Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F28C6_6
(429 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535693|ref|NP_495823.1| ribosomal Protein, Large subunit (1... 284 2e-76
gi|39587102|emb|CAE57569.1| Hypothetical protein CBG00547 [Caeno... 274 2e-73
gi|32564329|ref|NP_871965.1| ribosomal Protein, Large subunit (r... 211 3e-54
gi|17535691|ref|NP_495824.1| ribosomal Protein, Large subunit (1... 211 3e-54
gi|50754890|ref|XP_414531.1| PREDICTED: similar to ribosomal pro... 183 6e-46
gi|4506621|ref|NP_000978.1| ribosomal protein L26; 60S ribosomal... 183 6e-46
gi|48145773|emb|CAG33109.1| RPL26 [Homo sapiens] 183 6e-46
gi|38079500|ref|XP_357445.1| similar to 60S ribosomal protein L2... 183 6e-46
gi|49670406|gb|AAH75124.1| Unknown (protein for MGC:81816) [Xeno... 182 2e-45
gi|27729769|ref|XP_217729.1| similar to 60S ribosomal protein L2... 182 2e-45
gi|7705813|ref|NP_057177.1| ribosomal protein L26-like 1; riboso... 181 2e-45
gi|292435|gb|AAA60279.1| ribosomal protein L26 181 3e-45
gi|21357853|ref|NP_649070.1| CG6846-PA [Drosophila melanogaster]... 181 4e-45
gi|132827|sp|P12749|RL26_RAT 60S ribosomal protein L26 >gnl|BL_O... 180 5e-45
gi|27662758|ref|XP_235494.1| similar to 60S ribosomal protein L2... 179 1e-44
gi|15293919|gb|AAK95152.1| ribosomal protein L26 [Ictalurus punc... 177 3e-44
gi|47559079|gb|AAT35583.1| ribosomal protein L26 [Pectinaria gou... 175 2e-43
gi|47085861|ref|NP_998278.1| zgc:66190 [Danio rerio] >gnl|BL_ORD... 175 2e-43
gi|31340368|sp|Q95WA0|RL26_LITLI 60S ribosomal protein L26 >gnl|... 174 3e-43
gi|28189641|dbj|BAC56435.1| similar to ribosomal protein L26 [Bo... 174 3e-43
gi|34851284|ref|XP_226231.2| similar to 60S ribosomal protein L2... 173 6e-43
gi|22758898|gb|AAN05608.1| ribosomal protein L26 [Argopecten irr... 173 6e-43
gi|42542698|gb|AAH66316.1| Unknown (protein for MGC:87181) [Homo... 173 8e-43
gi|42659888|ref|XP_374987.1| similar to 60S ribosomal protein L2... 169 1e-41
gi|20853839|ref|XP_138109.1| similar to 60S ribosomal protein L2... 168 2e-41
gi|31207009|ref|XP_312471.1| ENSANGP00000022122 [Anopheles gambi... 167 5e-41
gi|24266959|gb|AAN52378.1| ribosomal protein L26 [Branchiostoma ... 166 7e-41
gi|34895672|ref|NP_909185.1| putative ribosomal protein L26 [Ory... 166 1e-40
gi|38080739|ref|XP_288716.2| similar to ribosomal protein L26 [M... 164 4e-40
gi|15229631|ref|NP_190560.1| 60S ribosomal protein L26 (RPL26A) ... 164 5e-40
gi|15240766|ref|NP_201552.1| 60S ribosomal protein L26 (RPL26B) ... 163 8e-40
gi|15213774|gb|AAK92162.1| ribosomal protein L26 [Spodoptera fru... 163 8e-40
gi|1350701|sp|P47832|RL26_CHICK 60S ribosomal protein L26 >gnl|B... 161 2e-39
gi|49532902|dbj|BAD26686.1| Ribosomal protein L26 [Plutella xylo... 161 3e-39
gi|48098427|ref|XP_392059.1| similar to ribosomal protein L26 [A... 160 5e-39
gi|47216819|emb|CAG10141.1| unnamed protein product [Tetraodon n... 158 3e-38
gi|38075288|ref|XP_285386.2| similar to 60S ribosomal protein L2... 156 7e-38
gi|38080426|ref|XP_357491.1| similar to ribosomal protein L26 [M... 156 1e-37
gi|32404420|ref|XP_322823.1| hypothetical protein [Neurospora cr... 155 2e-37
gi|50260188|gb|EAL22849.1| hypothetical protein CNBB0700 [Crypto... 154 3e-37
gi|38047793|gb|AAR09799.1| similar to Drosophila melanogaster CG... 154 4e-37
gi|3747050|gb|AAC64166.1| ribosomal protein L26 [Zea mays] 154 5e-37
gi|49085122|ref|XP_404707.1| conserved hypothetical protein [Asp... 153 8e-37
gi|46138661|ref|XP_391021.1| conserved hypothetical protein [Gib... 152 1e-36
gi|3914740|sp|Q39411|RL26_BRARA 60S ribosomal protein L26 >gnl|B... 150 5e-36
gi|21627827|emb|CAD37159.1| putative ribosomal protein [Aspergil... 150 5e-36
gi|6321471|ref|NP_011548.1| Protein component of the large (60S)... 149 9e-36
gi|45185504|ref|NP_983220.1| ACL184Cp [Eremothecium gossypii] >g... 149 9e-36
gi|1710575|sp|P53221|R262_YEAST 60S RIBOSOMAL PROTEIN L26-B (YL33) 148 2e-35
gi|6323376|ref|NP_013448.1| Protein component of the large (60S)... 147 4e-35
gi|49258859|pdb|1S1I|U Chain U, Structure Of The Ribosomal 80s-E... 147 4e-35
gi|49077142|ref|XP_402470.1| hypothetical protein UM04855.1 [Ust... 146 8e-35
gi|38103519|gb|EAA50206.1| hypothetical protein MG03965.4 [Magna... 145 2e-34
gi|50303699|ref|XP_451792.1| unnamed protein product [Kluyveromy... 144 3e-34
gi|32400995|gb|AAP80703.1| ribosome protein L26 [Griffithsia jap... 144 5e-34
gi|50287959|ref|XP_446408.1| unnamed protein product [Candida gl... 141 3e-33
gi|23479596|gb|EAA16382.1| ribosomal protein L24 [Plasmodium yoe... 140 4e-33
gi|19112446|ref|NP_595654.1| 60s ribosomal protein l26 [Schizosa... 136 8e-32
gi|16805215|ref|NP_473243.1| 60S ribosomal protein L26, putative... 135 2e-31
gi|34857542|ref|XP_344908.1| similar to 60S ribosomal protein L2... 134 3e-31
gi|46229335|gb|EAK90184.1| 60S ribosomal protein L26, transcript... 133 9e-31
gi|50553622|ref|XP_504222.1| hypothetical protein [Yarrowia lipo... 127 6e-29
gi|38089125|ref|XP_357865.1| similar to 60S ribosomal protein L2... 122 2e-27
gi|32399038|emb|CAD98278.1| ribosomal protein L26, probable [Cry... 115 1e-25
gi|50418271|ref|XP_457769.1| unnamed protein product [Debaryomyc... 113 9e-25
gi|20303025|gb|AAM18965.1| 60S ribosomal protein L26 [Leishmania... 112 1e-24
gi|14591523|ref|NP_143604.1| 50S ribosomal protein L24 [Pyrococc... 103 1e-21
gi|13124815|sp|O59429|RL24_PYRHO 50S ribosomal protein L24P 102 1e-21
gi|14600658|ref|NP_147176.1| 50S ribosomal protein L24 [Aeropyru... 102 2e-21
gi|18978185|ref|NP_579542.1| LSU ribosomal protein L24P [Pyrococ... 101 3e-21
gi|14520546|ref|NP_126021.1| LSU ribosomal protein L24P [Pyrococ... 101 4e-21
gi|46397696|sp|Q8U010|RL24_PYRFU 50S ribosomal protein L24P 101 4e-21
gi|34932639|ref|XP_225658.2| similar to ribosomal protein L26 [R... 98 4e-20
gi|38079923|ref|XP_194996.2| similar to 60S ribosomal protein L2... 98 4e-20
gi|29728789|ref|XP_291428.1| similar to ribosomal protein L26 [H... 96 2e-19
gi|20094655|ref|NP_614502.1| Ribosomal protein L24 [Methanopyrus... 96 2e-19
gi|15678045|ref|NP_275159.1| ribosomal protein L26 (E.coli L24) ... 92 2e-18
gi|18313979|ref|NP_560646.1| ribosomal protein L24 [Pyrobaculum ... 90 9e-18
gi|1173001|sp|P41960|RL26_BRUPA 60S ribosomal protein L26 88 4e-17
gi|572610|emb|CAA57759.1| ribosomal protein L26 [Brugia pahangi] 88 4e-17
gi|15668644|ref|NP_247442.1| LSU ribosomal protein L24P (rplX) [... 88 4e-17
gi|46397698|sp|Q975J1|RL24_SULTO 50S ribosomal protein L24P 86 2e-16
gi|19173363|ref|NP_597166.1| 60S RIBOSOMAL PROTEIN L26 [Encephal... 82 2e-15
gi|11499498|ref|NP_070739.1| LSU ribosomal protein L24P (rpl24P)... 82 2e-15
gi|15897613|ref|NP_342218.1| LSU ribosomal protein L24AB (rpl24A... 82 3e-15
gi|50303697|ref|XP_451791.1| unnamed protein product [Kluyveromy... 81 4e-15
gi|48838694|ref|ZP_00295634.1| COG0198: Ribosomal protein L24 [M... 80 7e-15
gi|29250307|gb|EAA41803.1| GLP_111_22147_22554 [Giardia lamblia ... 79 2e-14
gi|132817|sp|P14034|RL24_METVA 50S ribosomal protein L24P >gnl|B... 79 3e-14
gi|45358973|ref|NP_988530.1| LSU ribosomal protein L24P [Methano... 77 7e-14
gi|21228237|ref|NP_634159.1| LSU ribosomal protein L24P [Methano... 74 5e-13
gi|41615050|ref|NP_963548.1| NEQ257 [Nanoarchaeum equitans Kin4-... 73 1e-12
gi|20089953|ref|NP_616028.1| ribosomal protein L24p [Methanosarc... 73 1e-12
gi|132816|sp|P10972|RL24_HALMA 50S ribosomal protein L24P (Hmal2... 72 3e-12
gi|10120936|pdb|1FFK|Q Chain Q, Crystal Structure Of The Large R... 71 4e-12
gi|38073884|ref|XP_356612.1| similar to ribosomal protein L26 [M... 68 3e-11
gi|226204|prf||1501256A ribosomal protein L16 67 6e-11
gi|48477723|ref|YP_023429.1| large subunit ribosomal protein L24... 60 7e-09
gi|16082661|ref|NP_394716.1| 50S ribosomal protein L24 [Thermopl... 59 2e-08
gi|13541167|ref|NP_110855.1| 50S ribosomal protein L24 [Thermopl... 58 5e-08
gi|15790643|ref|NP_280467.1| 50S ribosomal protein L24P; Rpl24p ... 55 4e-07
gi|38074693|ref|XP_140912.2| similar to 60S ribosomal protein L2... 54 5e-07
gi|7674220|sp|O05633|RL24_SULAC 50S ribosomal protein L24P >gnl|... 54 7e-07
gi|13812144|ref|NP_113271.1| 60S ribosomal protein L26 [Guillard... 54 7e-07
gi|48852514|ref|ZP_00306700.1| COG0198: Ribosomal protein L24 [F... 54 9e-07
gi|1350702|sp|P49629|RL26_XENLA 60S RIBOSOMAL PROTEIN L26 >gnl|B... 50 1e-05
gi|15920631|ref|NP_376300.1| 85aa long hypothetical 50S ribosoma... 49 3e-05
gi|34869109|ref|XP_221497.2| similar to HMG-box transcription fa... 46 2e-04
gi|29250306|gb|EAA41802.1| GLP_111_22446_21862 [Giardia lamblia ... 42 0.003
gi|46314377|ref|ZP_00214963.1| hypothetical protein Bcepa0200367... 40 0.008
gi|46324189|ref|ZP_00224551.1| COG1196: Chromosome segregation A... 40 0.013
gi|48729648|ref|ZP_00263398.1| COG5295: Autotransporter adhesin ... 39 0.022
gi|15605246|ref|NP_220032.1| L24 Ribosomal Protein [Chlamydia tr... 38 0.038
gi|28394159|dbj|BAC57032.1| protomycinolide IV synthase 5 [Micro... 37 0.065
gi|15835418|ref|NP_297177.1| ribosomal protein L24 [Chlamydia mu... 37 0.085
gi|46579725|ref|YP_010533.1| ribosomal protein L24 [Desulfovibri... 37 0.085
gi|33519669|ref|NP_878501.1| 50S ribosomal subunit protein L24 [... 35 0.25
gi|12382242|gb|AAG53080.1| 5'A2rel-related protein [Leishmania d... 35 0.32
gi|20808649|ref|NP_623820.1| Ribosomal protein L24 [Thermoanaero... 35 0.32
gi|32414699|ref|XP_327829.1| hypothetical protein [Neurospora cr... 34 0.55
gi|48860557|ref|ZP_00314475.1| COG2931: RTX toxins and related C... 34 0.72
gi|47227721|emb|CAG09718.1| unnamed protein product [Tetraodon n... 34 0.72
gi|50843062|ref|YP_056289.1| phage associated protein [Propionib... 34 0.72
gi|18311376|ref|NP_563310.1| 50S ribosomal protein L24 [Clostrid... 34 0.72
gi|33585764|gb|AAH55690.1| RIKEN cDNA 5730593F17 [Mus musculus] 34 0.72
gi|49073328|ref|XP_400891.1| hypothetical protein UM03276.1 [Ust... 34 0.72
gi|27369768|ref|NP_766131.1| RIKEN cDNA 5730593F17 [Mus musculus... 34 0.72
gi|48860561|ref|ZP_00314477.1| COG3210: Large exoproteins involv... 33 0.94
gi|46394384|tpg|DAA05130.1| TPA: WRKY transcription factor 65 [O... 33 0.94
gi|50547187|ref|XP_501063.1| hypothetical protein [Yarrowia lipo... 33 0.94
gi|7674250|sp|Q9ZI41|RL24_AQUPY 50S ribosomal protein L24 >gnl|B... 33 0.94
gi|5163215|gb|AAD40594.1| ribosomal protein L24 [Leptospira inte... 33 0.94
gi|24213450|ref|NP_710931.1| ribosomal protein L24 [Leptospira i... 33 0.94
gi|37531276|ref|NP_919940.1| putative reverse transcriptase [Ory... 33 0.94
gi|28898404|ref|NP_798009.1| putative calcium-binding outer memb... 33 0.94
gi|34499630|ref|NP_903845.1| 50S ribosomal protein L24 [Chromoba... 33 1.2
gi|15805351|ref|NP_294045.1| ribosomal protein L24 [Deinococcus ... 33 1.2
gi|31044144|gb|AAP42856.1| NanA2 [Streptomyces nanchangensis] 33 1.2
gi|33603349|ref|NP_890909.1| putative pyruvate ferredoxin/flavod... 33 1.6
gi|47226943|emb|CAG05835.1| unnamed protein product [Tetraodon n... 33 1.6
gi|21674987|ref|NP_663052.1| ribosomal protein L24 [Chlorobium t... 33 1.6
gi|32475069|ref|NP_868063.1| probable 50S ribosomal protein L24 ... 33 1.6
gi|15606755|ref|NP_214135.1| ribosomal protein L24 [Aquifex aeol... 33 1.6
gi|23466953|ref|ZP_00122539.1| COG5295: Autotransporter adhesin ... 33 1.6
gi|33598409|ref|NP_886052.1| putative pyruvate ferredoxin/flavod... 33 1.6
gi|48849402|ref|ZP_00303645.1| COG1404: Subtilisin-like serine p... 33 1.6
gi|15892918|ref|NP_360632.1| 50S ribosomal protein L24 [Ricketts... 32 2.1
gi|34811572|pdb|1PNU|S Chain S, Crystal Structure Of A Streptomy... 32 2.1
gi|50287211|ref|XP_446035.1| unnamed protein product [Candida gl... 32 2.1
gi|49067755|ref|XP_398167.1| hypothetical protein UM00552.1 [Ust... 32 2.7
gi|50508930|dbj|BAD31835.1| putative high-affinity potassium tra... 32 2.7
gi|40787391|gb|AAR90269.1| polyketide synthase [Cochliobolus het... 32 2.7
gi|46432883|gb|EAK92346.1| hypothetical protein CaO19.6352 [Cand... 32 2.7
gi|42630383|ref|ZP_00155927.1| COG0198: Ribosomal protein L24 [H... 32 2.7
gi|15599448|ref|NP_252942.1| 50S ribosomal protein L24 [Pseudomo... 32 2.7
gi|49074828|gb|AAT49431.1| PA4252 [synthetic construct] 32 2.7
gi|15676021|ref|NP_273151.1| pyruvate kinase II [Neisseria menin... 32 2.7
gi|34101173|gb|AAQ57625.1| IcsA [Shigella flexneri] 32 2.7
gi|13449130|ref|NP_085346.1| invasion protein [Shigella flexneri... 32 2.7
gi|31983529|ref|NP_858315.1| VirG [Shigella flexneri 2a] >gnl|BL... 32 2.7
gi|31231947|ref|XP_318620.1| ENSANGP00000020885 [Anopheles gambi... 32 2.7
gi|50290763|ref|XP_447814.1| unnamed protein product [Candida gl... 32 2.7
gi|15824022|dbj|BAB69235.1| modular polyketide synthase [Strepto... 32 3.6
gi|46321597|ref|ZP_00221973.1| COG0457: FOG: TPR repeat [Burkhol... 32 3.6
gi|32474935|ref|NP_867929.1| conserved hypothetical protein-poss... 32 3.6
gi|13507915|ref|NP_109864.1| ribosomal protein L24 [Mycoplasma p... 32 3.6
gi|50876024|emb|CAG35864.1| probable 50S ribosomal protein L24 [... 32 3.6
gi|23470616|ref|ZP_00125948.1| COG0198: Ribosomal protein L24 [P... 32 3.6
gi|23104450|ref|ZP_00090914.1| COG0198: Ribosomal protein L24 [A... 32 3.6
gi|28867865|ref|NP_790484.1| ribosomal protein L24 [Pseudomonas ... 32 3.6
gi|48728500|ref|ZP_00262258.1| COG0198: Ribosomal protein L24 [P... 32 3.6
gi|48835044|ref|ZP_00292046.1| COG0198: Ribosomal protein L24 [T... 32 3.6
gi|26987206|ref|NP_742631.1| ribosomal protein L24 [Pseudomonas ... 32 3.6
gi|29833726|ref|NP_828360.1| putative modular polyketide synthas... 32 3.6
gi|23612132|ref|NP_703712.1| 50S ribosomal subunit L24, putative... 31 4.7
gi|7242953|dbj|BAA92537.1| KIAA1299 protein [Homo sapiens] 31 4.7
gi|22023997|ref|NP_523701.2| CG10897-PA [Drosophila melanogaster... 31 4.7
gi|7513272|pir||T08662 probable signaling mediator DKFZp547G1110... 31 4.7
gi|12642598|gb|AAK00302.1| Toutatis [Drosophila melanogaster] 31 4.7
gi|29839872|ref|NP_828978.1| ribosomal protein L24 [Chlamydophil... 31 4.7
gi|16272730|ref|NP_438948.1| ribosomal protein L24 [Haemophilus ... 31 4.7
gi|50122940|ref|YP_052107.1| 50S ribosomal subunit protein L24 [... 31 4.7
gi|12045015|ref|NP_072825.1| ribosomal protein L24 (rpL24) [Myco... 31 4.7
gi|48095684|ref|XP_394506.1| similar to finger protein - African... 31 4.7
gi|48866804|ref|ZP_00320520.1| COG0198: Ribosomal protein L24 [H... 31 4.7
gi|17549890|ref|NP_523230.1| PROBABLE RNA POLYMERASE SIGMA N (SI... 31 4.7
gi|50759584|ref|XP_429675.1| PREDICTED: hypothetical protein XP_... 31 4.7
gi|41400384|gb|AAS07044.1| plus agglutinin [Chlamydomonas reinha... 31 4.7
gi|50416870|gb|AAH77155.1| Unknown (protein for MGC:91938) [Dani... 31 6.1
gi|45550729|ref|NP_649995.2| CG6303-PA [Drosophila melanogaster]... 31 6.1
gi|16765456|ref|NP_461071.1| putative secretion protein [Salmone... 31 6.1
gi|16761055|ref|NP_456672.1| putative efflux system protein [Sal... 31 6.1
gi|48892637|ref|ZP_00325988.1| COG0149: Triosephosphate isomeras... 31 6.1
gi|34853415|ref|XP_215432.2| similar to WASP family 1 [Rattus no... 31 6.1
gi|48860559|ref|ZP_00314476.1| COG2931: RTX toxins and related C... 31 6.1
gi|16944400|emb|CAD11366.1| conserved hypothetical protein [Neur... 31 6.1
gi|37528532|ref|NP_931877.1| 50S ribosomal protein L24 [Photorha... 31 6.1
gi|15803836|ref|NP_289870.1| 50S ribosomal subunit protein L24 [... 31 6.1
gi|15604494|ref|NP_221012.1| 50S RIBOSOMAL PROTEIN L24 (rplX) [R... 31 6.1
gi|16762854|ref|NP_458471.1| 50S ribosomal subunit protein L24 [... 31 6.1
gi|33357919|pdb|1P85|S Chain S, Real Space Refined Coordinates O... 31 6.1
gi|16120558|ref|NP_403871.1| 50S ribosomal protein L24 [Yersinia... 31 6.1
gi|24114587|ref|NP_709097.1| 50S ribosomal subunit protein L24 [... 31 6.1
gi|32405014|ref|XP_323120.1| hypothetical protein [Neurospora cr... 31 6.1
gi|26249897|ref|NP_755937.1| 50S ribosomal protein L24 [Escheric... 31 6.1
gi|32405916|ref|XP_323571.1| predicted protein [Neurospora crass... 31 6.1
gi|22036500|gb|AAM89670.1| IcsA [Escherichia coli] >gnl|BL_ORD_I... 31 6.1
gi|22036482|gb|AAM89661.1| IcsA [Shigella sonnei] 31 6.1
gi|22036496|gb|AAM89668.1| IcsA [Escherichia coli] 31 6.1
gi|22036426|gb|AAM89633.1| IcsA [Shigella boydii] 31 6.1
gi|22036464|gb|AAM89652.1| IcsA [Shigella dysenteriae] 31 6.1
gi|22036484|gb|AAM89662.1| IcsA [Shigella sonnei] 31 6.1
gi|22036466|gb|AAM89653.1| IcsA [Shigella dysenteriae] 31 6.1
gi|22036470|gb|AAM89655.1| IcsA [Shigella dysenteriae] 31 6.1
gi|22036420|gb|AAM89630.1| IcsA [Shigella boydii] 31 6.1
gi|22036488|gb|AAM89664.1| IcsA [Shigella sonnei] 31 6.1
gi|22036454|gb|AAM89647.1| IcsA [Shigella flexneri] 31 6.1
gi|22036498|gb|AAM89669.1| IcsA [Escherichia coli] 31 6.1
gi|22036476|gb|AAM89658.1| IcsA [Shigella sonnei] 31 6.1
gi|22036418|gb|AAM89629.1| IcsA [Shigella boydii] 31 6.1
gi|22036460|gb|AAM89650.1| IcsA [Shigella dysenteriae] 31 6.1
gi|22036434|gb|AAM89637.1| IcsA [Shigella boydii] >gnl|BL_ORD_ID... 31 6.1
gi|22036486|gb|AAM89663.1| IcsA [Shigella sonnei] 31 6.1
gi|22036492|gb|AAM89666.1| IcsA [Escherichia coli] 31 6.1
gi|22036430|gb|AAM89635.1| IcsA [Shigella boydii] 31 6.1
gi|22036480|gb|AAM89660.1| IcsA [Shigella sonnei] 31 6.1
gi|22036422|gb|AAM89631.1| IcsA [Shigella boydii] >gnl|BL_ORD_ID... 31 6.1
gi|22036456|gb|AAM89648.1| IcsA [Shigella flexneri] 31 6.1
gi|22036478|gb|AAM89659.1| IcsA [Shigella sonnei] 31 6.1
gi|22036446|gb|AAM89643.1| IcsA [Shigella flexneri] 31 6.1
gi|22036416|gb|AAM89628.1| IcsA [Shigella boydii] >gnl|BL_ORD_ID... 31 6.1
gi|22036494|gb|AAM89667.1| IcsA [Escherichia coli] 31 6.1
gi|38100098|gb|EAA47280.1| predicted protein [Magnaporthe grisea... 31 6.1
gi|21410275|gb|AAH31061.1| Minichromosome maintenance protein 4 ... 30 8.0
gi|33469917|ref|NP_877423.1| minichromosome maintenance protein ... 30 8.0
gi|48832416|ref|ZP_00289451.1| COG3210: Large exoproteins involv... 30 8.0
gi|34533749|dbj|BAC86793.1| unnamed protein product [Homo sapiens] 30 8.0
gi|21324774|dbj|BAB99397.1| Hypothetical membrane protein [Coryn... 30 8.0
gi|48862941|ref|ZP_00316836.1| COG2931: RTX toxins and related C... 30 8.0
gi|32456022|ref|NP_862024.1| RB149 [Ruegeria sp. PR1b] >gnl|BL_O... 30 8.0
gi|19553208|ref|NP_601210.1| hypothetical membrane protein [Cory... 30 8.0
gi|2754697|gb|AAC52018.1| MCM4 [Homo sapiens] 30 8.0
gi|46432957|gb|EAK92417.1| hypothetical protein CaO19.13709 [Can... 30 8.0
gi|23508629|ref|NP_701298.1| hypothetical protein [Plasmodium fa... 30 8.0
gi|46580462|ref|YP_011270.1| conserved hypothetical protein [Des... 30 8.0
gi|15829047|ref|NP_326407.1| 50S RIBOSOMAL PROTEIN L24 [Mycoplas... 30 8.0
gi|46123493|ref|XP_386300.1| hypothetical protein FG06124.1 [Gib... 30 8.0
gi|46432987|gb|EAK92446.1| hypothetical protein CaO19.8926 [Cand... 30 8.0
gi|34485720|ref|NP_899243.1| echinoderm microtubule associated p... 30 8.0
gi|21430572|gb|AAM50964.1| RE07981p [Drosophila melanogaster] 30 8.0
gi|17530873|ref|NP_511100.1| CG12653-PA [Drosophila melanogaster... 30 8.0
gi|739242|prf||2002362A Sp1 protein 30 8.0
>gi|17535693|ref|NP_495823.1| ribosomal Protein, Large subunit (16.1
kD) (rpl-26) [Caenorhabditis elegans]
gi|2500310|sp|Q19869|RL26_CAEEL 60S ribosomal protein L26
gi|7500062|pir||T21486 hypothetical protein F28C6.7a -
Caenorhabditis elegans
gi|3876357|emb|CAA92674.1| Hypothetical protein F28C6.7a
[Caenorhabditis elegans]
Length = 142
Score = 284 bits (727), Expect = 2e-76
Identities = 142/142 (100%), Positives = 142/142 (100%)
Frame = +1
Query: 1 MKVNPFVSSDSGKSRKAHFNAPSHERRRIMSAPLTKELRTKHGIRAIPIRTDDEVVVMRG 180
MKVNPFVSSDSGKSRKAHFNAPSHERRRIMSAPLTKELRTKHGIRAIPIRTDDEVVVMRG
Sbjct: 1 MKVNPFVSSDSGKSRKAHFNAPSHERRRIMSAPLTKELRTKHGIRAIPIRTDDEVVVMRG 60
Query: 181 RHKGNTGRVLRCYRKKFVIHIDKITREKANGSTVHIGIHPSKVAITKLKLDKDRRALVER 360
RHKGNTGRVLRCYRKKFVIHIDKITREKANGSTVHIGIHPSKVAITKLKLDKDRRALVER
Sbjct: 61 RHKGNTGRVLRCYRKKFVIHIDKITREKANGSTVHIGIHPSKVAITKLKLDKDRRALVER 120
Query: 361 KAAGRSRVTGILKGKHTDETVN 426
KAAGRSRVTGILKGKHTDETVN
Sbjct: 121 KAAGRSRVTGILKGKHTDETVN 142