophila melanogas... 185 2e-45
gi|400144|sp|P31750|KRAC_MOUSE RAC-alpha serine/threonine-protei... 184 3e-45
gi|33303885|gb|AAQ02456.1| v-akt murine thymoma viral oncogene h... 184 3e-45
gi|31205767|ref|XP_311835.1| ENSANGP00000018211 [Anopheles gambi... 184 3e-45
gi|12653417|gb|AAH00479.1| AKT1 protein [Homo sapiens] 184 3e-45
gi|4885061|ref|NP_005154.1| serine/threonine protein kinase; Mur... 184 3e-45
gi|125693|sp|P10665|K6AA_XENLA Ribosomal protein S6 kinase II al... 184 3e-45
gi|7434394|pir||JE0377 p70 S6 kinase (EC 2.7.-.-) - human >gnl|B... 182 1e-44
gi|27806747|ref|NP_776411.1| v-akt murine thymoma viral oncogene... 182 1e-44
gi|35481|emb|CAA43372.1| human protein kinase B [Homo sapiens] 182 1e-44
gi|23509142|ref|NP_701810.1| rac-beta serine/threonine protein k... 182 1e-44
gi|46909485|gb|AAT06260.1| protein kinase B-like protein [Plasmo... 182 1e-44
gi|34861393|ref|XP_341980.1| similar to S6 kinase 2 [Rattus norv... 182 1e-44
gi|12060812|gb|AAG48248.1| p70 ribosomal protein S6 kinase [Arte... 182 2e-44
gi|49256532|gb|AAH71102.1| Unknown (protein for MGC:81220) [Xeno... 182 2e-44
gi|125694|sp|P10666|K6AB_XENLA Ribosomal protein S6 kinase II be... 182 2e-44
gi|31198165|ref|XP_308030.1| ENSANGP00000019348 [Anopheles gambi... 181 2e-44
gi|10946894|ref|NP_067460.1| ribosomal protein S6 kinase, polype... 181 2e-44
gi|39595602|emb|CAE67103.1| Hypothetical protein CBG12516 [Caeno... 180 7e-44
gi|50748598|ref|XP_421318.1| PREDICTED: similar to ribosomal pro... 179 9e-44
gi|39794417|gb|AAH64239.1| LOC394938 protein [Xenopus tropicalis] 179 1e-43
gi|4582255|emb|CAB40193.1| kinase [Xenopus laevis] 179 1e-43
gi|47210537|emb|CAF90656.1| unnamed protein product [Tetraodon n... 179 1e-43
gi|49118486|gb|AAH73469.1| Rps6kb1-A protein [Xenopus laevis] 179 1e-43
gi|7657526|ref|NP_055311.1| ribosomal protein S6 kinase, 90kDa, ... 178 2e-43
gi|11181910|emb|CAC16111.1| bA54F22.1.1 (ribosomal protein S6 ki... 178 2e-43
gi|33303997|gb|AAQ02506.1| ribosomal protein S6 kinase, 90kDa, p... 178 2e-43
gi|49168616|emb|CAG38803.1| RPS6KA6 [Homo sapiens] 178 2e-43
gi|33300395|emb|CAE17938.1| Hypothetical protein T01H8.1c [Caeno... 178 2e-43
gi|45645188|sp|Q21734|KS6A_CAEEL Putative ribosomal protein S6 k... 178 2e-43
gi|17508705|ref|NP_492320.1| ribosomal protein S6 kinase (rsk-1)... 178 2e-43
gi|33300393|emb|CAB02301.2| Hypothetical protein T01H8.1b [Caeno... 178 2e-43
gi|6677811|ref|NP_033123.1| ribosomal protein S6 kinase polypept... 178 2e-43
gi|17508707|ref|NP_492319.1| ribosomal protein S6 kinase (rsk-1)... 178 2e-43
gi|13324795|gb|AAK18843.1| putative protein kinase [Oryza sativa] 177 4e-43
gi|48138240|ref|XP_396874.1| similar to serine/threonine protein... 177 6e-43
gi|7649389|emb|CAB89082.1| S6 ribosomal protein kinase [Asparagu... 177 6e-43
gi|50415396|gb|AAH78067.1| Unknown (protein for MGC:82916) [Xeno... 177 6e-43
gi|32450549|gb|AAH54113.1| Rps6ka6 protein [Mus musculus] 177 6e-43
gi|3818592|gb|AAC69577.1| ribosome S6 protein kinase [Homo sapiens] 176 7e-43
gi|25145932|ref|NP_741614.1| AKT kinase (62.7 kD) (akt-1) [Caeno... 176 7e-43
gi|32528297|ref|NP_872198.1| ribosomal protein S6 kinase, 90kDa,... 176 7e-43
gi|32528295|ref|NP_004746.2| ribosomal protein S6 kinase, 90kDa,... 176 7e-43
gi|46107172|ref|XP_380645.1| hypothetical protein FG00469.1 [Gib... 176 9e-43
gi|50514024|pdb|1VZO|A Chain A, The Structure Of The N-Terminal ... 176 9e-43
gi|17557832|ref|NP_505637.1| AKT kinase (62.2 kD) (akt-1) [Caeno... 176 1e-42
gi|12620233|gb|AAG60621.1| S6 kinase [Aplysia californica] 175 2e-42
gi|1362152|pir||S56639 ribosomal protein S6 kinase homolog (clon... 175 2e-42
gi|19310195|dbj|BAB85907.1| p90 ribosomal S6 kinase [Asterina pe... 175 2e-42
gi|26328137|dbj|BAC27809.1| unnamed protein product [Mus musculus] 175 2e-42
gi|29789163|ref|NP_080225.1| ribosomal protein S6 kinase polypep... 175 2e-42
gi|23956386|ref|NP_705815.1| ribosomal protein S6 kinase, polype... 174 4e-42
gi|33638111|gb|AAQ24165.1| ribosomal protein S6 kinase splice va... 174 4e-42
gi|455163|gb|AAA50509.1| p90 ribosomal S6 kinase 174 5e-42
gi|47221835|emb|CAG08889.1| unnamed protein product [Tetraodon n... 174 5e-42
gi|24643817|ref|NP_523437.2| CG17596-PA [Drosophila melanogaster... 174 5e-42
gi|28416327|gb|AAO42636.1| SD05277p [Drosophila melanogaster] 174 5e-42
gi|50752484|ref|XP_422798.1| PREDICTED: similar to Protein kinas... 173 8e-42
gi|39584758|emb|CAE67653.1| Hypothetical protein CBG13216 [Caeno... 173 8e-42
gi|16266771|dbj|BAB69974.1| kinase Akt/PKB [Asterina pectinifera] 173 8e-42
gi|1079127|pir||A55888 protein kinase (EC 2.7.1.37) akt [similar... 172 1e-41
gi|45551909|ref|NP_732113.2| CG4006-PC [Drosophila melanogaster]... 172 1e-41
gi|398924|emb|CAA81204.1| Dakt1 serine-threonine protein kinase ... 172 1e-41
gi|24647358|ref|NP_732114.1| CG4006-PA [Drosophila melanogaster]... 172 1e-41
gi|17555946|ref|NP_499447.1| s6 kinase (3M341) [Caenorhabditis e... 172 1e-41
gi|25146791|ref|NP_510357.2| AKT kinase (55.8 kD) (akt-2) [Caeno... 172 2e-41
gi|7500109|pir||T21523 protein kinase (EC 2.7.1.37) akt-2 long s... 172 2e-41
gi|19114649|ref|NP_593737.1| protein kinase c-like 1 (EC 2.7.1.-... 171 3e-41
gi|1709606|sp|P36582|PCK1_SCHPO Protein kinase C-like 1 171 3e-41
gi|486786|pir||S35362 protein kinase C (EC 2.7.1.-) pck1 - fissi... 171 3e-41
gi|32420379|ref|XP_330633.1| hypothetical protein [Neurospora cr... 171 3e-41
gi|21356509|ref|NP_648432.1| CG6297-PB [Drosophila melanogaster]... 171 3e-41
gi|30725240|gb|AAP37655.1| serine/threonine protein kinase Akt [... 171 4e-41
gi|39593304|emb|CAE64774.1| Hypothetical protein CBG09565 [Caeno... 171 4e-41
gi|631750|pir||A53758 protein kinase C (EC 2.7.1.-) lambda - mouse 170 5e-41
gi|6679349|ref|NP_032883.1| protein kinase C, lambda [Mus muscul... 170 5e-41
gi|33304197|gb|AAQ02606.1| protein kinase C, iota [synthetic con... 170 5e-41
gi|34856774|ref|XP_342224.1| protein kinase C, lambda [Rattus no... 170 5e-41
gi|48255885|ref|NP_002731.3| protein kinase C, iota; atypical pr... 170 5e-41
gi|39596862|emb|CAE59089.1| Hypothetical protein CBG02381 [Caeno... 170 5e-41
gi|21166148|gb|AAM43765.1| similar to Dictyostelium discoideum (... 169 9e-41
gi|4996216|dbj|BAA78372.1| PKC lambda [Rattus norvegicus] 169 9e-41
gi|48141855|ref|XP_397273.1| similar to ENSANGP00000008680 [Apis... 169 9e-41
gi|17569233|ref|NP_508095.1| protein kinase and Protein kinase C... 169 1e-40
gi|34303892|dbj|BAC82421.1| hypothetical protein [Entamoeba hist... 169 1e-40
gi|15219539|ref|NP_175130.1| protein kinase family protein [Arab... 169 1e-40
gi|7506247|pir||T16679 hypothetical protein R04A9.5 - Caenorhabd... 169 1e-40
gi|18314569|gb|AAH22016.1| Protein kinase C, iota [Homo sapiens] 169 2e-40
gi|3024076|sp|O19111|KPCZ_RABIT Protein kinase C, zeta type (nPK... 168 2e-40
gi|23478593|gb|EAA15636.1| kinase Akt/PKB-related [Plasmodium yo... 168 3e-40
gi|3411161|gb|AAC67395.1| mitogen- and stress-activated protein ... 167 3e-40
gi|4506735|ref|NP_003933.1| ribosomal protein S6 kinase, 90kDa, ... 167 3e-40
gi|28839796|gb|AAH47896.1| RPS6KA4 protein [Homo sapiens] 167 3e-40
gi|47216837|emb|CAG02728.1| unnamed protein product [Tetraodon n... 167 4e-40
gi|15277982|gb|AAH12964.1| Ribosomal protein S6 kinase, polypept... 167 4e-40
gi|9910454|ref|NP_064308.1| ribosomal protein S6 kinase, polypep... 167 6e-40
gi|34861515|ref|XP_342005.1| similar to ribosomal protein S6 kin... 166 8e-40
gi|35501|emb|CAA78813.1| protein kinase C zeta [Homo sapiens] 166 1e-39
gi|28502762|gb|AAH47164.1| Prkci protein [Danio rerio] 166 1e-39
gi|49899150|gb|AAH75736.1| Prkci protein [Danio rerio] 166 1e-39
gi|50751352|ref|XP_422357.1| PREDICTED: similar to protein kinas... 166 1e-39
gi|30585051|gb|AAP36798.1| Homo sapiens protein kinase C, zeta [... 166 1e-39
gi|31158356|dbj|BAC76975.1| protein kinase C-zeta 2 [Mus musculus] 166 1e-39
gi|206195|gb|AAA41878.1| protein kinase C zeta subspecies 166 1e-39
gi|40363533|ref|NP_954682.1| serum/glucocorticoid regulated kina... 166 1e-39
gi|18859259|ref|NP_571930.1| protein kinase C, iota [Danio rerio... 166 1e-39
gi|11968080|ref|NP_071952.1| protein kinase C, zeta; 14 - 3 - 3 ... 166 1e-39
gi|14165515|gb|AAH08058.1| Protein kinase C, zeta [Homo sapiens]... 166 1e-39
gi|6679355|ref|NP_032886.1| protein kinase C, zeta [Mus musculus... 166 1e-39
gi|10864650|ref|NP_002735.2| protein kinase C, zeta [Homo sapien... 166 1e-39
gi|50759195|ref|XP_417561.1| PREDICTED: similar to protein kinas... 166 1e-39
gi|15241795|ref|NP_201037.1| incomplete root hair elongation (IR... 166 1e-39
gi|47221231|emb|CAG13167.1| unnamed protein product [Tetraodon n... 166 1e-39
gi|478322|pir||JN0877 protein kinase C (EC 2.7.1.-) zeta - human... 166 1e-39
gi|38086255|ref|XP_124895.2| similar to protein kinase C zeta [M... 165 2e-39
gi|17980212|gb|AAL50556.1| serine-threonine protein kinase PK2 [... 165 2e-39
gi|1730069|sp|P54644|KRAC_DICDI RAC-family serine/threonine-prot... 164 3e-39
gi|47218726|emb|CAG05698.1| unnamed protein product [Tetraodon n... 164 3e-39
gi|14326578|gb|AAK60333.1| At1g48490/T1N15_9 [Arabidopsis thalia... 164 3e-39
gi|18402213|ref|NP_564529.1| protein kinase, putative [Arabidops... 164 3e-39
gi|303941|dbj|BAA03268.1| protein kinase [Schizosaccharomyces po... 164 4e-39
gi|19112742|ref|NP_595950.1| protein kinase c-like 2 [Schizosacc... 164 4e-39
gi|50555624|ref|XP_505220.1| hypothetical protein [Yarrowia lipo... 164 4e-39
gi|50294600|ref|XP_449711.1| unnamed protein product [Candida gl... 164 5e-39
gi|2586064|gb|AAC13357.1| protein kinase C-related kinase 2 [Xen... 163 6e-39
gi|49095312|ref|XP_409117.1| hypothetical protein AN4980.2 [Aspe... 163 6e-39
gi|31198669|ref|XP_308282.1| ENSANGP00000022695 [Anopheles gambi... 163 8e-39
gi|31198671|ref|XP_308283.1| ENSANGP00000010728 [Anopheles gambi... 163 8e-39
gi|32414173|ref|XP_327566.1| hypothetical protein ( (AY029769) p... 163 8e-39
gi|28573941|ref|NP_788291.1| CG2049-PC [Drosophila melanogaster]... 162 1e-38
gi|28573943|ref|NP_788292.1| CG2049-PF [Drosophila melanogaster]... 162 1e-38
gi|15292295|gb|AAK93416.1| LD45949p [Drosophila melanogaster] 162 1e-38
gi|28573947|ref|NP_788294.1| CG2049-PE [Drosophila melanogaster]... 162 1e-38
gi|28573939|ref|NP_788290.1| CG2049-PB [Drosophila melanogaster]... 162 1e-38
gi|47213969|emb|CAG00660.1| unnamed protein product [Tetraodon n... 162 1e-38
gi|31240261|ref|XP_320544.1| ENSANGP00000015337 [Anopheles gambi... 162 1e-38
gi|527675|gb|AAA75362.1| protein kinase C subspecies zeta 162 1e-38
gi|33589302|gb|AAQ22418.1| RH55776p [Drosophila melanogaster] 162 1e-38
gi|31240263|ref|XP_320545.1| ENSANGP00000008680 [Anopheles gambi... 162 1e-38
gi|17533011|ref|NP_495011.1| protein kinase C, iota/lambda/zeta ... 161 2e-38
gi|49067618|ref|XP_398099.1| hypothetical protein UM00484.1 [Ust... 161 2e-38
gi|458284|gb|AAA57318.1| serine/threonine protein kinase 161 2e-38
gi|30684702|ref|NP_188412.2| protein kinase, putative [Arabidops... 161 3e-38
gi|9294489|dbj|BAB02708.1| IRE homolog; protein kinase-like prot... 161 3e-38
gi|9885776|gb|AAG01528.1| atypical protein kinase C [Drosophila ... 161 3e-38
gi|21392154|gb|AAM48431.1| RE60936p [Drosophila melanogaster] 161 3e-38
gi|24653760|ref|NP_524892.2| CG10261-PA [Drosophila melanogaster... 161 3e-38
gi|38109796|gb|EAA55609.1| hypothetical protein MG01260.4 [Magna... 161 3e-38
gi|6729348|dbj|BAA89784.1| IRE homolog 1 [Arabidopsis thaliana] 161 3e-38
gi|25168263|ref|NP_005618.2| serum/glucocorticoid regulated kina... 160 4e-38
gi|3914977|sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase ... 160 4e-38
gi|3688803|gb|AAC62398.1| unknown [Xenopus laevis] 160 4e-38
gi|33303865|gb|AAQ02446.1| serum/glucocorticoid regulated kinase... 160 4e-38
gi|6755490|ref|NP_035491.1| serum/glucocorticoid regulated kinas... 160 5e-38
gi|477098|pir||A48094 serum and glucocorticoid-regulated kinase ... 160 5e-38
gi|50550707|ref|XP_502826.1| hypothetical protein [Yarrowia lipo... 160 5e-38
gi|45383215|ref|NP_989807.1| serum- and glucocorticoid-induced k... 160 5e-38
gi|34860837|ref|XP_215718.2| similar to protein kinase C-like 2 ... 160 5e-38
gi|91277|pir||C32571 ribosomal protein S6 kinase II (EC 2.7.-.-)... 160 5e-38
gi|15072452|gb|AAK40343.1| protein kinase 1 [Cryphonectria paras... 160 5e-38
gi|33303981|gb|AAQ02498.1| protein kinase C-like 2 [synthetic co... 160 5e-38
gi|35396780|gb|AAQ84896.1| protein kinase C 1 [Cryptococcus neof... 160 5e-38
gi|35396778|gb|AAQ84895.1| protein kinase C 1 [Cryptococcus neof... 160 5e-38
gi|50259580|gb|EAL22253.1| hypothetical protein CNBC3910 [Crypto... 160 5e-38
gi|11493219|emb|CAC17575.1| dJ905H16.1 (protein kinase C-like 2)... 160 5e-38
gi|47124333|gb|AAH70401.1| Sgk protein [Mus musculus] 160 5e-38
gi|5453974|ref|NP_006247.1| protein kinase N2; protein kinase C-... 160 5e-38
gi|50552438|ref|XP_503629.1| hypothetical protein [Yarrowia lipo... 160 5e-38
gi|46122935|ref|XP_386021.1| hypothetical protein FG05845.1 [Gib... 160 7e-38
gi|20127541|ref|NP_057360.2| serum/glucocorticoid regulated kina... 160 7e-38
gi|4558499|gb|AAD22633.1| protein kinase C; serine/threonine pro... 160 7e-38
gi|26350541|dbj|BAC38910.1| unnamed protein product [Mus musculus] 160 7e-38
gi|25168261|ref|NP_733794.1| serum/glucocorticoid regulated kina... 160 7e-38
gi|33878427|gb|AAH14037.2| SGK2 protein [Homo sapiens] 160 7e-38
gi|33303995|gb|AAQ02505.1| serum/glucocorticoid regulated kinase... 160 7e-38
gi|30354738|gb|AAH52073.1| Pkn2 protein [Mus musculus] 160 7e-38
gi|49116933|gb|AAH73077.1| Sgk protein [Xenopus laevis] 159 9e-38
gi|2707262|gb|AAB92244.1| protein kinase C-related kinase [Pisas... 159 9e-38
gi|30520013|ref|NP_848769.1| serine/threonine kinase 7; protein ... 159 9e-38
gi|17402861|gb|AAF27051.2| SGK-like protein SGKL [Homo sapiens] 159 1e-37
gi|732542|gb|AAA64341.1| cAMP-dependent protein kinase 159 1e-37
gi|28629057|gb|AAO49460.1| protein kinase C [Leptosphaeria macul... 159 1e-37
gi|14719777|pdb|1FOT|A Chain A, Structure Of The Unliganded Camp... 159 2e-37
gi|3116066|emb|CAA11528.1| s-sgk2 [Squalus acanthias] 159 2e-37
gi|17570293|ref|NP_510647.1| serum and Glucocorticoid inducible ... 159 2e-37
gi|19075330|ref|NP_587830.1| putative protein kinase [Schizosacc... 159 2e-37
gi|4625|emb|CAA68689.1| unnamed protein product [Saccharomyces c... 159 2e-37
gi|2144416|pir||OKBYC1 protein kinase (EC 2.7.1.37), cAMP-depend... 159 2e-37
gi|39596349|emb|CAE69987.1| Hypothetical protein CBG16386 [Caeno... 159 2e-37
gi|48097317|ref|XP_391874.1| similar to ENSANGP00000009078 [Apis... 158 2e-37
gi|173011|gb|AAA35165.1| cAMP-dependent protein kinase subunit (... 158 2e-37
gi|6650370|gb|AAF21806.1| rac serine/threonine kinase homolog [D... 158 2e-37
gi|9507093|ref|NP_062105.1| serum/glucocorticoid regulated kinas... 158 2e-37
gi|6225860|sp|O08874|PKL2_RAT Protein kinase C-like 2 (Protein-k... 158 3e-37
gi|13431833|sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase... 158 3e-37
gi|20218944|emb|CAD24069.1| protein kinase A catalytic subunit [... 158 3e-37
gi|6325053|ref|NP_015121.1| Involved in nutrient control of cell... 158 3e-37
gi|26449548|dbj|BAC41900.1| putative protein kinase [Arabidopsis... 157 3e-37
gi|3116064|emb|CAA11527.1| s-sgk1 [Squalus acanthias] 157 3e-37
gi|50303809|ref|XP_451851.1| unnamed protein product [Kluyveromy... 157 3e-37
gi|9858805|gb|AAG01142.1| protein kinase A [Blumeria graminis] 157 3e-37
gi|6016441|sp|O42632|KPC1_COCHE Protein kinase C-like >gnl|BL_OR... 157 5e-37
gi|1093486|prf||2104208A protein kinase C-related kinase:ISOTYPE... 157 6e-37
gi|46445417|gb|EAL04686.1| hypothetical protein CaO19.12357 [Can... 157 6e-37
gi|50405145|ref|YP_054237.1| cAMP-dependent protein kinase catal... 157 6e-37
gi|125208|sp|P06244|KAPA_YEAST cAMP-dependent protein kinase typ... 157 6e-37
gi|19075510|ref|NP_588010.1| putative proliferation-associated s... 157 6e-37
gi|2073444|emb|CAA73363.1| protein kinase C [Hydra vulgaris] 156 8e-37
gi|25304069|gb|AAH40061.1| Protein kinase C-like 1, isoform 2 [H... 156 8e-37
gi|6174910|sp|Q16512|PKL1_HUMAN Protein kinase C-like 1 (Protein... 156 8e-37
gi|47132589|ref|NP_002732.3| protein kinase N1 isoform 2; serine... 156 8e-37
gi|47132591|ref|NP_998725.1| protein kinase N1 isoform 1; serine... 156 8e-37
gi|2073446|emb|CAA73362.1| protein kinase C [Hydra vulgaris] 156 8e-37
gi|50415747|ref|XP_457493.1| unnamed protein product [Debaryomyc... 156 8e-37
gi|543444|pir||JC2130 protein kinase (EC 2.7.1.37) - rat 156 8e-37
gi|8394047|ref|NP_058871.1| protein kinase C-like 1; protein kin... 156 8e-37
gi|38197376|gb|AAH61836.1| Protein kinase C-like 1 [Rattus norve... 156 8e-37
gi|38524427|dbj|BAD02338.1| protein kinase C [Emericella nidulans] 156 8e-37
gi|38104629|gb|EAA51167.1| hypothetical protein MG08689.4 [Magna... 156 8e-37
gi|4928705|gb|AAD33693.1| protein kinase C [Magnaporthe grisea] 156 8e-37
gi|6102720|emb|CAB59301.1| protein kinase C [Botryotinia fuckeli... 156 8e-37
gi|49084020|ref|XP_404243.1| KPC1_ASPNG Protein kinase C-like [A... 156 8e-37
gi|38110717|gb|EAA56397.1| hypothetical protein MG06368.4 [Magna... 156 8e-37
gi|22087745|gb|AAM91027.1| protein kinase B [Hydra vulgaris] 156 8e-37
gi|49257650|gb|AAH74305.1| Unknown (protein for MGC:84110) [Xeno... 156 1e-36
gi|516040|gb|AAA93199.1| cAMP-dependent protein kinase catalytic... 156 1e-36
gi|7497946|pir||T20232 hypothetical protein C54G4.1 - Caenorhabd... 156 1e-36
gi|32563675|ref|NP_492204.2| protein kinase and Protein kinase C... 156 1e-36
gi|16905491|gb|AAL31374.1| cardiolipin/protease-activated protei... 156 1e-36
gi|38707442|dbj|BAD04044.1| catalytic subunit of cAMP-dependent ... 156 1e-36
gi|50731568|ref|XP_418280.1| PREDICTED: similar to Serine/threon... 156 1e-36
gi|6322682|ref|NP_012755.1| Involved in nutrient control of cell... 155 1e-36
gi|6016442|sp|Q25378|KPC1_LYTPI Protein kinase C >gnl|BL_ORD_ID|... 155 1e-36
gi|7446393|pir||PC4287 protein kinase (EC 2.7.1.37) N - fruit fl... 155 1e-36
gi|30172014|gb|AAP20604.1| protein kinase C [Pichia pastoris] 155 1e-36
gi|50757368|ref|XP_415491.1| PREDICTED: similar to protein kinas... 155 1e-36
gi|6225593|sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase... 155 1e-36
gi|228058|prf||1716374A protein kinase C I 155 1e-36
gi|2499576|sp|Q00078|KPC1_ASPNG Protein kinase C-like >gnl|BL_OR... 155 1e-36
gi|45198429|ref|NP_985458.1| AFL090Wp [Eremothecium gossypii] >g... 155 1e-36
gi|6016443|sp|P87253|KPC1_NEUCR Protein kinase C-like >gnl|BL_OR... 155 2e-36
gi|32411837|ref|XP_326399.1| PROTEIN KINASE C-LIKE [Neurospora c... 155 2e-36
gi|464395|sp|P28178|PK2_DICDI Protein kinase 2 >gnl|BL_ORD_ID|12... 155 2e-36
gi|31563382|ref|NP_037389.4| serum/glucocorticoid regulated kina... 155 2e-36
gi|6466010|gb|AAF12758.1| protein kinase [Homo sapiens] >gnl|BL_... 155 2e-36
gi|50548247|ref|XP_501593.1| hypothetical protein [Yarrowia lipo... 155 2e-36
gi|2911458|gb|AAC04355.1| cAMP-dependent protein kinase catalyti... 155 2e-36
gi|33303813|gb|AAQ02420.1| serum/glucocorticoid regulated kinase... 155 2e-36
gi|45190492|ref|NP_984746.1| AEL115Cp [Eremothecium gossypii] >g... 155 2e-36
gi|32813439|ref|NP_796236.2| protein kinase N1; serine/threonine... 155 2e-36
gi|50547917|ref|XP_501428.1| hypothetical protein [Yarrowia lipo... 155 2e-36
gi|173013|gb|AAA35166.1| cAMP-dependent protein kinase subunit (... 154 3e-36
gi|46136289|ref|XP_389836.1| hypothetical protein FG09660.1 [Gib... 154 3e-36
gi|50425563|ref|XP_461377.1| unnamed protein product [Debaryomyc... 154 4e-36
gi|1085381|pir||S48705 serine/threonine protein kinase - human >... 154 4e-36
gi|39596192|emb|CAE69829.1| Hypothetical protein CBG16150 [Caeno... 154 4e-36
gi|39582051|emb|CAE63694.1| Hypothetical protein CBG08209 [Caeno... 154 4e-36
gi|48101319|ref|XP_395099.1| similar to ribosomal protein S6 kin... 154 4e-36
gi|50303505|ref|XP_451694.1| unnamed protein product [Kluyveromy... 154 4e-36
gi|12005625|gb|AAG44542.1| protein kinase C [Blumeria graminis] 154 5e-36
gi|1362234|pir||S55694 protein kinase (EC 2.7.1.37) sck1, cAMP-d... 154 5e-36
gi|19114666|ref|NP_593754.1| cAMP-dependent protein kinase, sck1... 154 5e-36
gi|20072336|gb|AAH26549.1| Serum/glucocorticoid regulated kinase... 154 5e-36
gi|3393042|emb|CAA06507.1| eye-specific protein kinase C [Callip... 154 5e-36
gi|45187484|ref|NP_983707.1| ADL389Wp [Eremothecium gossypii] >g... 154 5e-36
gi|2760821|gb|AAB95270.1| serine/threonine protein kinase [Entam... 154 5e-36
gi|32411229|ref|XP_326095.1| hypothetical protein ( (AF264760) c... 154 5e-36
gi|3114989|emb|CAA73554.1| Serine/Threonine protein kinase [Syco... 154 5e-36
gi|38109783|gb|EAA55600.1| hypothetical protein MG01251.4 [Magna... 154 5e-36
gi|4157977|emb|CAA76911.1| protein kinase C [Geodia cydonium] 154 5e-36
gi|46436399|gb|EAK95762.1| hypothetical protein CaO19.9817 [Cand... 153 7e-36
gi|34860642|ref|XP_342571.1| serum/glucocorticoid regulated kina... 153 7e-36
gi|11596395|gb|AAG38600.1| cAMP-dependent protein kinase catalyt... 153 7e-36
gi|21392563|gb|AAA68709.2| Protein kinase c protein 2, isoform c... 153 7e-36
gi|7305483|ref|NP_038759.1| serum/glucocorticoid regulated kinas... 153 7e-36
gi|32566197|ref|NP_741872.2| protein kinase C (78.0 kD) (pkc-2) ... 153 7e-36
gi|2499577|sp|Q99014|KPC1_TRIRE Protein kinase C-like >gnl|BL_OR... 153 7e-36
gi|1778592|gb|AAB40869.1| protein kinase C2 B isoform [Caenorhab... 153 7e-36
gi|6322297|ref|NP_012371.1| putative catalytic subunit of cAMP-d... 153 7e-36
gi|7511603|pir||T15903 protein kinase C homolog - Caenorhabditis... 153 7e-36
gi|6456802|emb|CAB61490.1| cAMP-dependent protein kinase A catal... 153 9e-36
gi|46442847|gb|EAL02133.1| hypothetical protein CaO19.829 [Candi... 153 9e-36
gi|50420447|ref|XP_458760.1| unnamed protein product [Debaryomyc... 153 9e-36
gi|18959280|ref|NP_573483.1| serum/glucocorticoid regulated kina... 153 9e-36
gi|17390848|gb|AAH18363.1| Sgk3 protein [Mus musculus] 153 9e-36
gi|26327211|dbj|BAC27349.1| unnamed protein product [Mus musculus] 152 1e-35
gi|50308473|ref|XP_454238.1| unnamed protein product [Kluyveromy... 152 1e-35
gi|47209740|emb|CAF93725.1| unnamed protein product [Tetraodon n... 152 1e-35
gi|50288647|ref|XP_446753.1| unnamed protein product [Candida gl... 152 1e-35
gi|38110989|gb|EAA56628.1| hypothetical protein MG06599.4 [Magna... 152 1e-35
gi|33988322|gb|AAH15816.2| MAST2 protein [Homo sapiens] 152 1e-35
gi|26344119|dbj|BAC35716.1| unnamed protein product [Mus musculus] 152 1e-35
gi|14149671|ref|NP_055927.1| microtubule associated serine/threo... 152 1e-35
gi|41350925|gb|AAH65499.1| MAST205 protein [Homo sapiens] 152 1e-35
gi|32420385|ref|XP_330636.1| hypothetical protein [Neurospora cr... 152 1e-35
gi|6319363|ref|NP_009445.1| Protein Kinase C; Pkc1p [Saccharomyc... 152 1e-35
gi|172177|gb|AAA34878.1| protein kinase C-like protein (PKC1) 152 1e-35
gi|40788866|dbj|BAA34527.2| KIAA0807 protein [Homo sapiens] 152 1e-35
gi|1220554|gb|AAA91961.1| type Z protein kinase c 152 2e-35
gi|46107178|ref|XP_380648.1| hypothetical protein FG00472.1 [Gib... 152 2e-35
gi|28558156|sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase S... 152 2e-35
gi|48094345|ref|XP_394147.1| similar to cyclic AMP-dependent cat... 152 2e-35
gi|22087742|gb|AAM91026.1| protein kinase C-related kinase [Hydr... 152 2e-35
gi|10334453|emb|CAC10200.1| bA563J2.2 (protein kinase C theta ) ... 151 2e-35
gi|47220463|emb|CAG03243.1| unnamed protein product [Tetraodon n... 151 2e-35
gi|7522131|pir||T28666 protein kinase C-related kinase PRKSD - S... 151 2e-35
gi|49097300|ref|XP_410110.1| hypothetical protein AN5973.2 [Aspe... 151 2e-35
gi|25405887|pir||H96509 protein F27F5.23 [imported] - Arabidopsi... 151 2e-35
gi|50292225|ref|XP_448545.1| unnamed protein product [Candida gl... 151 2e-35
gi|558099|gb|AAA75571.1| protein kinase C-theta 151 2e-35
gi|5453976|ref|NP_006248.1| protein kinase C, theta [Homo sapien... 151 2e-35
gi|125318|sp|P16912|KDC2_DROME Protein kinase DC2 >gnl|BL_ORD_ID... 151 3e-35
gi|21429726|gb|AAM50541.1| AT10577p [Drosophila melanogaster] 151 3e-35
gi|34874121|ref|XP_343976.1| protein kinase C, alpha [Rattus nor... 151 3e-35
gi|7578502|gb|AAF64072.1| protein kinase A [Candida albicans] 151 3e-35
gi|50287865|ref|XP_446362.1| unnamed protein product [Candida gl... 151 3e-35
gi|50294680|ref|XP_449751.1| unnamed protein product [Candida gl... 151 3e-35
gi|24664872|ref|NP_524097.2| CG6117-PA [Drosophila melanogaster]... 151 3e-35
gi|28574900|ref|NP_730083.2| CG6117-PB [Drosophila melanogaster]... 151 3e-35
gi|23956080|ref|NP_058675.1| protein kinase, X-linked; putative ... 151 3e-35
gi|3114991|emb|CAA73557.1| Serine/Threonine protein kinase [Syco... 151 3e-35
gi|46125747|ref|XP_387427.1| hypothetical protein FG07251.1 [Gib... 151 3e-35
gi|46444978|gb|EAL04249.1| hypothetical protein CaO19.13322 [Can... 151 3e-35
gi|1170687|sp|P43057|KPC1_CANAL Protein kinase C-like 1 (PKC 1) ... 151 3e-35
gi|26006211|dbj|BAC41448.1| mKIAA0807 protein [Mus musculus] 151 3e-35
gi|125552|sp|P05696|KPCA_RAT Protein kinase C, alpha type (PKC-a... 151 3e-35
gi|66717|pir||KIMSCA protein kinase C (EC 2.7.1.-) alpha - mouse... 151 3e-35
gi|125550|sp|P20444|KPCA_MOUSE Protein kinase C, alpha type (PKC... 151 3e-35
gi|6755078|ref|NP_035231.1| protein kinase C, alpha [Mus musculu... 151 3e-35
gi|4506067|ref|NP_002728.1| protein kinase C, alpha; protein kin... 151 3e-35
gi|104167|pir||A37237 protein kinase C (EC 2.7.1.-) I - African ... 150 4e-35
gi|50254457|gb|EAL17206.1| hypothetical protein CNBN0340 [Crypto... 150 4e-35
gi|47207176|emb|CAF90287.1| unnamed protein product [Tetraodon n... 150 4e-35
gi|125551|sp|P10102|KPCA_RABIT Protein kinase C, alpha type (PKC... 150 4e-35
gi|17136402|ref|NP_476682.1| CG6622-PA [Drosophila melanogaster]... 150 6e-35
gi|38511949|gb|AAH60703.1| Mast2 protein [Mus musculus] 150 6e-35
gi|33146662|dbj|BAC80008.1| putative S6 ribosomal protein kinase... 150 6e-35
gi|6010221|emb|CAB57279.1| putative PKA-related protein kinase [... 150 6e-35
gi|6678958|ref|NP_032667.1| microtubule associated serine/threon... 150 6e-35
gi|50751534|ref|XP_422443.1| PREDICTED: similar to Mast2 protein... 150 6e-35
gi|24654282|ref|NP_725626.1| CG6622-PB [Drosophila melanogaster]... 150 6e-35
gi|27806089|ref|NP_776860.1| protein kinase, C alpha [Bos taurus... 150 6e-35
gi|31203461|ref|XP_310679.1| ENSANGP00000020017 [Anopheles gambi... 150 7e-35
gi|50306467|ref|XP_453207.1| unnamed protein product [Kluyveromy... 150 7e-35
gi|35505544|gb|AAH57694.1| Protein kinase C zeta subspecies [Mus... 150 7e-35
gi|629915|pir||S47220 protein kinase C (EC 2.7.1.-) PKC1 - yeast... 150 7e-35
gi|27807061|ref|NP_777012.1| protein kinase C, beta 1 polypeptid... 149 9e-35
gi|3114956|emb|CAA73553.1| Serine/Threonine protein kinase [Sube... 149 9e-35
gi|46433231|gb|EAK92679.1| hypothetical protein CaO19.399 [Candi... 149 9e-35
gi|34853530|ref|XP_226732.2| similar to KIAA0303 [Rattus norvegi... 149 9e-35
gi|631936|pir||S41099 protein kinase (EC 2.7.1.37), cAMP-depende... 149 9e-35
gi|6088096|dbj|BAA85625.1| protein kinase PKNbeta [Homo sapiens] 149 9e-35
gi|50761545|ref|XP_424758.1| PREDICTED: similar to KIAA0303 [Gal... 149 9e-35
gi|102678|pir||S19027 protein kinase A (EC 2.7.1.-) catalytic ch... 149 9e-35
gi|545623|gb|AAB30032.1| cAMP-dependent protein kinase C subunit... 149 9e-35
gi|50755717|ref|XP_414868.1| PREDICTED: similar to Protein kinas... 149 9e-35
gi|507141|gb|AAA19440.1| cAMP-dependent protein kinase catalytic... 149 9e-35
gi|47213332|emb|CAF93963.1| unnamed protein product [Tetraodon n... 149 9e-35
gi|25146870|ref|NP_741871.1| protein kinase C (77.6 kD) (pkc-2) ... 149 1e-34
gi|1778590|gb|AAB40868.1| protein kinase C2 A isoform [Caenorhab... 149 1e-34
gi|102679|pir||S19028 protein kinase (EC 2.7.1.37) A, cAMP-depen... 149 1e-34
gi|17136716|ref|NP_476863.1| CG6518-PA [Drosophila melanogaster]... 149 1e-34
gi|27769312|gb|AAH42511.1| 4930420O11Rik protein [Mus musculus] 149 1e-34
gi|6679353|ref|NP_032885.1| protein kinase C, theta [Mus musculu... 149 2e-34
gi|15787861|dbj|BAB68538.1| protein kinase C thetaII [Mus musculus] 149 2e-34
gi|2822147|gb|AAB97934.1| Protein kinase C beta (5' partial) spl... 149 2e-34
gi|4325024|gb|AAD17221.1| cAMP-dependent protein kinase catalyti... 149 2e-34
gi|66731|pir||KIMSCD protein kinase C (EC 2.7.1.-) delta - mouse... 149 2e-34
gi|2822146|gb|AAB97933.1| Protein kinase C beta (5' partial) spl... 149 2e-34
gi|47157322|ref|NP_997700.1| protein kinase C, beta isoform 1; p... 149 2e-34
gi|45185877|ref|NP_983593.1| ACR191Cp [Eremothecium gossypii] >g... 149 2e-34
gi|37550319|ref|XP_291141.3| KIAA0303 protein [Homo sapiens] 149 2e-34
gi|24641525|ref|NP_511171.2| CG10524-PA [Drosophila melanogaster... 149 2e-34
gi|20127450|ref|NP_002729.2| protein kinase C, beta isoform 2; p... 149 2e-34
gi|9716257|emb|CAC01625.1| protein kinase C homologue [Tuber bor... 149 2e-34
gi|2224547|dbj|BAA20762.1| KIAA0303 [Homo sapiens] 149 2e-34
gi|55132|emb|CAA36907.1| protein kinase C [Mus musculus] >gnl|BL... 149 2e-34
gi|9844082|emb|CAC03748.1| cAMP-dependent protein kinase catalyt... 148 2e-34
gi|38075057|ref|XP_283179.2| RIKEN cDNA 4930420O11 [Mus musculus] 148 2e-34
gi|40254851|ref|NP_037487.2| protein kinase PKNbeta [Homo sapien... 148 2e-34
gi|6981398|ref|NP_036845.1| protein kinase C, beta; protein kina... 148 2e-34
gi|125539|sp|P05772|KPCB_RABIT Protein kinase C, beta type (PKC-... 148 2e-34
gi|125540|sp|P04410|KPCB_MOUSE Protein kinase C, beta type (PKC-... 148 2e-34
gi|47221653|emb|CAF97918.1| unnamed protein product [Tetraodon n... 148 2e-34
gi|206189|gb|AAA41875.1| protein kinase C type II 148 2e-34
gi|66725|pir||KIRBC2 protein kinase C (EC 2.7.1.-) beta-II - rab... 148 2e-34
gi|7019312|emb|CAB75578.1| protein kinase C delta [Rattus norveg... 148 2e-34
gi|18959250|ref|NP_579841.1| protein kinase C, delta [Rattus nor... 148 2e-34
gi|6679345|ref|NP_032881.1| protein kinase C, beta [Mus musculus... 148 2e-34
gi|12698444|gb|AAK01549.1| cAMP-dependent protein kinase catalyt... 148 3e-34
gi|37702159|gb|AAR00731.1| protein kinase C type beta [Schistoso... 148 3e-34
gi|47212671|emb|CAF94152.1| unnamed protein product [Tetraodon n... 148 3e-34
gi|47223111|emb|CAG07198.1| unnamed protein product [Tetraodon n... 148 3e-34
gi|6755082|ref|NP_035233.1| protein kinase C, delta; protein kin... 147 4e-34
gi|34877594|ref|XP_237971.2| similar to KIAA0561 protein [Rattus... 147 4e-34
gi|66724|pir||KIRTC2 protein kinase C (EC 2.7.1.-) beta-II - rat... 147 5e-34
gi|15074866|emb|CAC48007.1| protein kinase C homologue [Tuber ma... 147 5e-34
gi|27524356|emb|CAC82611.1| protein kinase A catalytic subunit 1... 147 5e-34
gi|47216574|emb|CAG00609.1| unnamed protein product [Tetraodon n... 147 5e-34
gi|66721|pir||KIRTC1 protein kinase C (EC 2.7.1.-) beta-I - rat ... 147 5e-34
gi|6755080|ref|NP_035232.1| protein kinase C, gamma [Mus musculu... 147 5e-34
gi|103330|pir||A32545 protein kinase C (EC 2.7.1.-) - fruit fly ... 147 5e-34
gi|48096660|ref|XP_394743.1| similar to CG10524-PA [Apis mellifera] 147 5e-34
gi|4938231|emb|CAA28890.2| protein kinase C [Drosophila melanoga... 147 5e-34
gi|476509|pir||OKHUCG protein kinase (EC 2.7.1.37), cAMP-depende... 147 5e-34
gi|16580138|gb|AAL02131.1| cAMP-dependent protein kinase catalyt... 147 5e-34
gi|125218|sp|P24256|KAPI_BOVIN cAMP-dependent protein kinase, be... 147 5e-34
gi|6755076|ref|NP_035230.1| protein kinase, cAMP dependent, cata... 147 5e-34
gi|27807059|ref|NP_777010.1| cAMP-dependent protein kinase catal... 147 5e-34
gi|49097964|ref|XP_410442.1| hypothetical protein AN6305.2 [Aspe... 147 5e-34
gi|49093828|ref|XP_408375.1| hypothetical protein AN4238.2 [Aspe... 147 6e-34
gi|41053359|ref|NP_957323.1| similar to Protein C kinase 53E [Da... 147 6e-34
>gi|17567363|ref|NP_508114.1| protein kinase (XB152) [Caenorhabditis
elegans]
gi|7500046|pir||T30026 hypothetical protein F28C10.3 - Caenorhabditis
elegans
gi|1326310|gb|AAB00607.1| Hypothetical protein F28C10.3
[Caenorhabditis elegans]
Length = 392
Score = 821 bits (2121), Expect = 0.0
Identities = 392/392 (100%), Positives = 392/392 (100%)
Frame = -1
Query: 1179 MTECPESSTNMTNGENGENHAPAATIEDFEILKHIGSGAYGEVAAVRKLNGCDTETIYAM 1000
MTECPESSTNMTNGENGENHAPAATIEDFEILKHIGSGAYGEVAAVRKLNGCDTETIYAM
Sbjct: 1 MTECPESSTNMTNGENGENHAPAATIEDFEILKHIGSGAYGEVAAVRKLNGCDTETIYAM 60
Query: 999 KVMEKRRMSKHKDMVEHEWKILTTIHNPFFMKMSYSFQTKRHLVFVMPFAGGGDMLTMME 820
KVMEKRRMSKHKDMVEHEWKILTTIHNPFFMKMSYSFQTKRHLVFVMPFAGGGDMLTMME
Sbjct: 61 KVMEKRRMSKHKDMVEHEWKILTTIHNPFFMKMSYSFQTKRHLVFVMPFAGGGDMLTMME 120
Query: 819 NECLIEESAHFYLCELVEGIGYLHEKHIVHRDVKLENLLIGNDGHLMITDYGLSATGCDA 640
NECLIEESAHFYLCELVEGIGYLHEKHIVHRDVKLENLLIGNDGHLMITDYGLSATGCDA
Sbjct: 121 NECLIEESAHFYLCELVEGIGYLHEKHIVHRDVKLENLLIGNDGHLMITDYGLSATGCDA 180
Query: 639 EDAIQGVIGTRHTMAPEVHLEKKYGTSCDWWAVGITYCDMRSDKAVFDGADSKEYSDSTA 460
EDAIQGVIGTRHTMAPEVHLEKKYGTSCDWWAVGITYCDMRSDKAVFDGADSKEYSDSTA
Sbjct: 181 EDAIQGVIGTRHTMAPEVHLEKKYGTSCDWWAVGITYCDMRSDKAVFDGADSKEYSDSTA 240
Query: 459 KKRPRLPKVLSPRERGFVNKLIVRDPTQRLGNGPDGTATVKAHDMFKGVVWEDVLAKKSK 280
KKRPRLPKVLSPRERGFVNKLIVRDPTQRLGNGPDGTATVKAHDMFKGVVWEDVLAKKSK
Sbjct: 241 KKRPRLPKVLSPRERGFVNKLIVRDPTQRLGNGPDGTATVKAHDMFKGVVWEDVLAKKSK 300
Query: 279 SDNYSVFATHNFGNRPTKFFLNAFLYYTLSHFTGLILTSRTHPCATTSHPTRMDFNIIFY 100
SDNYSVFATHNFGNRPTKFFLNAFLYYTLSHFTGLILTSRTHPCATTSHPTRMDFNIIFY
Sbjct: 301 SDNYSVFATHNFGNRPTKFFLNAFLYYTLSHFTGLILTSRTHPCATTSHPTRMDFNIIFY 360
Query: 99 CHAKYSLDFLTNRFPFCHFSRLLNPIFPIPTF 4
CHAKYSLDFLTNRFPFCHFSRLLNPIFPIPTF
Sbjct: 361 CHAKYSLDFLTNRFPFCHFSRLLNPIFPIPTF 392