Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F28C6_10
         (447 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17533547|ref|NP_495827.1| putative protein (15.6 kD) (2I899) ...   283   4e-76
gi|39587099|emb|CAE57566.1| Hypothetical protein CBG00544 [Caeno...   121   3e-27
gi|50548313|ref|XP_501626.1| hypothetical protein [Yarrowia lipo...    45   4e-04
gi|22788712|ref|NP_690420.1| histone h3, h4 [Heliothis zea virus...    44   9e-04
gi|29374894|ref|NP_814047.1| N-acetylmuramoyl-L-alanine amidase,...    43   0.001
gi|17566006|ref|NP_505150.1| putative protein (5I806) [Caenorhab...    41   0.004
gi|38108069|gb|EAA54157.1| hypothetical protein MG02142.4 [Magna...    41   0.006
gi|7511304|pir||T34513 hypothetical protein ZK783.1 - Caenorhabd...    39   0.017
gi|1052834|gb|AAB00491.1| ORF UL119                                    39   0.017
gi|7415419|dbj|BAA93431.1| ORF1 [Staphylococcus aureus]                39   0.029
gi|21283815|ref|NP_646903.1| truncated FmtB protein [Staphylococ...    39   0.029
gi|50553722|ref|XP_504272.1| hypothetical protein [Yarrowia lipo...    38   0.049
gi|24649873|ref|NP_651318.1| CG13648-PA [Drosophila melanogaster...    38   0.049
gi|6324372|ref|NP_014442.1| Anchorage subunit of a-agglutinin of...    38   0.049
gi|39590335|emb|CAE66074.1| Hypothetical protein CBG11288 [Caeno...    38   0.049
gi|50305509|ref|XP_452714.1| unnamed protein product [Kluyveromy...    38   0.049
gi|39592304|emb|CAE75525.1| Hypothetical protein CBG23547 [Caeno...    37   0.064
gi|46122557|ref|XP_385832.1| hypothetical protein FG05656.1 [Gib...    37   0.083
gi|39591918|emb|CAE75138.1| Hypothetical protein CBG23067 [Caeno...    37   0.083
gi|39597992|emb|CAE68684.1| Hypothetical protein CBG14595 [Caeno...    37   0.083
gi|18447198|gb|AAL68190.1| GH09355p [Drosophila melanogaster]          37   0.083
gi|31204945|ref|XP_311421.1| ENSANGP00000018591 [Anopheles gambi...    37   0.083
gi|47229749|emb|CAG06945.1| unnamed protein product [Tetraodon n...    37   0.083
gi|24662885|ref|NP_648504.1| CG6004-PB [Drosophila melanogaster]...    37   0.083
gi|15925150|ref|NP_372684.1| FmtB protein [Staphylococcus aureus...    37   0.11
gi|50288227|ref|XP_446542.1| unnamed protein product [Candida gl...    37   0.11
gi|7511432|pir||T21460 hypothetical protein ZK945.10 - Caenorhab...    37   0.11
gi|6321628|ref|NP_011705.1| Putative glycosidase of the cell wal...    37   0.11
gi|39582656|emb|CAE73760.1| Hypothetical protein CBG21295 [Caeno...    37   0.11
gi|32414167|ref|XP_327563.1| hypothetical protein [Neurospora cr...    37   0.11
gi|17535137|ref|NP_496184.1| location Of Vulva defective LOV-1, ...    37   0.11
gi|48865011|ref|ZP_00318878.1| COG1388: FOG: LysM repeat [Oenoco...    37   0.11
gi|6324583|ref|NP_014652.1| Tir4p [Saccharomyces cerevisiae] >gn...    36   0.14
gi|48836146|ref|ZP_00293143.1| hypothetical protein Tfus02001330...    36   0.14
gi|24661848|ref|NP_648349.1| CG16707-PC [Drosophila melanogaster...    36   0.14
gi|49096330|ref|XP_409625.1| hypothetical protein AN5488.2 [Aspe...    36   0.14
gi|50290579|ref|XP_447722.1| unnamed protein product [Candida gl...    36   0.14
gi|46122253|ref|XP_385680.1| hypothetical protein FG05504.1 [Gib...    36   0.14
gi|39592003|emb|CAE75223.1| Hypothetical protein CBG23172 [Caeno...    36   0.14
gi|11559520|gb|AAG37995.1| extracellular matrix protein papilin ...    36   0.19
gi|17221116|gb|AAK61485.1| glycoprotein gp2 [Equine herpesvirus 1]     36   0.19
gi|17221098|gb|AAK61476.1| glycoprotein gp2 [Equine herpesvirus 1]     36   0.19
gi|29423264|gb|AAO84908.1| extracellular matrix protein papilin ...    36   0.19
gi|17221106|gb|AAK61480.1| glycoprotein gp2 [Equine herpesvirus 1]     36   0.19
gi|28572036|ref|NP_788752.1| CG33103-PA [Drosophila melanogaster...    36   0.19
gi|28572038|ref|NP_788751.1| CG33103-PB [Drosophila melanogaster...    36   0.19
gi|24661856|ref|NP_729535.1| CG16707-PA [Drosophila melanogaster...    36   0.19
gi|11278205|pir||T45462 membrane glycoprotein [imported] - equin...    36   0.19
gi|42795202|gb|AAS45959.1| envelope glycoprotein [Equine herpesv...    36   0.19
gi|17221112|gb|AAK61483.1| glycoprotein gp2 [Equine herpesvirus 1]     36   0.19
gi|17221114|gb|AAK61484.1| glycoprotein gp2 [Equine herpesvirus 1]     36   0.19
gi|46127759|ref|XP_388433.1| hypothetical protein FG08257.1 [Gib...    36   0.19
gi|24650473|ref|NP_651520.1| CG6296-PA [Drosophila melanogaster]...    36   0.19
gi|17221108|gb|AAK61481.1| glycoprotein gp2 [Equine herpesvirus 1]     36   0.19
gi|11278206|pir||T45463 membrane glycoprotein [imported] - equin...    36   0.19
gi|17221110|gb|AAK61482.1| glycoprotein gp2 [Equine herpesvirus 1]     36   0.19
gi|29423262|gb|AAO84907.1| extracellular matrix protein papilin ...    36   0.19
gi|17221104|gb|AAK61479.1| glycoprotein gp2 [Equine herpesvirus 1]     36   0.19
gi|17221102|gb|AAK61478.1| glycoprotein gp2 [Equine herpesvirus 1]     36   0.19
gi|17221100|gb|AAK61477.1| glycoprotein gp2 [Equine herpesvirus 1]     36   0.19
gi|50313312|ref|YP_053115.1| membrane glycoprotein [Equine herpe...    36   0.19
gi|50307991|ref|XP_453995.1| unnamed protein product [Kluyveromy...    35   0.24
gi|29428019|sp|Q9N4M4|ANC1_CAEEL Nuclear anchorage protein 1 (An...    35   0.24
gi|42538971|tpg|DAA04553.1| TPA: ANC-1 [Caenorhabditis elegans]        35   0.24
gi|47566068|ref|ZP_00237106.1| cell surface protein [Bacillus ce...    35   0.24
gi|17511139|ref|NP_491353.1| nuclear anchorage protein 1 family ...    35   0.24
gi|49483044|ref|YP_040268.1| clumping factor [Staphylococcus aur...    35   0.24
gi|7415524|dbj|BAA93438.1| FmtB [Staphylococcus aureus]                35   0.24
gi|5834649|emb|CAB55329.1| Mrp protein [Staphylococcus aureus]         35   0.24
gi|6164595|gb|AAF04457.1| lacunin [Manduca sexta]                      35   0.32
gi|47212491|emb|CAF95056.1| unnamed protein product [Tetraodon n...    35   0.32
gi|42734037|gb|AAS38912.1| similar to Staphylococcus aureus (str...    35   0.32
gi|45190584|ref|NP_984838.1| AEL023Cp [Eremothecium gossypii] >g...    35   0.32
gi|6321936|ref|NP_012012.1| Daughter cell-specific secreted prot...    35   0.32
gi|50548251|ref|XP_501595.1| hypothetical protein [Yarrowia lipo...    35   0.32
gi|46121725|ref|XP_385417.1| hypothetical protein FG05241.1 [Gib...    35   0.32
gi|24663552|ref|NP_648610.1| CG14120-PA [Drosophila melanogaster...    35   0.32
gi|15926464|ref|NP_373997.1| fibrinogen-binding protein A, clump...    35   0.32
gi|15923801|ref|NP_371335.1| fibrinogen-binding protein [Staphyl...    35   0.32
gi|9964588|ref|NP_065054.1| similar to laminin [Amsacta moorei e...    35   0.32
gi|34852027|ref|NP_038763.2| transformation related protein 53 b...    35   0.41
gi|46912969|emb|CAG19758.1| hypothetical protein [Photobacterium...    35   0.41
gi|46441026|gb|EAL00326.1| hypothetical protein CaO19.12983 [Can...    35   0.41
gi|20093373|ref|NP_619448.1| cell surface protein [Methanosarcin...    35   0.41
gi|31209185|ref|XP_313559.1| ENSANGP00000014029 [Anopheles gambi...    35   0.41
gi|46435549|gb|EAK94928.1| hypothetical protein CaO19.7738 [Cand...    35   0.41
gi|6319341|ref|NP_009424.1| Lectin-like protein involved in floc...    35   0.41
gi|1346018|sp|P32768|FLO1_YEAST FLOCCULATION PROTEIN FLO1 PRECUR...    35   0.41
gi|46440903|gb|EAL00204.1| hypothetical protein CaO19.5537 [Cand...    35   0.41
gi|23271157|gb|AAH35206.1| Trp53bp1 protein [Mus musculus]             35   0.41
gi|32420231|ref|XP_330559.1| hypothetical protein [Neurospora cr...    35   0.41
gi|26325766|dbj|BAC26637.1| unnamed protein product [Mus musculus]     35   0.41
gi|50290853|ref|XP_447859.1| unnamed protein product [Candida gl...    35   0.41
gi|50418601|ref|XP_457819.1| unnamed protein product [Debaryomyc...    34   0.54
gi|11360971|pir||T44967 gas-vesicle protein gvpC - Halorubrum va...    34   0.54
gi|50306747|ref|XP_453348.1| unnamed protein product [Kluyveromy...    34   0.54
gi|49120840|ref|XP_412378.1| hypothetical protein AN8241.2 [Aspe...    34   0.54
gi|17568435|ref|NP_508295.1| putative protein family member (XC1...    34   0.54
gi|418236|sp|P32515|VGLZ_EHV1K Glycoprotein precursor >gnl|BL_OR...    34   0.54
gi|17221120|gb|AAK61487.1| glycoprotein gp2 [Equine herpesvirus 4]     34   0.54
gi|17221118|gb|AAK61486.1| glycoprotein gp2 [Equine herpesvirus 4]     34   0.54
gi|17221126|gb|AAK61490.1| glycoprotein gp2 [Equine herpesvirus 4]     34   0.54
gi|49092700|ref|XP_407811.1| hypothetical protein AN3674.2 [Aspe...    34   0.54
gi|17221124|gb|AAK61489.1| glycoprotein gp2 [Equine herpesvirus 4]     34   0.54
gi|17221122|gb|AAK61488.1| glycoprotein gp2 [Equine herpesvirus 4]     34   0.54
gi|50305131|ref|XP_452524.1| unnamed protein product [Kluyveromy...    34   0.54
gi|7493929|pir||JW0067 chitinase (EC 3.2.1.14) A - Emericella ni...    34   0.54
gi|1360110|emb|CAA57972.1| mitogen-activated protein kinase 1, s...    34   0.70
gi|2146861|pir||JC5153 mitogen-activated protein kinase (EC 2.7....    34   0.70
gi|7491580|pir||T40167 hypothetical protein SPBC30B4.01c - fissi...    34   0.70
gi|23509516|ref|NP_702183.1| mitogen-activated protein kinase 1 ...    34   0.70
gi|2077900|dbj|BAA19915.1| flocculin [Saccharomyces cerevisiae]        34   0.70
gi|9629801|ref|NP_045288.1| 71 [Equine herpesvirus 4] >gnl|BL_OR...    34   0.70
gi|48095295|ref|XP_394403.1| similar to ENSANGP00000017739 [Apis...    34   0.70
gi|1262446|gb|AAC47170.1| mitogen-activated protein kinase-relat...    34   0.70
gi|50295090|ref|XP_449956.1| unnamed protein product [Candida gl...    34   0.70
gi|3892157|emb|CAA10033.1| DYS-1 protein [Caenorhabditis elegans]      34   0.70
gi|17506447|ref|NP_492946.1| DYStrophin related (417.4 kD) (dys-...    34   0.70
gi|19168493|dbj|BAB85832.1| cell wall protein Awa1p [Saccharomyc...    34   0.70
gi|48429243|sp|P87179|YB1E_SCHPO Serine-rich protein C30B4.01c p...    34   0.70
gi|39591715|emb|CAE71293.1| Hypothetical protein CBG18182 [Caeno...    34   0.70
gi|40645464|dbj|BAD06577.1| cell wall protein Awa1p [Saccharomyc...    34   0.70
gi|50554911|ref|XP_504864.1| hypothetical protein [Yarrowia lipo...    34   0.70
gi|19112318|ref|NP_595526.1| hypothetical protein [Schizosacchar...    34   0.70
gi|38102071|gb|EAA48955.1| hypothetical protein MG00613.4 [Magna...    34   0.70
gi|541336|pir||S41539 fibrinogen-binding protein - Staphylococcu...    33   0.92
gi|24571160|gb|AAN62895.1| cell wall protein; Sed1p [Saccharomyc...    33   0.92
gi|7579069|gb|AAF64243.1| hsp70 BiP [Entamoeba invadens]               33   0.92
gi|31220056|ref|XP_316870.1| ENSANGP00000017739 [Anopheles gambi...    33   0.92
gi|16079587|ref|NP_390411.1| yqfF [Bacillus subtilis subsp. subt...    33   0.92
gi|45510793|ref|ZP_00163125.1| COG2931: RTX toxins and related C...    33   0.92
gi|39595813|emb|CAE67316.1| Hypothetical protein CBG12774 [Caeno...    33   0.92
gi|49067232|ref|XP_397906.1| hypothetical protein UM00291.1 [Ust...    33   0.92
gi|6324418|ref|NP_014487.1| ORF; Yol155cp [Saccharomyces cerevis...    33   0.92
gi|24571169|gb|AAN62898.1| cell wall protein; Sed1p [Saccharomyc...    33   0.92
gi|46435796|gb|EAK95170.1| hypothetical protein CaO19.4072 [Cand...    33   0.92
gi|38105365|gb|EAA51805.1| hypothetical protein MG03400.4 [Magna...    33   0.92
gi|42525947|ref|NP_971045.1| LysM domain protein [Treponema dent...    33   0.92
gi|50552384|ref|XP_503602.1| hypothetical protein [Yarrowia lipo...    33   0.92
gi|7504248|pir||T22696 hypothetical protein F55B11.3 - Caenorhab...    33   0.92
gi|32477034|ref|NP_870028.1| hypothetical protein-signal peptide...    33   0.92
gi|18424590|ref|NP_568953.1| zinc finger (C3HC4-type RING finger...    33   0.92
gi|17557081|ref|NP_498670.1| fibrillin (3I729) [Caenorhabditis e...    33   0.92
gi|24571149|gb|AAN62891.1| cell wall protein; Sed1p [Saccharomyc...    33   0.92
gi|1177622|emb|CAA61860.1| AOF1001 [Saccharomyces cerevisiae]          33   0.92
gi|31234806|ref|XP_319120.1| ENSANGP00000009899 [Anopheles gambi...    33   0.92
gi|39589616|emb|CAE66851.1| Hypothetical protein CBG12223 [Caeno...    33   0.92
gi|50547897|ref|XP_501418.1| hypothetical protein [Yarrowia lipo...    33   1.2
gi|50731742|ref|XP_425925.1| PREDICTED: similar to zinc finger h...    33   1.2
gi|6321569|ref|NP_011646.1| Protein of unknown function; green f...    33   1.2
gi|39579687|emb|CAE56568.1| Hypothetical protein CBG24307 [Caeno...    33   1.2
gi|46432987|gb|EAK92446.1| hypothetical protein CaO19.8926 [Cand...    33   1.2
gi|48696432|ref|YP_024473.1| ORF43 [Staphylococcus phage K] >gnl...    33   1.2
gi|17568719|ref|NP_508292.1| putative protein family member (XC1...    33   1.2
gi|24662804|ref|NP_648488.1| CG6071-PA [Drosophila melanogaster]...    33   1.2
gi|5902754|sp|O13368|ALA1_CANAL AGGLUTININ-LIKE PROTEIN ALA1 PRE...    33   1.2
gi|31616158|gb|AAK38834.2| biofilm-associated surface protein [S...    33   1.2
gi|46105332|ref|XP_380470.1| hypothetical protein FG00294.1 [Gib...    33   1.2
gi|17230838|ref|NP_487386.1| hypothetical protein [Nostoc sp. PC...    33   1.2
gi|630548|pir||S43581 C28A5.6 protein (clone C28A5) - Caenorhabd...    33   1.2
gi|46580385|ref|YP_011193.1| chaperonin, 60 kDa [Desulfovibrio v...    33   1.2
gi|6324263|ref|NP_014333.1| Protein involved in the aging proces...    33   1.2
gi|17552350|ref|NP_497900.1| protein with 2 coiled coil-4 domain...    33   1.2
gi|50304929|ref|XP_452420.1| unnamed protein product [Kluyveromy...    33   1.2
gi|50308763|ref|XP_454386.1| unnamed protein product [Kluyveromy...    33   1.2
gi|30025119|gb|AAC69092.2| Hypothetical protein R09F10.3 [Caenor...    33   1.6
gi|16078002|ref|NP_388818.1| gamma-D-glutamate-meso-diaminopimel...    33   1.6
gi|21402849|ref|NP_658834.1| hypothetical protein predicted by G...    33   1.6
gi|17569353|ref|NP_509401.1| putative nuclear protein (XI913) [C...    33   1.6
gi|49480732|ref|YP_038849.1| conserved hypothetical protein [Bac...    33   1.6
gi|26331306|dbj|BAC29383.1| unnamed protein product [Mus musculus]     33   1.6
gi|48825680|ref|ZP_00286921.1| COG3883: Uncharacterized protein ...    33   1.6
gi|15617745|gb|AAL02467.1| Nuclear hormone receptor family prote...    33   1.6
gi|21229273|ref|NP_635195.1| hypothetical protein MM3171 [Methan...    33   1.6
gi|10198002|gb|AAG15135.1| nuclear receptor NHR-46 [Caenorhabdit...    33   1.6
gi|16507200|ref|NP_065937.1| ubiquitin specific protease 28 [Hom...    33   1.6
gi|10198008|gb|AAG15138.1| nuclear receptor NHR-46 [Caenorhabdit...    33   1.6
gi|7959297|dbj|BAA96039.1| KIAA1515 protein [Homo sapiens]             33   1.6
gi|9246950|gb|AAF86217.1| SagA [Enterococcus faecium] >gnl|BL_OR...    33   1.6
gi|21328339|gb|AAM48523.1| Rabphilin protein 1, isoform d [Caeno...    33   1.6
gi|46439826|gb|EAK99139.1| hypothetical protein CaO19.5736 [Cand...    33   1.6
gi|29373081|gb|AAO72529.1| agglutinin-like protein [Candida albi...    33   1.6
gi|16950406|gb|AAL32217.1| Rabphilin protein 1, isoform b [Caeno...    33   1.6
gi|29373079|gb|AAO72528.1| agglutinin-like protein [Candida albi...    33   1.6
gi|46439750|gb|EAK99064.1| hypothetical protein CaO19.13158 [Can...    33   1.6
gi|23490420|gb|EAA22203.1| PCI domain, putative [Plasmodium yoel...    33   1.6
gi|32564314|ref|NP_498467.2| RaBPHilin, RAB-3 binding protein (1...    33   1.6
gi|28869170|ref|NP_791789.1| flagellar hook-length control prote...    33   1.6
gi|15148886|gb|AAK84870.1| rabphilin [Caenorhabditis elegans] >g...    33   1.6
gi|11346533|pir||T44657 protein GP80 [imported] - bovine herpesv...    33   1.6
gi|32565814|ref|NP_500858.2| nuclear Hormone Receptor (59.1 kD) ...    33   1.6
gi|17552860|ref|NP_497557.1| putative secreted or extracellular ...    33   1.6
gi|7507975|pir||T34369 hypothetical protein T19D12.1 - Caenorhab...    33   1.6
gi|24645448|ref|NP_524294.2| CG9434-PA [Drosophila melanogaster]...    33   1.6
gi|50288683|ref|XP_446771.1| unnamed protein product [Candida gl...    33   1.6
gi|47228977|emb|CAG09492.1| unnamed protein product [Tetraodon n...    33   1.6
gi|46433961|gb|EAK93385.1| hypothetical protein CaO19.7838 [Cand...    33   1.6
gi|24661166|ref|NP_648260.1| CG13312-PA [Drosophila melanogaster...    33   1.6
gi|30019739|ref|NP_831370.1| Cell surface protein [Bacillus cere...    33   1.6
gi|10198010|gb|AAG15139.1| nuclear receptor NHR-46 [Caenorhabdit...    33   1.6
gi|46119656|ref|ZP_00177051.2| COG3378: Predicted ATPase [Crocos...    33   1.6
gi|15617744|gb|AAL02466.1| Nuclear hormone receptor family prote...    33   1.6
gi|46102608|ref|XP_380184.1| hypothetical protein FG00008.1 [Gib...    33   1.6
gi|46116978|ref|XP_384507.1| hypothetical protein FG04331.1 [Gib...    33   1.6
gi|1176716|sp|P41885|YPT7_CAEEL Hypothetical protein F37A4.7 in ...    33   1.6
gi|17536319|ref|NP_495357.1| putative protein family member (2G9...    33   1.6
gi|9313011|gb|AAD52096.2| beige protein homolog [Dictyostelium d...    33   1.6
gi|50554989|ref|XP_504903.1| hypothetical protein [Yarrowia lipo...    32   2.0
gi|1710864|sp|P54254|ATX1_MOUSE Ataxin-1 (Spinocerebellar ataxia...    32   2.0
gi|6322209|ref|NP_012284.1| GPI-anchored cell surface glycoprote...    32   2.0
gi|34870721|ref|XP_220420.2| similar to putative transcription f...    32   2.0
gi|19705547|ref|NP_599240.1| BTB (POZ) domain containing 14B; tr...    32   2.0
gi|13537106|dbj|BAB40785.1| frost protein [Drosophila melanogast...    32   2.0
gi|45198709|ref|NP_985738.1| AFR191Cp [Eremothecium gossypii] >g...    32   2.0
gi|21282493|ref|NP_645581.1| fibrinogen-binding protein [Staphyl...    32   2.0
gi|42406326|gb|AAH65928.1| USP28 protein [Homo sapiens]                32   2.0
gi|39596372|emb|CAE70010.1| Hypothetical protein CBG16424 [Caeno...    32   2.0
gi|46444332|gb|EAL03607.1| hypothetical protein CaO19.9026 [Cand...    32   2.0
gi|48139985|ref|XP_397066.1| similar to ENSANGP00000016491 [Apis...    32   2.0
gi|33859616|ref|NP_035394.1| REV3-like, catalytic subunit of DNA...    32   2.0
gi|28828259|gb|AAO50936.1| similar to Dictyostelium discoideum (...    32   2.0
gi|483238|pir||E48338 hypothetical protein orf71 - equine herpes...    32   2.0
gi|30020766|ref|NP_832397.1| Cell surface protein [Bacillus cere...    32   2.0
gi|49485657|ref|YP_042878.1| clumping factor [Staphylococcus aur...    32   2.0
gi|34872595|ref|XP_345605.1| similar to Cc2-27 [Rattus norvegicus]     32   2.0
gi|50549699|ref|XP_502320.1| hypothetical protein [Yarrowia lipo...    32   2.0
gi|30022869|ref|NP_834500.1| hypothetical protein [Bacillus cere...    32   2.7
gi|4760402|gb|AAD29126.1| variant-specific surface protein [Plas...    32   2.7
gi|47567978|ref|ZP_00238684.1| conserved hypothetical protein pr...    32   2.7
gi|38176151|ref|NP_085153.1| Lunapark; 4921514L11Rik; 2310011O18...    32   2.7
gi|50427481|ref|XP_462353.1| unnamed protein product [Debaryomyc...    32   2.7
gi|42520378|ref|NP_966293.1| hypothetical protein WD0513 [Wolbac...    32   2.7
gi|46399085|gb|AAS92204.1| 14-3-3 sigma [Gallus gallus]                32   2.7
gi|1077492|pir||S51959 hypothetical protein YAL063c - yeast (Sac...    32   2.7
gi|12697975|dbj|BAB21806.1| KIAA1715 protein [Homo sapiens]            32   2.7
gi|31222803|ref|XP_317226.1| ENSANGP00000022604 [Anopheles gambi...    32   2.7
gi|47220223|emb|CAF98988.1| unnamed protein product [Tetraodon n...    32   2.7
gi|21358339|ref|NP_649722.1| CG14598-PA [Drosophila melanogaster...    32   2.7
gi|6319255|ref|NP_009338.1| Lectin-like protein with similarity ...    32   2.7
gi|50545165|ref|XP_500120.1| hypothetical protein [Yarrowia lipo...    32   2.7
gi|16551959|dbj|BAB71207.1| unnamed protein product [Homo sapiens]     32   2.7
gi|38105202|gb|EAA51658.1| hypothetical protein MG03253.4 [Magna...    32   2.7
gi|37993693|gb|AAR06930.1| translation initiation factor B [Stre...    32   2.7
gi|25010490|ref|NP_734885.1| initiation factor 2 [Streptococcus ...    32   2.7
gi|9558369|emb|CAC00485.1| initiation Factor 2 [Streptococcus ag...    32   2.7
gi|9558387|emb|CAC00497.1| initiation factor 2 [Streptococcus ag...    32   2.7
gi|9558381|emb|CAC00493.1| initiation factor 2 [Streptococcus ag...    32   2.7
gi|46438332|gb|EAK97664.1| hypothetical protein CaO19.10912 [Can...    32   2.7
gi|22536564|ref|NP_687415.1| translation initiation factor IF-2 ...    32   2.7
gi|9367038|gb|AAF87093.1| secreted antigen SagBb [Enterococcus h...    32   2.7
gi|39583830|emb|CAE74903.1| Hypothetical protein CBG22772 [Caeno...    32   2.7
gi|1582765|prf||2119294A YFW1 gene                                     32   2.7
gi|46124257|ref|XP_386682.1| hypothetical protein FG06506.1 [Gib...    32   2.7
gi|49080906|ref|XP_403919.1| hypothetical protein UM06304.1 [Ust...    32   2.7
gi|50365262|ref|YP_053687.1| membrane-associated lipoprotein [Me...    32   2.7
gi|39580036|emb|CAE71562.1| Hypothetical protein CBG18512 [Caeno...    32   3.5
gi|2384661|gb|AAB69852.1| RNA replicase [rice hoja blanca virus]       32   3.5
gi|38111308|gb|EAA56907.1| hypothetical protein MG07262.4 [Magna...    32   3.5
gi|38083062|ref|XP_289814.2| similar to Zonadhesin [Mus musculus]      32   3.5
gi|39585368|emb|CAE61690.1| Hypothetical protein CBG05636 [Caeno...    32   3.5
gi|46443495|gb|EAL02776.1| hypothetical protein CaO19.9183 [Cand...    32   3.5
gi|12853128|dbj|BAB29650.1| unnamed protein product [Mus musculus]     32   3.5
gi|50310441|ref|XP_455240.1| unnamed protein product [Kluyveromy...    32   3.5
gi|48833294|ref|ZP_00290315.1| COG3291: FOG: PKD repeat [Magneto...    32   3.5
gi|17534551|ref|NP_494923.1| putative protein (2F299) [Caenorhab...    32   3.5
gi|41144257|ref|XP_371614.1| hypothetical protein FLJ10707 [Homo...    32   3.5
gi|46443625|gb|EAL02905.1| hypothetical protein CaO19.1616 [Cand...    32   3.5
gi|17986031|ref|NP_523441.1| CG3696-PA [Drosophila melanogaster]...    32   3.5
gi|12698059|dbj|BAB21848.1| KIAA1757 protein [Homo sapiens]            32   3.5
gi|46445626|gb|EAL04894.1| hypothetical protein CaO19.4906 [Cand...    32   3.5
gi|47228436|emb|CAG05256.1| unnamed protein product [Tetraodon n...    32   3.5
gi|42407645|dbj|BAD08759.1| ubiquitin-specific protease-like [Or...    32   3.5
gi|49095082|ref|XP_409002.1| hypothetical protein AN4865.2 [Aspe...    32   3.5
gi|50556110|ref|XP_505463.1| hypothetical protein [Yarrowia lipo...    32   3.5
gi|50304613|ref|XP_452262.1| unnamed protein product [Kluyveromy...    32   3.5
gi|46115278|ref|XP_383657.1| hypothetical protein FG03481.1 [Gib...    32   3.5
gi|49076292|ref|XP_402139.1| hypothetical protein UM04524.1 [Ust...    32   3.5
gi|349037|gb|AAA19737.1| merozoite surface antigen 2                   32   3.5
gi|15229678|ref|NP_188491.1| nucleolin, putative [Arabidopsis th...    32   3.5
gi|45360221|gb|AAS59251.1| DM_02207 [Dictyostelium minutum]            32   3.5
gi|13492037|gb|AAK28052.1| Zonadhesin >gnl|BL_ORD_ID|1548452 gi|...    32   3.5
gi|20089422|ref|NP_615497.1| conserved hypothetical protein [Met...    32   3.5
gi|42519985|ref|NP_965900.1| ankyrin repeat domain protein [Wolb...    32   3.5
gi|13095628|ref|NP_076543.1| glycoprotein gp80 [Bovine herpesvir...    32   3.5
gi|39595727|emb|CAE67230.1| Hypothetical protein CBG12669 [Caeno...    32   3.5
gi|24641644|ref|NP_727652.1| CG32644-PB [Drosophila melanogaster...    32   3.5
gi|38110219|gb|EAA55974.1| hypothetical protein MG01625.4 [Magna...    32   3.5
gi|18138515|ref|NP_542611.1| capsid protein VP [Bombyx mori dens...    32   3.5
gi|48837554|ref|ZP_00294530.1| COG1520: FOG: WD40-like repeat [M...    32   3.5
gi|46445432|gb|EAL04701.1| hypothetical protein CaO19.12372 [Can...    32   3.5
gi|28573667|ref|NP_611680.2| CG12489-PA [Drosophila melanogaster...    32   3.5
gi|2126603|pir||S61441 surface-associated protein cshA precursor...    32   3.5
gi|32563699|ref|NP_871809.1| carboxypeptidase activation peptide...    32   3.5
gi|47207122|emb|CAF91371.1| unnamed protein product [Tetraodon n...    32   3.5
gi|32418398|ref|XP_329677.1| hypothetical protein [Neurospora cr...    32   3.5
gi|50290767|ref|XP_447816.1| unnamed protein product [Candida gl...    32   3.5
gi|32407814|ref|XP_324405.1| predicted protein [Neurospora crass...    32   3.5
gi|9294322|dbj|BAB02219.1| unnamed protein product [Arabidopsis ...    32   3.5
gi|5006435|gb|AAD37500.1| kismet [Drosophila melanogaster]             32   3.5
gi|39596058|emb|CAE69694.1| Hypothetical protein CBG15949 [Caeno...    32   3.5
gi|15487230|emb|CAC69100.1| hypothetical predicted protein P1046...    32   3.5
gi|24580589|ref|NP_722617.1| CG3696-PB [Drosophila melanogaster]...    32   3.5
gi|48097264|ref|XP_391868.1| similar to hypothetical protein CaO...    32   3.5
gi|45201423|ref|NP_986993.1| AGR327Cp [Eremothecium gossypii] >g...    32   3.5
gi|23346483|ref|NP_694715.1| sperm-associated cation channel 2 [...    32   3.5
gi|6323063|ref|NP_013135.1| Mutl Homolog; Mlh2p [Saccharomyces c...    32   3.5
gi|4903269|gb|AAD32849.1| agglutinin-like protein [Candida albic...    31   4.6
gi|3130076|dbj|BAA26103.1| glucosyltransferase-S [Streptococcus ...    31   4.6
gi|3130097|dbj|BAA26115.1| glucosyltransferase-S [Streptococcus ...    31   4.6
gi|7228262|emb|CAB77164.1| adenylate cyclase [Botryotinia fuckel...    31   4.6
gi|17137536|ref|NP_477351.1| CG5216-PA [Drosophila melanogaster]...    31   4.6
gi|3928792|gb|AAC79684.1| SIR2 [Drosophila melanogaster]               31   4.6
gi|50420277|ref|XP_458671.1| unnamed protein product [Debaryomyc...    31   4.6
gi|31543309|ref|NP_080064.2| transcriptional repressor NAC1 [Mus...    31   4.6
gi|30931339|gb|AAH52706.1| Transcriptional repressor NAC1 [Mus m...    31   4.6
gi|28571214|ref|NP_727928.2| CG32580-PA [Drosophila melanogaster...    31   4.6
gi|12849997|dbj|BAB28558.1| unnamed protein product [Mus musculus]     31   4.6
gi|31241999|ref|XP_321430.1| ENSANGP00000022061 [Anopheles gambi...    31   4.6
gi|24584802|ref|NP_724046.1| CG6860-PA [Drosophila melanogaster]...    31   4.6
gi|38106862|gb|EAA53116.1| hypothetical protein MG07393.4 [Magna...    31   4.6
gi|22330695|ref|NP_177854.2| SET domain-containing protein [Arab...    31   4.6
gi|29376689|ref|NP_815843.1| glycosyl transferase, group 2 famil...    31   4.6
gi|45269279|gb|AAS56019.1| YDR077W [Saccharomyces cerevisiae]          31   4.6
gi|6320282|ref|NP_010362.1| Isolated as a suppressor of an erd2 ...    31   4.6
gi|6746586|gb|AAF27636.1| Sec12 [Pichia pastoris]                      31   4.6
gi|28603694|gb|AAO47879.1| LD07439p [Drosophila melanogaster]          31   4.6
gi|48143663|ref|XP_397458.1| similar to ENSANGP00000021655 [Apis...    31   4.6
gi|24584804|ref|NP_609834.2| CG6860-PB [Drosophila melanogaster]...    31   4.6
gi|50755210|ref|XP_414654.1| PREDICTED: similar to zinc finger, ...    31   4.6
gi|32815056|gb|AAP88031.1| structural glycoprotein [Sudan Ebola ...    31   4.6
gi|46438397|gb|EAK97728.1| hypothetical protein CaO19.3409 [Cand...    31   4.6
gi|3850135|emb|CAA21936.1| SEC12 homologue [Candida albicans]          31   4.6
gi|48995595|gb|AAQ08596.1| polymorphic membrane protein C [Chlam...    31   4.6
gi|34365062|emb|CAE45727.1| DNA topoisomerase I subunit B [Leish...    31   4.6
gi|15991642|gb|AAL12981.1| minor structural protein [Norwalk-lik...    31   4.6
gi|547938|sp|Q02496|MUC1_MOUSE Mucin 1 precursor (Polymorphic ep...    31   4.6
gi|6863054|dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]        31   4.6
gi|49079456|ref|XP_403371.1| hypothetical protein UM05756.1 [Ust...    31   4.6
gi|45552029|ref|NP_787974.2| CG33196-PB [Drosophila melanogaster...    31   4.6
gi|49067823|ref|XP_398201.1| hypothetical protein UM00586.1 [Ust...    31   4.6
gi|50257813|gb|EAL20514.1| hypothetical protein CNBE4340 [Crypto...    31   4.6
gi|12003321|gb|AAG43525.1| liver growth hormone receptor [Pelodi...    31   4.6
gi|50548685|ref|XP_501812.1| hypothetical protein [Yarrowia lipo...    31   4.6
gi|423935|pir||A46194 neurofilament protein NF-220, high-molecul...    31   4.6
gi|50545139|ref|XP_500107.1| hypothetical protein [Yarrowia lipo...    31   4.6
gi|23003282|ref|ZP_00046948.1| COG3468: Type V secretory pathway...    31   6.0
gi|32698003|emb|CAB04326.3| Hypothetical protein F36F2.3 [Caenor...    31   6.0
gi|17534737|ref|NP_495358.1| g-protein beta WD-40 repeat family ...    31   6.0
gi|17542230|ref|NP_501307.1| SH2 motif and protein kinase family...    31   6.0
gi|49097828|ref|XP_410374.1| hypothetical protein AN6237.2 [Aspe...    31   6.0
gi|4468842|emb|CAB38226.1| aggregation substance [Enterococcus f...    31   6.0
gi|34858306|ref|XP_238368.2| similar to mKIAA1757 protein [Rattu...    31   6.0
gi|7500635|pir||T21861 hypothetical protein F36F2.3 - Caenorhabd...    31   6.0
gi|11968247|ref|NP_072034.1| aggregation substance protein, puta...    31   6.0
gi|11498987|ref|NP_070220.1| branched-chain amino acid ABC trans...    31   6.0
gi|50555151|ref|XP_504984.1| YlTSR1 [Yarrowia lipolytica] >gnl|B...    31   6.0
gi|33868622|gb|AAQ55258.1| GP protein [Marburg virus]                  31   6.0
gi|17384256|emb|CAC83675.1| mucin 5 [Homo sapiens]                     31   6.0
gi|32421137|ref|XP_331012.1| predicted protein [Neurospora crass...    31   6.0
gi|40804367|ref|NP_955626.1| major capsid protein VP3 [Bombyx mo...    31   6.0
gi|32403730|ref|XP_322478.1| predicted protein [Neurospora crass...    31   6.0
gi|2459876|gb|AAC40458.1| glycoprotein precursor [Marburg virus]       31   6.0
gi|15237954|ref|NP_197240.1| pyruvate decarboxylase family prote...    31   6.0
gi|50550481|ref|XP_502713.1| hypothetical protein [Yarrowia lipo...    31   6.0
gi|19571553|emb|CAD27464.1| SPAPB15E9.01c [Schizosaccharomyces p...    31   6.0
gi|17507217|ref|NP_492424.1| retinoblastoma binding protein 6 li...    31   6.0
gi|18543303|ref|NP_570034.1| CG14419-PA [Drosophila melanogaster...    31   6.0
gi|50288051|ref|XP_446454.1| unnamed protein product [Candida gl...    31   6.0
gi|17509085|ref|NP_491665.1| nucleoporin FG repeat, Nuclear Pore...    31   6.0
gi|6322068|ref|NP_012143.1| (putative) invovled in control of DN...    31   6.0
gi|46250130|gb|AAH68816.1| MGC81421 protein [Xenopus laevis]           31   6.0
gi|20128875|ref|NP_569927.1| CG14796-PA [Drosophila melanogaster...    31   6.0
gi|32410143|ref|XP_325552.1| predicted protein [Neurospora crass...    31   6.0
gi|23334615|ref|NP_694837.1| capsid protein [Bombyx mori densovi...    31   6.0
gi|31208407|ref|XP_313170.1| ENSANGP00000024051 [Anopheles gambi...    31   6.0
gi|19115042|ref|NP_594130.1| putative glucoamylase I (alpha-1,4-...    31   6.0
gi|49477283|ref|YP_035806.1| conserved hypothetical protein [Bac...    31   6.0
gi|21399510|ref|NP_655495.1| hypothetical protein predicted by G...    31   6.0
gi|39597324|emb|CAE59552.1| Hypothetical protein CBG02948 [Caeno...    31   6.0
gi|40804368|ref|NP_955627.1| major capsid protein VP1 [Bombyx mo...    31   6.0
gi|39583863|emb|CAE63953.1| Hypothetical protein CBG08535 [Caeno...    31   6.0
gi|50259780|gb|EAL22448.1| hypothetical protein CNBB3270 [Crypto...    31   6.0
gi|41688299|dbj|BAD08652.1| transmembrane protein 7 [Sus scrofa]       31   6.0
gi|49073328|ref|XP_400891.1| hypothetical protein UM03276.1 [Ust...    31   6.0
gi|3608402|gb|AAC35928.1| Orfde14 [Enterococcus faecalis]              31   6.0
gi|17553756|ref|NP_497705.1| myosin heavy like (3E497) [Caenorha...    31   6.0
gi|29249063|gb|EAA40583.1| GLP_609_41156_47407 [Giardia lamblia ...    31   6.0
gi|15822816|dbj|BAB69038.1| kinesin-related protein [Homo sapiens]     30   7.8
gi|17568717|ref|NP_508293.1| putative protein family member (XC1...    30   7.8
gi|30584877|gb|AAP36693.1| Homo sapiens kinesin family member 1B...    30   7.8
gi|28279129|gb|AAH45875.1| Wu:fi20g04 protein [Danio rerio]            30   7.8
gi|46433959|gb|EAK93383.1| hypothetical protein CaO19.7836 [Cand...    30   7.8
gi|7486998|pir||T00458 hypothetical protein T14N5.15 - Arabidops...    30   7.8
gi|46433991|gb|EAK93414.1| hypothetical protein CaO19.206 [Candi...    30   7.8
gi|31240471|ref|XP_320649.1| ENSANGP00000021199 [Anopheles gambi...    30   7.8
gi|17544054|ref|NP_500240.1| putative secreted or extracellular ...    30   7.8
gi|50747892|ref|XP_421033.1| PREDICTED: similar to Mucin 5B prec...    30   7.8
gi|27708038|ref|XP_216076.1| similar to fatty acid transport pro...    30   7.8
gi|50417993|gb|AAH77807.1| Unknown (protein for IMAGE:5155330) [...    30   7.8
gi|13925307|gb|AAK49332.1| kinesin superfamily protein KIF1B [Ho...    30   7.8
gi|49069678|ref|XP_399128.1| hypothetical protein UM01513.1 [Ust...    30   7.8
gi|41393563|ref|NP_055889.2| kinesin family member 1B isoform b;...    30   7.8
gi|24582321|ref|NP_609072.1| CG11321-PA [Drosophila melanogaster...    30   7.8
gi|48475129|gb|AAT44198.1| unknown protein [Oryza sativa (japoni...    30   7.8
gi|38108254|gb|EAA54307.1| hypothetical protein MG02292.4 [Magna...    30   7.8
gi|50254943|gb|EAL17683.1| hypothetical protein CNBL1980 [Crypto...    30   7.8
gi|15672897|ref|NP_267071.1| teichoic acid ABC transporter ATP b...    30   7.8
gi|24582323|ref|NP_723214.1| CG11321-PB [Drosophila melanogaster...    30   7.8
gi|28829866|gb|AAL96754.2| similar to Dictyostelium discoideum (...    30   7.8
gi|50553250|ref|XP_504035.1| hypothetical protein [Yarrowia lipo...    30   7.8
gi|39583089|emb|CAE60629.1| Hypothetical protein CBG04272 [Caeno...    30   7.8
gi|39596701|emb|CAE63320.1| Hypothetical protein CBG07711 [Caeno...    30   7.8
gi|5326752|gb|AAD42033.1| agglutinin-like protein 6 [Candida alb...    30   7.8
gi|23023493|ref|ZP_00062728.1| hypothetical protein [Leuconostoc...    30   7.8
gi|19424152|ref|NP_598197.1| mucin 10 [Rattus norvegicus] >gnl|B...    30   7.8
gi|10434679|dbj|BAB14341.1| unnamed protein product [Homo sapiens]     30   7.8
gi|15721939|ref|NP_031385.2| cancer susceptibility candidate 3; ...    30   7.8
gi|24656879|ref|NP_647819.1| CG14973-PA [Drosophila melanogaster...    30   7.8
gi|42560524|sp|O60333|KF1B_HUMAN Kinesin-like protein KIF1B (Klp)      30   7.8
gi|29421178|dbj|BAA25517.2| KIAA0591 protein [Homo sapiens]            30   7.8
gi|46226813|gb|EAK87779.1| hypothetical protein with signal pept...    30   7.8
gi|50545265|ref|XP_500170.1| hypothetical protein [Yarrowia lipo...    30   7.8
gi|14189882|dbj|BAB55870.1| complement C1 inhibitor [Pan troglod...    30   7.8
gi|49075438|ref|XP_401784.1| hypothetical protein UM04169.1 [Ust...    30   7.8
gi|46431186|gb|EAK90801.1| hypothetical protein CaO19.1811 [Cand...    30   7.8
gi|34784556|gb|AAH56938.1| Ehmt1 protein [Mus musculus]                30   7.8
gi|24286732|gb|AAN46886.1| nucleotide exchange factor RasGEF R [...    30   7.8
gi|42657782|ref|XP_376630.1| similar to Nuclear envelope pore me...    30   7.8
gi|32452989|gb|AAP82647.1| Hypothetical protein K06A9.1c [Caenor...    30   7.8
gi|39589588|emb|CAE66823.1| Hypothetical protein CBG12190 [Caeno...    30   7.8
gi|6752866|gb|AAF27912.1| mutanase [Penicillium purpurogenum]          30   7.8
gi|6688939|emb|CAB65345.1| PR7 protein [Plasmodium falciparum]         30   7.8
gi|46435696|gb|EAK95072.1| hypothetical protein CaO19.8201 [Cand...    30   7.8
gi|23613725|ref|NP_704746.1| hypothetical protein [Plasmodium fa...    30   7.8
gi|17384254|emb|CAC83674.1| mucin 5 [Homo sapiens]                     30   7.8
gi|12655125|gb|AAH01415.1| KIF1B protein [Homo sapiens] >gnl|BL_...    30   7.8
gi|31236440|ref|XP_319410.1| ENSANGP00000002836 [Anopheles gambi...    30   7.8
gi|50308125|ref|XP_454063.1| unnamed protein product [Kluyveromy...    30   7.8
gi|38100722|gb|EAA47815.1| hypothetical protein MG03058.4 [Magna...    30   7.8
gi|1498641|gb|AAB06444.1| extracellular matrix associated protei...    30   7.8
gi|23396860|sp|P70663|SPL1_MOUSE SPARC-like protein 1 precursor ...    30   7.8
gi|24646232|ref|NP_650174.1| CG4066-PA [Drosophila melanogaster]...    30   7.8
gi|7656879|ref|NP_055238.1| ALL1 fused gene from 5q31 [Homo sapi...    30   7.8
gi|28829905|gb|AAM44312.2| hypothetical protein [Dictyostelium d...    30   7.8
gi|30021434|ref|NP_833065.1| hypothetical protein [Bacillus cere...    30   7.8
gi|33086672|gb|AAP92648.1| Cc2-27 [Rattus norvegicus]                  30   7.8


>gi|17533547|ref|NP_495827.1| putative protein (15.6 kD) (2I899)
           [Caenorhabditis elegans]
 gi|7500056|pir||T21488 hypothetical protein F28C6.10 -
           Caenorhabditis elegans
 gi|3876359|emb|CAA92676.1| Hypothetical protein F28C6.10
           [Caenorhabditis elegans]
          Length = 148

 Score =  283 bits (725), Expect = 4e-76
 Identities = 148/148 (100%), Positives = 148/148 (100%)
 Frame = +1

Query: 1   MMTGRGFIFTVIMGLLLAVSTVTCADAVETEGSIVSGSEDVKVSLESKSTVAPTSSVTQK 180
           MMTGRGFIFTVIMGLLLAVSTVTCADAVETEGSIVSGSEDVKVSLESKSTVAPTSSVTQK
Sbjct: 1   MMTGRGFIFTVIMGLLLAVSTVTCADAVETEGSIVSGSEDVKVSLESKSTVAPTSSVTQK 60

Query: 181 SSNSTESPETDSTEKGDDEKPITEQIRTYIEDSVKSVKHAISKIGKFVGELFEPSNSTVP 360
           SSNSTESPETDSTEKGDDEKPITEQIRTYIEDSVKSVKHAISKIGKFVGELFEPSNSTVP
Sbjct: 61  SSNSTESPETDSTEKGDDEKPITEQIRTYIEDSVKSVKHAISKIGKFVGELFEPSNSTVP 120

Query: 361 SNRSTTVPVASTVIPSVVSSLPNDKDQK 444
           SNRSTTVPVASTVIPSVVSSLPNDKDQK
Sbjct: 121 SNRSTTVPVASTVIPSVVSSLPNDKDQK 148




[DB home][top]