Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F28C6_7
(321 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535691|ref|NP_495824.1| ribosomal Protein, Large subunit (1... 216 7e-56
gi|32564329|ref|NP_871965.1| ribosomal Protein, Large subunit (r... 213 1e-54
gi|17535693|ref|NP_495823.1| ribosomal Protein, Large subunit (1... 211 4e-54
gi|39587102|emb|CAE57569.1| Hypothetical protein CBG00547 [Caeno... 204 4e-52
gi|7705813|ref|NP_057177.1| ribosomal protein L26-like 1; riboso... 146 9e-35
gi|50754890|ref|XP_414531.1| PREDICTED: similar to ribosomal pro... 146 1e-34
gi|38079500|ref|XP_357445.1| similar to 60S ribosomal protein L2... 146 1e-34
gi|42542698|gb|AAH66316.1| Unknown (protein for MGC:87181) [Homo... 146 1e-34
gi|28189641|dbj|BAC56435.1| similar to ribosomal protein L26 [Bo... 146 1e-34
gi|4506621|ref|NP_000978.1| ribosomal protein L26; 60S ribosomal... 146 1e-34
gi|48145773|emb|CAG33109.1| RPL26 [Homo sapiens] 146 1e-34
gi|292435|gb|AAA60279.1| ribosomal protein L26 146 1e-34
gi|49670406|gb|AAH75124.1| Unknown (protein for MGC:81816) [Xeno... 144 3e-34
gi|27662758|ref|XP_235494.1| similar to 60S ribosomal protein L2... 144 3e-34
gi|27729769|ref|XP_217729.1| similar to 60S ribosomal protein L2... 144 3e-34
gi|47216819|emb|CAG10141.1| unnamed protein product [Tetraodon n... 144 6e-34
gi|31340368|sp|Q95WA0|RL26_LITLI 60S ribosomal protein L26 >gnl|... 143 8e-34
gi|132827|sp|P12749|RL26_RAT 60S ribosomal protein L26 >gnl|BL_O... 143 1e-33
gi|47559079|gb|AAT35583.1| ribosomal protein L26 [Pectinaria gou... 142 1e-33
gi|21357853|ref|NP_649070.1| CG6846-PA [Drosophila melanogaster]... 141 3e-33
gi|15293919|gb|AAK95152.1| ribosomal protein L26 [Ictalurus punc... 141 4e-33
gi|47085861|ref|NP_998278.1| zgc:66190 [Danio rerio] >gnl|BL_ORD... 140 5e-33
gi|22758898|gb|AAN05608.1| ribosomal protein L26 [Argopecten irr... 139 1e-32
gi|34851284|ref|XP_226231.2| similar to 60S ribosomal protein L2... 138 3e-32
gi|38080739|ref|XP_288716.2| similar to ribosomal protein L26 [M... 137 4e-32
gi|24266959|gb|AAN52378.1| ribosomal protein L26 [Branchiostoma ... 134 6e-31
gi|20853839|ref|XP_138109.1| similar to 60S ribosomal protein L2... 134 6e-31
gi|42659888|ref|XP_374987.1| similar to 60S ribosomal protein L2... 134 6e-31
gi|31207009|ref|XP_312471.1| ENSANGP00000022122 [Anopheles gambi... 133 1e-30
gi|15240766|ref|NP_201552.1| 60S ribosomal protein L26 (RPL26B) ... 131 3e-30
gi|34895672|ref|NP_909185.1| putative ribosomal protein L26 [Ory... 131 3e-30
gi|3747050|gb|AAC64166.1| ribosomal protein L26 [Zea mays] 130 5e-30
gi|15229631|ref|NP_190560.1| 60S ribosomal protein L26 (RPL26A) ... 130 9e-30
gi|46138661|ref|XP_391021.1| conserved hypothetical protein [Gib... 128 3e-29
gi|38080426|ref|XP_357491.1| similar to ribosomal protein L26 [M... 128 3e-29
gi|32404420|ref|XP_322823.1| hypothetical protein [Neurospora cr... 127 6e-29
gi|38075288|ref|XP_285386.2| similar to 60S ribosomal protein L2... 127 7e-29
gi|15213774|gb|AAK92162.1| ribosomal protein L26 [Spodoptera fru... 126 1e-28
gi|48098427|ref|XP_392059.1| similar to ribosomal protein L26 [A... 125 2e-28
gi|49085122|ref|XP_404707.1| conserved hypothetical protein [Asp... 125 2e-28
gi|50260188|gb|EAL22849.1| hypothetical protein CNBB0700 [Crypto... 125 2e-28
gi|49532902|dbj|BAD26686.1| Ribosomal protein L26 [Plutella xylo... 124 4e-28
gi|21627827|emb|CAD37159.1| putative ribosomal protein [Aspergil... 124 5e-28
gi|1350701|sp|P47832|RL26_CHICK 60S ribosomal protein L26 >gnl|B... 124 5e-28
gi|49077142|ref|XP_402470.1| hypothetical protein UM04855.1 [Ust... 124 5e-28
gi|6321471|ref|NP_011548.1| Protein component of the large (60S)... 123 8e-28
gi|1710575|sp|P53221|R262_YEAST 60S RIBOSOMAL PROTEIN L26-B (YL33) 122 2e-27
gi|45185504|ref|NP_983220.1| ACL184Cp [Eremothecium gossypii] >g... 122 2e-27
gi|6323376|ref|NP_013448.1| Protein component of the large (60S)... 121 4e-27
gi|49258859|pdb|1S1I|U Chain U, Structure Of The Ribosomal 80s-E... 121 4e-27
gi|38103519|gb|EAA50206.1| hypothetical protein MG03965.4 [Magna... 120 9e-27
gi|32400995|gb|AAP80703.1| ribosome protein L26 [Griffithsia jap... 119 2e-26
gi|50303699|ref|XP_451792.1| unnamed protein product [Kluyveromy... 118 3e-26
gi|50287959|ref|XP_446408.1| unnamed protein product [Candida gl... 118 3e-26
gi|3914740|sp|Q39411|RL26_BRARA 60S ribosomal protein L26 >gnl|B... 118 3e-26
gi|23479596|gb|EAA16382.1| ribosomal protein L24 [Plasmodium yoe... 118 3e-26
gi|38047793|gb|AAR09799.1| similar to Drosophila melanogaster CG... 115 3e-25
gi|19112446|ref|NP_595654.1| 60s ribosomal protein l26 [Schizosa... 114 5e-25
gi|20303025|gb|AAM18965.1| 60S ribosomal protein L26 [Leishmania... 112 1e-24
gi|16805215|ref|NP_473243.1| 60S ribosomal protein L26, putative... 111 4e-24
gi|46229335|gb|EAK90184.1| 60S ribosomal protein L26, transcript... 109 2e-23
gi|34857542|ref|XP_344908.1| similar to 60S ribosomal protein L2... 107 8e-23
gi|50553622|ref|XP_504222.1| hypothetical protein [Yarrowia lipo... 105 3e-22
gi|32399038|emb|CAD98278.1| ribosomal protein L26, probable [Cry... 92 3e-18
gi|14591523|ref|NP_143604.1| 50S ribosomal protein L24 [Pyrococc... 91 4e-18
gi|13124815|sp|O59429|RL24_PYRHO 50S ribosomal protein L24P 91 6e-18
gi|18978185|ref|NP_579542.1| LSU ribosomal protein L24P [Pyrococ... 90 1e-17
gi|46397696|sp|Q8U010|RL24_PYRFU 50S ribosomal protein L24P 90 1e-17
gi|38089125|ref|XP_357865.1| similar to 60S ribosomal protein L2... 89 3e-17
gi|14520546|ref|NP_126021.1| LSU ribosomal protein L24P [Pyrococ... 88 4e-17
gi|50418271|ref|XP_457769.1| unnamed protein product [Debaryomyc... 88 4e-17
gi|34932639|ref|XP_225658.2| similar to ribosomal protein L26 [R... 88 5e-17
gi|1173001|sp|P41960|RL26_BRUPA 60S ribosomal protein L26 88 5e-17
gi|572610|emb|CAA57759.1| ribosomal protein L26 [Brugia pahangi] 88 5e-17
gi|20094655|ref|NP_614502.1| Ribosomal protein L24 [Methanopyrus... 88 5e-17
gi|38079923|ref|XP_194996.2| similar to 60S ribosomal protein L2... 87 8e-17
gi|14600658|ref|NP_147176.1| 50S ribosomal protein L24 [Aeropyru... 86 1e-16
gi|15678045|ref|NP_275159.1| ribosomal protein L26 (E.coli L24) ... 84 5e-16
gi|15668644|ref|NP_247442.1| LSU ribosomal protein L24P (rplX) [... 82 3e-15
gi|18313979|ref|NP_560646.1| ribosomal protein L24 [Pyrobaculum ... 82 4e-15
gi|11499498|ref|NP_070739.1| LSU ribosomal protein L24P (rpl24P)... 74 6e-13
gi|29250307|gb|EAA41803.1| GLP_111_22147_22554 [Giardia lamblia ... 72 4e-12
gi|15897613|ref|NP_342218.1| LSU ribosomal protein L24AB (rpl24A... 71 6e-12
gi|132817|sp|P14034|RL24_METVA 50S ribosomal protein L24P >gnl|B... 70 8e-12
gi|46397698|sp|Q975J1|RL24_SULTO 50S ribosomal protein L24P 70 1e-11
gi|45358973|ref|NP_988530.1| LSU ribosomal protein L24P [Methano... 69 2e-11
gi|48838694|ref|ZP_00295634.1| COG0198: Ribosomal protein L24 [M... 67 1e-10
gi|29728789|ref|XP_291428.1| similar to ribosomal protein L26 [H... 65 3e-10
gi|132816|sp|P10972|RL24_HALMA 50S ribosomal protein L24P (Hmal2... 65 4e-10
gi|41615050|ref|NP_963548.1| NEQ257 [Nanoarchaeum equitans Kin4-... 65 4e-10
gi|10120936|pdb|1FFK|Q Chain Q, Crystal Structure Of The Large R... 64 6e-10
gi|19173363|ref|NP_597166.1| 60S RIBOSOMAL PROTEIN L26 [Encephal... 64 8e-10
gi|21228237|ref|NP_634159.1| LSU ribosomal protein L24P [Methano... 62 2e-09
gi|20089953|ref|NP_616028.1| ribosomal protein L24p [Methanosarc... 61 6e-09
gi|226204|prf||1501256A ribosomal protein L16 60 8e-09
gi|50303697|ref|XP_451791.1| unnamed protein product [Kluyveromy... 59 2e-08
gi|38074693|ref|XP_140912.2| similar to 60S ribosomal protein L2... 52 2e-06
gi|13812144|ref|NP_113271.1| 60S ribosomal protein L26 [Guillard... 52 3e-06
gi|16082661|ref|NP_394716.1| 50S ribosomal protein L24 [Thermopl... 52 4e-06
gi|1350702|sp|P49629|RL26_XENLA 60S RIBOSOMAL PROTEIN L26 >gnl|B... 50 1e-05
gi|13541167|ref|NP_110855.1| 50S ribosomal protein L24 [Thermopl... 49 2e-05
gi|48477723|ref|YP_023429.1| large subunit ribosomal protein L24... 48 4e-05
gi|38073884|ref|XP_356612.1| similar to ribosomal protein L26 [M... 46 2e-04
gi|15790643|ref|NP_280467.1| 50S ribosomal protein L24P; Rpl24p ... 45 3e-04
gi|48852514|ref|ZP_00306700.1| COG0198: Ribosomal protein L24 [F... 45 4e-04
gi|34869109|ref|XP_221497.2| similar to HMG-box transcription fa... 44 6e-04
gi|29250306|gb|EAA41802.1| GLP_111_22446_21862 [Giardia lamblia ... 42 0.004
gi|7674220|sp|O05633|RL24_SULAC 50S ribosomal protein L24P >gnl|... 40 0.009
gi|46579725|ref|YP_010533.1| ribosomal protein L24 [Desulfovibri... 37 0.099
gi|28394159|dbj|BAC57032.1| protomycinolide IV synthase 5 [Micro... 36 0.22
gi|12382242|gb|AAG53080.1| 5'A2rel-related protein [Leishmania d... 35 0.38
gi|20808649|ref|NP_623820.1| Ribosomal protein L24 [Thermoanaero... 35 0.49
gi|32414699|ref|XP_327829.1| hypothetical protein [Neurospora cr... 34 0.64
gi|5163215|gb|AAD40594.1| ribosomal protein L24 [Leptospira inte... 34 0.64
gi|24213450|ref|NP_710931.1| ribosomal protein L24 [Leptospira i... 34 0.64
gi|49073328|ref|XP_400891.1| hypothetical protein UM03276.1 [Ust... 34 0.84
gi|50843062|ref|YP_056289.1| phage associated protein [Propionib... 34 0.84
gi|33585764|gb|AAH55690.1| RIKEN cDNA 5730593F17 [Mus musculus] 34 0.84
gi|27369768|ref|NP_766131.1| RIKEN cDNA 5730593F17 [Mus musculus... 34 0.84
gi|15597083|ref|NP_250577.1| DNA polymerase II [Pseudomonas aeru... 34 0.84
gi|37531276|ref|NP_919940.1| putative reverse transcriptase [Ory... 33 1.1
gi|50547187|ref|XP_501063.1| hypothetical protein [Yarrowia lipo... 33 1.1
gi|46394384|tpg|DAA05130.1| TPA: WRKY transcription factor 65 [O... 33 1.1
gi|7674250|sp|Q9ZI41|RL24_AQUPY 50S ribosomal protein L24 >gnl|B... 33 1.1
gi|34499630|ref|NP_903845.1| 50S ribosomal protein L24 [Chromoba... 33 1.4
gi|15835418|ref|NP_297177.1| ribosomal protein L24 [Chlamydia mu... 33 1.4
gi|15605246|ref|NP_220032.1| L24 Ribosomal Protein [Chlamydia tr... 33 1.4
gi|12002012|gb|AAG43149.1| DNA polymerase II [Pseudomonas fluore... 33 1.9
gi|48860557|ref|ZP_00314475.1| COG2931: RTX toxins and related C... 33 1.9
gi|47226943|emb|CAG05835.1| unnamed protein product [Tetraodon n... 33 1.9
gi|32475069|ref|NP_868063.1| probable 50S ribosomal protein L24 ... 33 1.9
gi|21674987|ref|NP_663052.1| ribosomal protein L24 [Chlorobium t... 33 1.9
gi|15606755|ref|NP_214135.1| ribosomal protein L24 [Aquifex aeol... 33 1.9
gi|48860561|ref|ZP_00314477.1| COG3210: Large exoproteins involv... 33 1.9
gi|15920631|ref|NP_376300.1| 85aa long hypothetical 50S ribosoma... 33 1.9
gi|50287211|ref|XP_446035.1| unnamed protein product [Candida gl... 32 2.5
gi|15892918|ref|NP_360632.1| 50S ribosomal protein L24 [Ricketts... 32 2.5
gi|33519669|ref|NP_878501.1| 50S ribosomal subunit protein L24 [... 32 2.5
gi|48729904|ref|ZP_00263653.1| COG0417: DNA polymerase elongatio... 32 2.5
gi|23612132|ref|NP_703712.1| 50S ribosomal subunit L24, putative... 32 3.2
gi|49067755|ref|XP_398167.1| hypothetical protein UM00552.1 [Ust... 32 3.2
gi|50290763|ref|XP_447814.1| unnamed protein product [Candida gl... 32 3.2
gi|31044144|gb|AAP42856.1| NanA2 [Streptomyces nanchangensis] 32 3.2
gi|31231947|ref|XP_318620.1| ENSANGP00000020885 [Anopheles gambi... 32 3.2
gi|50508930|dbj|BAD31835.1| putative high-affinity potassium tra... 32 3.2
gi|49074828|gb|AAT49431.1| PA4252 [synthetic construct] 32 3.2
gi|15599448|ref|NP_252942.1| 50S ribosomal protein L24 [Pseudomo... 32 3.2
gi|46432883|gb|EAK92346.1| hypothetical protein CaO19.6352 [Cand... 32 3.2
gi|46321597|ref|ZP_00221973.1| COG0457: FOG: TPR repeat [Burkhol... 32 4.2
gi|40787391|gb|AAR90269.1| polyketide synthase [Cochliobolus het... 32 4.2
gi|29833726|ref|NP_828360.1| putative modular polyketide synthas... 32 4.2
gi|15824022|dbj|BAB69235.1| modular polyketide synthase [Strepto... 32 4.2
gi|23470616|ref|ZP_00125948.1| COG0198: Ribosomal protein L24 [P... 32 4.2
gi|23104450|ref|ZP_00090914.1| COG0198: Ribosomal protein L24 [A... 32 4.2
gi|28867865|ref|NP_790484.1| ribosomal protein L24 [Pseudomonas ... 32 4.2
gi|48728500|ref|ZP_00262258.1| COG0198: Ribosomal protein L24 [P... 32 4.2
gi|26987206|ref|NP_742631.1| ribosomal protein L24 [Pseudomonas ... 32 4.2
gi|13507915|ref|NP_109864.1| ribosomal protein L24 [Mycoplasma p... 32 4.2
gi|50876024|emb|CAG35864.1| probable 50S ribosomal protein L24 [... 32 4.2
gi|48095684|ref|XP_394506.1| similar to finger protein - African... 31 5.5
gi|17549890|ref|NP_523230.1| PROBABLE RNA POLYMERASE SIGMA N (SI... 31 5.5
gi|50759584|ref|XP_429675.1| PREDICTED: hypothetical protein XP_... 31 5.5
gi|29839872|ref|NP_828978.1| ribosomal protein L24 [Chlamydophil... 31 5.5
gi|7513272|pir||T08662 probable signaling mediator DKFZp547G1110... 31 5.5
gi|42630383|ref|ZP_00155927.1| COG0198: Ribosomal protein L24 [H... 31 5.5
gi|7242953|dbj|BAA92537.1| KIAA1299 protein [Homo sapiens] 31 5.5
gi|12045015|ref|NP_072825.1| ribosomal protein L24 (rpL24) [Myco... 31 5.5
gi|48866804|ref|ZP_00320520.1| COG0198: Ribosomal protein L24 [H... 31 5.5
gi|50122940|ref|YP_052107.1| 50S ribosomal subunit protein L24 [... 31 5.5
gi|18311376|ref|NP_563310.1| 50S ribosomal protein L24 [Clostrid... 31 5.5
gi|41400384|gb|AAS07044.1| plus agglutinin [Chlamydomonas reinha... 31 5.5
gi|34853415|ref|XP_215432.2| similar to WASP family 1 [Rattus no... 31 7.1
gi|50416870|gb|AAH77155.1| Unknown (protein for MGC:91938) [Dani... 31 7.1
gi|16944400|emb|CAD11366.1| conserved hypothetical protein [Neur... 31 7.1
gi|32041959|ref|ZP_00139542.1| COG0417: DNA polymerase elongatio... 31 7.1
gi|32405014|ref|XP_323120.1| hypothetical protein [Neurospora cr... 31 7.1
gi|32405916|ref|XP_323571.1| predicted protein [Neurospora crass... 31 7.1
gi|15604494|ref|NP_221012.1| 50S RIBOSOMAL PROTEIN L24 (rplX) [R... 31 7.1
gi|29135017|ref|NP_803647.1| ORF081 [Pseudomonas phage phiKZ] >g... 31 7.1
gi|33357919|pdb|1P85|S Chain S, Real Space Refined Coordinates O... 31 7.1
gi|37528532|ref|NP_931877.1| 50S ribosomal protein L24 [Photorha... 31 7.1
gi|15803836|ref|NP_289870.1| 50S ribosomal subunit protein L24 [... 31 7.1
gi|16762854|ref|NP_458471.1| 50S ribosomal subunit protein L24 [... 31 7.1
gi|16120558|ref|NP_403871.1| 50S ribosomal protein L24 [Yersinia... 31 7.1
gi|24114587|ref|NP_709097.1| 50S ribosomal subunit protein L24 [... 31 7.1
gi|26249897|ref|NP_755937.1| 50S ribosomal protein L24 [Escheric... 31 7.1
gi|32041961|ref|ZP_00139544.1| COG0417: DNA polymerase elongatio... 31 7.1
gi|21324774|dbj|BAB99397.1| Hypothetical membrane protein [Coryn... 30 9.3
gi|2754697|gb|AAC52018.1| MCM4 [Homo sapiens] 30 9.3
gi|46123493|ref|XP_386300.1| hypothetical protein FG06124.1 [Gib... 30 9.3
gi|50757723|ref|XP_415621.1| PREDICTED: similar to Exocyst compl... 30 9.3
gi|34811572|pdb|1PNU|S Chain S, Crystal Structure Of A Streptomy... 30 9.3
gi|34533749|dbj|BAC86793.1| unnamed protein product [Homo sapiens] 30 9.3
gi|19553208|ref|NP_601210.1| hypothetical membrane protein [Cory... 30 9.3
gi|15805351|ref|NP_294045.1| ribosomal protein L24 [Deinococcus ... 30 9.3
gi|17530873|ref|NP_511100.1| CG12653-PA [Drosophila melanogaster... 30 9.3
gi|16272730|ref|NP_438948.1| ribosomal protein L24 [Haemophilus ... 30 9.3
gi|739242|prf||2002362A Sp1 protein 30 9.3
gi|34485720|ref|NP_899243.1| echinoderm microtubule associated p... 30 9.3
gi|46432987|gb|EAK92446.1| hypothetical protein CaO19.8926 [Cand... 30 9.3
gi|46432957|gb|EAK92417.1| hypothetical protein CaO19.13709 [Can... 30 9.3
gi|21410275|gb|AAH31061.1| Minichromosome maintenance protein 4 ... 30 9.3
gi|33469917|ref|NP_877423.1| minichromosome maintenance protein ... 30 9.3
>gi|17535691|ref|NP_495824.1| ribosomal Protein, Large subunit (12.1
kD) (rpl-26) [Caenorhabditis elegans]
gi|7500063|pir||T21490 hypothetical protein F28C6.7b -
Caenorhabditis elegans
gi|3876361|emb|CAA92678.1| Hypothetical protein F28C6.7b
[Caenorhabditis elegans]
Length = 106
Score = 216 bits (551), Expect = 7e-56
Identities = 106/106 (100%), Positives = 106/106 (100%)
Frame = +1
Query: 1 MKVNPFVSSDSGKSRKAHFNAPSHERRRIMSAPLTKELRTKHGIRAIPIRTDDEVVVMRG 180
MKVNPFVSSDSGKSRKAHFNAPSHERRRIMSAPLTKELRTKHGIRAIPIRTDDEVVVMRG
Sbjct: 1 MKVNPFVSSDSGKSRKAHFNAPSHERRRIMSAPLTKELRTKHGIRAIPIRTDDEVVVMRG 60
Query: 181 RHKGNTGRVLRCYRKKFVIHIDKITREKANGSTVHIGIHPSKVRFV 318
RHKGNTGRVLRCYRKKFVIHIDKITREKANGSTVHIGIHPSKVRFV
Sbjct: 61 RHKGNTGRVLRCYRKKFVIHIDKITREKANGSTVHIGIHPSKVRFV 106